Basic Information | |
---|---|
Family ID | F052789 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 142 |
Average Sequence Length | 43 residues |
Representative Sequence | VSNALGLLAFVVYVAAIVGAAAGVTWVVVRLTPSRKPDSSAGS |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 142 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 85.21 % |
% of genes near scaffold ends (potentially truncated) | 17.61 % |
% of genes from short scaffolds (< 2000 bps) | 77.46 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (71.831 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (13.380 % of family members) |
Environment Ontology (ENVO) | Unclassified (16.197 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.859 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 142 Family Scaffolds |
---|---|---|
PF01262 | AlaDh_PNT_C | 40.14 |
PF05222 | AlaDh_PNT_N | 14.79 |
PF01676 | Metalloenzyme | 10.56 |
PF03129 | HGTP_anticodon | 2.11 |
PF14016 | DUF4232 | 1.41 |
PF00117 | GATase | 1.41 |
PF06210 | DUF1003 | 0.70 |
PF00293 | NUDIX | 0.70 |
PF06418 | CTP_synth_N | 0.70 |
PF06831 | H2TH | 0.70 |
PF04472 | SepF | 0.70 |
PF01149 | Fapy_DNA_glyco | 0.70 |
PF00664 | ABC_membrane | 0.70 |
PF02875 | Mur_ligase_C | 0.70 |
PF02896 | PEP-utilizers_C | 0.70 |
PF02581 | TMP-TENI | 0.70 |
PF02518 | HATPase_c | 0.70 |
PF01266 | DAO | 0.70 |
PF11755 | DUF3311 | 0.70 |
PF11967 | RecO_N | 0.70 |
PF13411 | MerR_1 | 0.70 |
PF00300 | His_Phos_1 | 0.70 |
COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
---|---|---|---|
COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.11 |
COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 2.11 |
COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.11 |
COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.11 |
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 1.41 |
COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 0.70 |
COG0504 | CTP synthase (UTP-ammonia lyase) | Nucleotide transport and metabolism [F] | 0.70 |
COG1799 | Cell division protein SepF/YlmF, interacts with FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 0.70 |
COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 71.83 % |
Unclassified | root | N/A | 28.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig59317 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
2170459013|GO6OHWN01EBS4W | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
2189573002|GZIGXIF01B9HWT | Not Available | 503 | Open in IMG/M |
2189573002|GZIGXIF02JSARS | Not Available | 506 | Open in IMG/M |
3300000956|JGI10216J12902_111462369 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300001535|A3PFW1_10070113 | All Organisms → cellular organisms → Bacteria | 6415 | Open in IMG/M |
3300002568|C688J35102_118990707 | Not Available | 622 | Open in IMG/M |
3300003321|soilH1_10009801 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
3300004479|Ga0062595_100180855 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
3300004479|Ga0062595_101135443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 687 | Open in IMG/M |
3300004479|Ga0062595_102415168 | Not Available | 522 | Open in IMG/M |
3300004479|Ga0062595_102478162 | Not Available | 517 | Open in IMG/M |
3300004479|Ga0062595_102511385 | Not Available | 514 | Open in IMG/M |
3300005174|Ga0066680_10201861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1257 | Open in IMG/M |
3300005176|Ga0066679_10929307 | Not Available | 546 | Open in IMG/M |
3300005177|Ga0066690_11022633 | Not Available | 518 | Open in IMG/M |
3300005178|Ga0066688_10079477 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
3300005178|Ga0066688_10456541 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300005179|Ga0066684_10028604 | All Organisms → cellular organisms → Bacteria | 3004 | Open in IMG/M |
3300005187|Ga0066675_10167579 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
3300005329|Ga0070683_101245251 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300005332|Ga0066388_100027827 | All Organisms → cellular organisms → Bacteria | 5206 | Open in IMG/M |
3300005332|Ga0066388_100941848 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300005332|Ga0066388_103401965 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300005332|Ga0066388_105780237 | Not Available | 626 | Open in IMG/M |
3300005332|Ga0066388_106427324 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300005336|Ga0070680_100326579 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
3300005337|Ga0070682_100160082 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
3300005434|Ga0070709_10062209 | All Organisms → cellular organisms → Bacteria | 2379 | Open in IMG/M |
3300005435|Ga0070714_100012820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6699 | Open in IMG/M |
3300005436|Ga0070713_102375354 | Not Available | 513 | Open in IMG/M |
3300005439|Ga0070711_100644367 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 888 | Open in IMG/M |
3300005467|Ga0070706_101197984 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300005524|Ga0070737_10029470 | All Organisms → cellular organisms → Bacteria | 3461 | Open in IMG/M |
3300005529|Ga0070741_10257263 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
3300005529|Ga0070741_11168290 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300005530|Ga0070679_100102021 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
3300005532|Ga0070739_10000744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 56460 | Open in IMG/M |
3300005532|Ga0070739_10004237 | All Organisms → cellular organisms → Bacteria | 17131 | Open in IMG/M |
3300005532|Ga0070739_10007869 | All Organisms → cellular organisms → Bacteria | 11127 | Open in IMG/M |
3300005532|Ga0070739_10173020 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300005537|Ga0070730_10004153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12817 | Open in IMG/M |
3300005537|Ga0070730_11037544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 510 | Open in IMG/M |
3300005538|Ga0070731_10000267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 84996 | Open in IMG/M |
3300005569|Ga0066705_10366267 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300005607|Ga0070740_10308767 | Not Available | 631 | Open in IMG/M |
3300005615|Ga0070702_101360078 | Not Available | 579 | Open in IMG/M |
3300005764|Ga0066903_100052055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5001 | Open in IMG/M |
3300005764|Ga0066903_100109451 | All Organisms → cellular organisms → Bacteria | 3780 | Open in IMG/M |
3300005764|Ga0066903_100442761 | All Organisms → cellular organisms → Bacteria | 2166 | Open in IMG/M |
3300005764|Ga0066903_100638840 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
3300005764|Ga0066903_101279553 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300005764|Ga0066903_101474814 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
3300005764|Ga0066903_101619831 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300005764|Ga0066903_104580086 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300005764|Ga0066903_106046726 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300005841|Ga0068863_100447993 | Not Available | 1267 | Open in IMG/M |
3300005897|Ga0075281_1024831 | Not Available | 854 | Open in IMG/M |
3300005904|Ga0075280_10118564 | Not Available | 555 | Open in IMG/M |
3300006173|Ga0070716_101261913 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300006806|Ga0079220_11558243 | Not Available | 570 | Open in IMG/M |
3300006854|Ga0075425_102571624 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300009093|Ga0105240_10023103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8234 | Open in IMG/M |
3300009176|Ga0105242_12196743 | Not Available | 597 | Open in IMG/M |
3300010043|Ga0126380_10340835 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300010152|Ga0126318_10508831 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300010154|Ga0127503_10291198 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
3300010154|Ga0127503_10507691 | Not Available | 1411 | Open in IMG/M |
3300010154|Ga0127503_11068245 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300010360|Ga0126372_11645276 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300010362|Ga0126377_10930916 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300010371|Ga0134125_10481089 | Not Available | 1376 | Open in IMG/M |
3300010373|Ga0134128_10035490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5840 | Open in IMG/M |
3300010373|Ga0134128_10742932 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300010373|Ga0134128_12084813 | Not Available | 624 | Open in IMG/M |
3300010376|Ga0126381_103219879 | Not Available | 645 | Open in IMG/M |
3300010396|Ga0134126_10285001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1944 | Open in IMG/M |
3300010401|Ga0134121_13214291 | Not Available | 505 | Open in IMG/M |
3300012200|Ga0137382_10505270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 859 | Open in IMG/M |
3300012206|Ga0137380_10208547 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
3300012359|Ga0137385_11001213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 689 | Open in IMG/M |
3300012971|Ga0126369_13185765 | Not Available | 537 | Open in IMG/M |
3300013104|Ga0157370_11520915 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300014497|Ga0182008_10073708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1679 | Open in IMG/M |
3300017924|Ga0187820_1177631 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300017930|Ga0187825_10095495 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300017937|Ga0187809_10156574 | Not Available | 791 | Open in IMG/M |
3300017947|Ga0187785_10021887 | All Organisms → cellular organisms → Bacteria | 2268 | Open in IMG/M |
3300017959|Ga0187779_10223764 | Not Available | 1184 | Open in IMG/M |
3300017994|Ga0187822_10162622 | Not Available | 724 | Open in IMG/M |
3300018433|Ga0066667_12054966 | Not Available | 527 | Open in IMG/M |
3300018468|Ga0066662_10502952 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300018468|Ga0066662_12441700 | Not Available | 550 | Open in IMG/M |
3300020069|Ga0197907_11303687 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
3300021478|Ga0210402_10584378 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300021560|Ga0126371_11917557 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 711 | Open in IMG/M |
3300025913|Ga0207695_10390943 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
3300025913|Ga0207695_11205650 | Not Available | 637 | Open in IMG/M |
3300025914|Ga0207671_10608503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 871 | Open in IMG/M |
3300025915|Ga0207693_10642589 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300025916|Ga0207663_10464830 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 978 | Open in IMG/M |
3300025921|Ga0207652_10079240 | All Organisms → cellular organisms → Bacteria | 2869 | Open in IMG/M |
3300025928|Ga0207700_10754284 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300025928|Ga0207700_11276304 | Not Available | 655 | Open in IMG/M |
3300025934|Ga0207686_11622945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 534 | Open in IMG/M |
3300025988|Ga0208141_1021355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300025998|Ga0208651_1027650 | Not Available | 507 | Open in IMG/M |
3300026078|Ga0207702_11420397 | Not Available | 688 | Open in IMG/M |
3300026295|Ga0209234_1142117 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300026301|Ga0209238_1074039 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300026325|Ga0209152_10099420 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
3300026331|Ga0209267_1225338 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300026335|Ga0209804_1131176 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300026523|Ga0209808_1053936 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
3300026547|Ga0209156_10166695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1062 | Open in IMG/M |
3300026550|Ga0209474_10133735 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
3300027576|Ga0209003_1023692 | Not Available | 1011 | Open in IMG/M |
3300027706|Ga0209581_1004164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11825 | Open in IMG/M |
3300027706|Ga0209581_1233777 | Not Available | 568 | Open in IMG/M |
3300027773|Ga0209810_1000079 | All Organisms → cellular organisms → Bacteria | 291971 | Open in IMG/M |
3300027773|Ga0209810_1002320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23335 | Open in IMG/M |
3300027773|Ga0209810_1005794 | All Organisms → cellular organisms → Bacteria | 11002 | Open in IMG/M |
3300027857|Ga0209166_10001915 | All Organisms → cellular organisms → Bacteria | 16520 | Open in IMG/M |
3300027869|Ga0209579_10000004 | All Organisms → cellular organisms → Bacteria | 890648 | Open in IMG/M |
3300027965|Ga0209062_1324964 | Not Available | 509 | Open in IMG/M |
3300031341|Ga0307418_1003967 | All Organisms → cellular organisms → Bacteria | 4578 | Open in IMG/M |
3300031367|Ga0307440_1171611 | Not Available | 596 | Open in IMG/M |
3300031720|Ga0307469_10325359 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300031779|Ga0318566_10311783 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300031938|Ga0308175_100000034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 112846 | Open in IMG/M |
3300031938|Ga0308175_100028209 | All Organisms → cellular organisms → Bacteria | 4600 | Open in IMG/M |
3300031938|Ga0308175_100199987 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
3300031939|Ga0308174_11594231 | Not Available | 560 | Open in IMG/M |
3300031996|Ga0308176_10265206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1655 | Open in IMG/M |
3300032074|Ga0308173_10206066 | Not Available | 1637 | Open in IMG/M |
3300032770|Ga0335085_10003235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 28630 | Open in IMG/M |
3300032770|Ga0335085_10405592 | Not Available | 1580 | Open in IMG/M |
3300032783|Ga0335079_11686564 | Not Available | 620 | Open in IMG/M |
3300032805|Ga0335078_10125836 | All Organisms → cellular organisms → Bacteria | 3661 | Open in IMG/M |
3300032892|Ga0335081_10188577 | All Organisms → cellular organisms → Bacteria | 2874 | Open in IMG/M |
3300032898|Ga0335072_10041999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6241 | Open in IMG/M |
3300033803|Ga0314862_0015214 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 13.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.04% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.23% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.23% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.52% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.52% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.52% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.82% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.82% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.11% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.41% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.41% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.41% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.70% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.70% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.70% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.70% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.70% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.70% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.70% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.70% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.70% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.70% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.70% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
3300025998 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300031341 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-20 | Environmental | Open in IMG/M |
3300031367 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-10 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0317.00003560 | 2166559005 | Simulated | VSNVLGLIGFVAYIVAIVGLAAAVTWVVVRFTPSRKQDGSAKPS |
N57_01275200 | 2170459013 | Grass Soil | VSNALGLIGFVAYIVAIVGLAAAVTWVVVRFTPSRKQDGSAKPS |
FE1_06858330 | 2189573002 | Grass Soil | VSNVLGLIGFVAYIVAIVGLAAAVTWVVVRFTPSRKQDG |
FE1_06244920 | 2189573002 | Grass Soil | LGLIGFVAYIVAIVGLAAAVTWVVVRFTPSRKQDGSAKPS |
JGI10216J12902_1114623692 | 3300000956 | Soil | VSNVLGLLAFVLYVVVIIGTAAGVTWIVVRLTPSRKSSGGSAQS* |
A3PFW1_100701135 | 3300001535 | Permafrost | MSTALGLIAFVGYVLAIVGAAASVTWVVVRLTPSRKPKPDS* |
C688J35102_1189907072 | 3300002568 | Soil | VSNALGLLAFVCFVVAIVGVAAGVTWVVVRLTPSRKPDSSADS* |
soilH1_100098013 | 3300003321 | Sugarcane Root And Bulk Soil | VSNALGLLAFVGYVIVIVGFAAGMTWLVVRLTPSRKPDESARS* |
Ga0062595_1001808552 | 3300004479 | Soil | MPWAPGYSREPVSNALGLIEFVAYVVAIVGLAAGITWVVVRITPSRKPDSSAES* |
Ga0062595_1011354431 | 3300004479 | Soil | FAMSTALGLLAFVVFIVAIIAVAAGVTWVVVRLSPSKKPDSPQPAA* |
Ga0062595_1024151681 | 3300004479 | Soil | VSTVLGLLAFVVYVLVIVGVAAGVTWLVVRLTPTRKPDGPAQS* |
Ga0062595_1024781621 | 3300004479 | Soil | WAPGYSREPVSNALGLLAFAGYVVAIIGAAAGITWVVVRLTPSRKSDSSASS* |
Ga0062595_1025113852 | 3300004479 | Soil | STALGLLAFAAYVVVIIGVAAAVTWAVVRLTPSRDSKSSAGS* |
Ga0066680_102018612 | 3300005174 | Soil | VSNALGLLAFVVYVLAIVGAAAGVTWLVVRLTPSRKPDSSPPS* |
Ga0066679_109293071 | 3300005176 | Soil | VSNALGLIEFAAYVLVIVGLAAGITWAVVRLTPSRKPNGPAQS* |
Ga0066690_110226331 | 3300005177 | Soil | NALGLLAFVVYVLAIVGAAAGVTWLVVRLTPSRKPDSSPPS* |
Ga0066688_100794772 | 3300005178 | Soil | VSTAFGLLAFAAYVVAIIGAAAGVTWVVVRLTPSRKSDSSARS* |
Ga0066688_104565412 | 3300005178 | Soil | VSNALGLIEFAAYVLVIVGLAAGITWAVVRLTPSRKPDGPAQS* |
Ga0066684_100286043 | 3300005179 | Soil | VSTAFGLLAFAAYVVAIIGAAAGVTWVVVRLTPTRKSDSSARS* |
Ga0066675_101675792 | 3300005187 | Soil | VSNALGLLAFVVFVVAIVGAAAGVTWAVVRLTPSRKPDSSADS* |
Ga0070683_1012452512 | 3300005329 | Corn Rhizosphere | VSNALGLIEFVAYILVIVGLAAGVTWVVVRYTPSRKQDGAAKS* |
Ga0066388_1000278272 | 3300005332 | Tropical Forest Soil | VSNALGLLAFVAYVVVIVGVAAAVTWVVVRLTPSRGKDGPAKS* |
Ga0066388_1009418482 | 3300005332 | Tropical Forest Soil | VSNVLGLLAFVAYVLVIVGMAAGVTWLVVRFTPSRKSDATSKS* |
Ga0066388_1034019652 | 3300005332 | Tropical Forest Soil | VSTALGLLAFVVYVVVIIGVAAAVTWAVVRLTPSRDSKGSAGS* |
Ga0066388_1057802372 | 3300005332 | Tropical Forest Soil | VSNVLGLIAFVAYVLVIVGLAAGVTWVVVRLTPSKSKPGGAAKS* |
Ga0066388_1064273242 | 3300005332 | Tropical Forest Soil | VSNVLGLIAFVGYVVAIIGIAAAVTWVVVRLTPPSKPGGSAQS* |
Ga0070680_1003265792 | 3300005336 | Corn Rhizosphere | VSNALGLLAFVVYVAAIVGAAAGVTWLVVRLTPSRKPDSSAGS* |
Ga0070682_1001600822 | 3300005337 | Corn Rhizosphere | VSNALGLLAFVVYVAAIVGAAAGVTWVVVRLKPSRKPDSSAGS* |
Ga0070709_100622092 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTALGLIAFVGYVLVVVGAAAGVTWVVVRLTPSRKPGGESGS* |
Ga0070714_1000128204 | 3300005435 | Agricultural Soil | VSNVLGLLAFALYVVVIVGTAAGVTWLVVRLTPSRKPGGSTQNN* |
Ga0070713_1023753542 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | WAPGYSREPVSNVLGLIEFVVYVAAIVGAAAGVTWLVVRLTPSRKPDSSAGS* |
Ga0070711_1006443671 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNALGLIAFVLYVVFIVGLAAAVTWLVVRFSPQKKPDGPART* |
Ga0070706_1011979842 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VSNALGLIEFVAYILVIVGLAAGVTWVVVRYTPSRKQNGAAKS* |
Ga0070737_100294703 | 3300005524 | Surface Soil | VSTALGLLAFLAYVVAVIAVAAAVTWVVVRLTPAQKRNGSPRS* |
Ga0070741_102572632 | 3300005529 | Surface Soil | VSTALGLILFVVYALAVVGVAAGITWVVVRLSPGQKPGGAPKRSES* |
Ga0070741_111682902 | 3300005529 | Surface Soil | VSTALGLLAFIGYVVAVVAVAAGVTWVVVRLTPARKPGGAKPS* |
Ga0070679_1001020211 | 3300005530 | Corn Rhizosphere | VSNALGLLAFVVYVAAIVGAAAGVTWVVVRLTPSRKPDSSAGS* |
Ga0070739_100007449 | 3300005532 | Surface Soil | VSTALGLLAFVAYVLVIVGVAAAVTWIVVRVTPTHKPDGSAQS* |
Ga0070739_1000423716 | 3300005532 | Surface Soil | VSTALGLLAFVGYVLAIVGVAAGVTWVVVRLTPSRKPDSPAQS* |
Ga0070739_100078694 | 3300005532 | Surface Soil | VSTALDLLAFVGYALAVVGAAAGVTWVVVRVTPSKRPSQPAKR* |
Ga0070739_101730202 | 3300005532 | Surface Soil | VSTALGLLAFLGYVIAVVAVAAGVTWVVVRLTPAQKPERTARS* |
Ga0070730_100041538 | 3300005537 | Surface Soil | VSNALGLIAFVGYVVAVVGVAAAVTWIVVRVTPSRKPDGSAGS* |
Ga0070730_110375442 | 3300005537 | Surface Soil | VSNALGLLAFAAYVIVIVGAAAAITWIVVRFTPSQKRNG* |
Ga0070731_100002673 | 3300005538 | Surface Soil | VSTALGLLAFAAYALVVIGAAAAITWMVVKLTPPGRRPGS* |
Ga0066705_103662672 | 3300005569 | Soil | VSNALGLLEFVFFVVAIVGVAAGVTWVVVRLTPSRKPDSSADS* |
Ga0070740_103087671 | 3300005607 | Surface Soil | VSTALGLLAFVAYVIVVVAVAAGVTWVVVKLTPAQKPDRPARS* |
Ga0070702_1013600782 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VSNALGLIEFVAYILVIVGLAAGVTWVVVRYTPSRKQDGA |
Ga0066903_1000520552 | 3300005764 | Tropical Forest Soil | VSSVLGLIAFVAYVVAIIGLAAGVTWIVVRLTPPSRKQDSKARS* |
Ga0066903_1001094515 | 3300005764 | Tropical Forest Soil | VSNVLGLLAFALYVAVIVGTAAGVTWVVVRLTPSKKPRSSAES* |
Ga0066903_1004427612 | 3300005764 | Tropical Forest Soil | VSNAFGLIEFVIYVALIVGLAAGVTWVVVRLTPSKSKPSGSPRS* |
Ga0066903_1006388402 | 3300005764 | Tropical Forest Soil | VSNVLGLLAFVAYVLVIVGLAAGVTWLVVRFTPSRKSDATSKS* |
Ga0066903_1012795532 | 3300005764 | Tropical Forest Soil | VSSVLGLIAFVVYVLAIVGLAAGITWVVVRLTPPSRKPKSQART* |
Ga0066903_1014748142 | 3300005764 | Tropical Forest Soil | MENVLGLLAFILYVLVIVGMAAGVTWIVVRFTPSRRKTDAAAKN* |
Ga0066903_1016198312 | 3300005764 | Tropical Forest Soil | MENVLGLLAFTLYVLVIVGMAAGVTWIVVRFTPSRRKADGAARN* |
Ga0066903_1045800862 | 3300005764 | Tropical Forest Soil | VSNVLGLLAFALYVVVIVGTAAGVTWLVVRLTPSRKPSGSTQNN* |
Ga0066903_1060467262 | 3300005764 | Tropical Forest Soil | VSTALGLIAFVAYVLVIVGLAAGVTWVVVRLTPRRKKPKPGSPAQS* |
Ga0068863_1004479931 | 3300005841 | Switchgrass Rhizosphere | VSNALGLIEFVAYILVIVGLAAGVTWVVVRYTPSRKQDGAAK |
Ga0075281_10248311 | 3300005897 | Rice Paddy Soil | MDSALGLLAFVVYLLAIVSVAAGVTWLVRVTPTKKPSQSSDGSAS* |
Ga0075280_101185641 | 3300005904 | Rice Paddy Soil | ALGLLAFVVYLLAIVSVAAGVTWLVVRVTPTKKPSQSSDGSAS* |
Ga0070716_1012619132 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNVLGLLGFALYVVVIVGTAAGVTWVVVRLTPSRKPGGSSQS* |
Ga0079220_115582432 | 3300006806 | Agricultural Soil | WTPMSTALGLLAFVVYVVVIIGVAAAVTWAVVRLTPSRDSKSSARS* |
Ga0075425_1025716242 | 3300006854 | Populus Rhizosphere | VSNALGLLAFVAYVIAIVGIAAAVTWVVVRLTPSRKPSGPTKS* |
Ga0105240_100231038 | 3300009093 | Corn Rhizosphere | MPWASGYSREPVSNALGLLAFVVYVAAIVGAAAGVTWLVVRLTPSRKPDSSAGS* |
Ga0105242_121967431 | 3300009176 | Miscanthus Rhizosphere | VSNALGLIEFVAYILVIVGLAAGVTWAVVRFTPSRKQDSSAKS* |
Ga0126380_103408352 | 3300010043 | Tropical Forest Soil | MSTVLGLIAFVAYVLVIVGLAAGVTWVVVRLTPTKKKPKPGSPAQS* |
Ga0126318_105088312 | 3300010152 | Soil | VSNALGLIEFVGYVAAIVGLAAGITWAVVRLTPSRKPDSPAQS* |
Ga0127503_102911981 | 3300010154 | Soil | VSNVLGLIAFVGYVVAIIGIAAGVTWLVVRLTPPSKPGGSAQS* |
Ga0127503_105076912 | 3300010154 | Soil | VSNVLGLIAFVAYIVAIIGIAAGVTWLVVRLIPPGKPRGSAQD* |
Ga0127503_110682452 | 3300010154 | Soil | LGLIAFVAYVLAIIGIAAGVTWLVVRLTPSKKPGGSAQS* |
Ga0126372_116452762 | 3300010360 | Tropical Forest Soil | VSNVLGLLAFVAYVLVIVGMAAGVTWLVVRFTPSRKSDAATKN* |
Ga0126377_109309162 | 3300010362 | Tropical Forest Soil | MENLLGLLAFILYVVVIVGMAAGVTWIVVRYTPSRKSNSAAKS* |
Ga0134125_104810892 | 3300010371 | Terrestrial Soil | VSNALGLLAFVAFVLVVVGAAAGVTWVVVRLTPSRKPGGDAPS* |
Ga0134128_100354905 | 3300010373 | Terrestrial Soil | MSTALGLIAFVGYVLAVVGVAAAVTWVVVRLTPTRKPSGQARS* |
Ga0134128_107429322 | 3300010373 | Terrestrial Soil | VSNVLGLIEFVVYVAGIVGAAAGVTWLVVRLTPSRKSGGSAQS* |
Ga0134128_120848132 | 3300010373 | Terrestrial Soil | VSNVFGLIEFVVYVAAIVGAAAGVTWLVVRLTPSRKPDGSARS* |
Ga0126381_1032198791 | 3300010376 | Tropical Forest Soil | VSTVLGLLAFVLYVVAIIGIAAAVTWVVVRLTPSRNQSGSARS* |
Ga0134126_102850013 | 3300010396 | Terrestrial Soil | FGLIEFVVYVAAIVGAAAGVTWLVVRLTPSRKPDGSAGS* |
Ga0134121_132142912 | 3300010401 | Terrestrial Soil | VSNVLGLLAFVGYVLAVVGVAAGVTWVVVRLTPSRKPDGTARS* |
Ga0137382_105052701 | 3300012200 | Vadose Zone Soil | VSNALGLIGFVAYIVAIVGLAAAVTWVVVRFTPSRKQDGSAES* |
Ga0137380_102085471 | 3300012206 | Vadose Zone Soil | REPVSNALGLLEFVFFVVAIVGAAAGVTWAVVRLTPKRKPDSSAGS* |
Ga0137385_110012132 | 3300012359 | Vadose Zone Soil | VSTAIGLIAFVGYVLAVVGVAAGMTWVVVRLTPGRKPDGSAKS* |
Ga0126369_131857652 | 3300012971 | Tropical Forest Soil | VSNVLGLLDFALYVVVIVGTAAGVTWLVVRLTPSRKPSGSTQNN* |
Ga0157370_115209152 | 3300013104 | Corn Rhizosphere | VSNALGLLEFVVYVAAIVGAAAGVTWLVVRLTPSRKPDSSAGS* |
Ga0182008_100737081 | 3300014497 | Rhizosphere | VSTALGLLAFVVYVLVIVGVAAAVTWVVVRVTPTRKSDEQARG* |
Ga0187820_11776312 | 3300017924 | Freshwater Sediment | VSTALGLLAFVGYVIAIVAVAAAVTWIVVRLTPNRKPDSSART |
Ga0187825_100954952 | 3300017930 | Freshwater Sediment | LSNALGLLAFVAYVLVIVGVAAAVTWIVVRLTPSRKSDSSART |
Ga0187809_101565742 | 3300017937 | Freshwater Sediment | SRYAVSTALGLLAFAGYVLVVVGLAAAVTWVVVRLTPSRKPGSSAG |
Ga0187785_100218873 | 3300017947 | Tropical Peatland | VSAALSLIAFAGYVLLIVGVAAGVTWIVVRLTPSRKPDGPAQQ |
Ga0187779_102237641 | 3300017959 | Tropical Peatland | VSTILGLLAFVAYVLVIVGLAAGVTWVVVRLTPSKRGGSGAAKS |
Ga0187822_101626222 | 3300017994 | Freshwater Sediment | VENLLGLLAFAAYVLVIVAMAAGLTWVVVRFTPSRKPDDAAKS |
Ga0066667_120549662 | 3300018433 | Grasslands Soil | VSNALGLLAFVVFVVAIVGAAAGVTWAVVRLTPSRKPDSSADS |
Ga0066662_105029522 | 3300018468 | Grasslands Soil | VSTAFGLLAFAAYVVAIIGAAAGVTWVVVRLTPSRKSDSSARS |
Ga0066662_124417002 | 3300018468 | Grasslands Soil | VSNVLGLLAFVLYVIVIVGTAAGVTWVVVRLTPSRKPDSSADG |
Ga0197907_113036873 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VSNALGLLAFVVYVAAIVGAAAGVTWLVVRLTPSRKPDSSAGS |
Ga0210402_105843782 | 3300021478 | Soil | VSTAFGLIEFILYVVLIVGLAAGVTWLVVRLTPSKSKPSGSARS |
Ga0126371_119175572 | 3300021560 | Tropical Forest Soil | VSNVLGLLAFVAYVLVIVGLAAGVTWLVVRFTPSRKSDATSKS |
Ga0207695_103909431 | 3300025913 | Corn Rhizosphere | SREPVSNALGLLAFVVYVAAIVGAAAGVTWLVVRLTPSRKPDSSAGS |
Ga0207695_112056501 | 3300025913 | Corn Rhizosphere | VSTALGLIAFVGYVLAIVGAAAAVTWVVVRLTPSRKS |
Ga0207671_106085032 | 3300025914 | Corn Rhizosphere | MPWASGYSREPVSNALGLLAFVVYVAAIVGAAAGVTWLVVRLTPSRKPDSSAGS |
Ga0207693_106425892 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNVLGLLGFALYVVVIVGTAAGVTWVVVRLTPSRKPGGSSQS |
Ga0207663_104648302 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNALGLIAFVLYVVFIVGLAAAVTWLVVRFSPQKKPDGPART |
Ga0207652_100792405 | 3300025921 | Corn Rhizosphere | VSNALGLLAFVVYVAAIVGAAAGVTWVVVRLTPSRKPDSSAGS |
Ga0207700_107542842 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSNVLGLLAFALYVVVIVGTAAGVTWLVVRLTPSRKPGGSTQNN |
Ga0207700_112763042 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNALGLIAFVVYVVFIVGLAAAVTWLVVRFSPQKKSDGPAQS |
Ga0207686_116229452 | 3300025934 | Miscanthus Rhizosphere | ALGLIGFVAYILVIVGLAAGVTWAVVRFTPSRKQDSSAKS |
Ga0208141_10213551 | 3300025988 | Rice Paddy Soil | VSTVLGLLAFVVYVLAVIGVAAGVTWIVVRLTPTRKPGGSA |
Ga0208651_10276501 | 3300025998 | Rice Paddy Soil | VSTVLGLLAFVVYVLAVIGVAAGVTWIVVRLTPTRKPGGSAQS |
Ga0207702_114203972 | 3300026078 | Corn Rhizosphere | VSNVLGLLAFVLYVVVIVGTAAGVTWLVVRLTPSRKPRDSAQS |
Ga0209234_11421172 | 3300026295 | Grasslands Soil | VSNALGLLEFVFFVVAIVGVAAGVTWVVVRLTPSRKPDSSADS |
Ga0209238_10740392 | 3300026301 | Grasslands Soil | LWRATLLAFVCFVVAIVGVAAGVTWVVVRLTPSRKPDTSADS |
Ga0209152_100994202 | 3300026325 | Soil | VSNALGLLAFVCFVVAIVGVAAGVTWVVVRLTPSRKPDSSADS |
Ga0209267_12253382 | 3300026331 | Soil | VSNALGLIEFAAYVLVIVGLAAGITWAVVRLTPSRKPDGPAQS |
Ga0209804_11311762 | 3300026335 | Soil | VSNALGLIEFAAYVLVIVGLAAGITWAVVRLTPSRKPNGPAQS |
Ga0209808_10539363 | 3300026523 | Soil | VSTAFGLLAFAAYVVAIIGAAAGVTWVVVRLTPTRKSDSSARS |
Ga0209156_101666951 | 3300026547 | Soil | LLAFAAYVVAIIGAAAGVTWVVVRLTPSRKSDSSARS |
Ga0209474_101337352 | 3300026550 | Soil | VSTALGLLAFVGYVIAIIAVAAAVTWMVVRLTPSRKPDSSPRT |
Ga0209003_10236921 | 3300027576 | Forest Soil | VSNALGLLFFVVYVLAIVGAAAGITWVVVRLTPSRKPDGPAKPS |
Ga0209581_100416410 | 3300027706 | Surface Soil | VSTALGLLAFLAYVVAVIAVAAAVTWVVVRLTPAQKRNGSPRS |
Ga0209581_12337772 | 3300027706 | Surface Soil | VSTALGLLAFVAYVIVVVAVAAGVTWVVVKLTPAQKPDRPARS |
Ga0209810_1000079139 | 3300027773 | Surface Soil | VSTALGLLAFVAYVLVIVGVAAAVTWIVVRVTPTHKPDGSAQS |
Ga0209810_100232024 | 3300027773 | Surface Soil | VSTALGLLAFVGYVLAIVGVAAGVTWVVVRLTPSRKPDSPAQS |
Ga0209810_10057944 | 3300027773 | Surface Soil | VSTALDLLAFVGYALAVVGAAAGVTWVVVRVTPSKRPSQPAKR |
Ga0209166_100019158 | 3300027857 | Surface Soil | VSNALGLIAFVGYVVAVVGVAAAVTWIVVRVTPSRKPDGSAGS |
Ga0209579_10000004766 | 3300027869 | Surface Soil | VSTALGLLAFAAYALVVIGAAAAITWMVVKLTPPGRRPGS |
Ga0209062_13249641 | 3300027965 | Surface Soil | VSTALGLLAFLAYVVAVIAVAAAVTWVVVRLTPAQKRNGSPRT |
Ga0307418_10039675 | 3300031341 | Salt Marsh | VSNVLGLLAFVAYVLAVVGAAAGVTWVVVRLTPPKKSGRPARN |
Ga0307440_11716112 | 3300031367 | Salt Marsh | TPVSNVLGLLAFVAYVLAVVGAAAGVTWVVVRLTPPKKSGRPARN |
Ga0307469_103253592 | 3300031720 | Hardwood Forest Soil | VSNVLGLIAFVGYVVAIIGIAAAVTWVVVRLTPPSKPGGSAQS |
Ga0318566_103117832 | 3300031779 | Soil | VSNVLGLIAFVGYVVAIIGIAAAVTWVVVRLTPPSKPGGPAQS |
Ga0308175_100000034103 | 3300031938 | Soil | VSTALGLLAFVVYVLAVVGVAAGVTWIVVRLTPTRKTGDSARS |
Ga0308175_1000282096 | 3300031938 | Soil | VSTALGLIAFVAYVLVIVGVAAGVTWVVVRLTPTRKSGGQARG |
Ga0308175_1001999873 | 3300031938 | Soil | PVSTALGLIAFVGYVLAVVGVAAAVTWVVVRLTPSRKPGGQARS |
Ga0308174_115942312 | 3300031939 | Soil | LSNAFGLIEFIIYVALIVGLAAGVTWVVVRLTPSKSKPSGSARS |
Ga0308176_102652061 | 3300031996 | Soil | LGLLAFVVFVLVVVGVAAGVTWVVVRLTPSRKPGGETQS |
Ga0308173_102060663 | 3300032074 | Soil | MSTALGLIAFVGYVLAVVGVAAAVTWVVVRLTPTRKPSGQARS |
Ga0335085_1000323511 | 3300032770 | Soil | MSTILGLLAFVAYVLVIVGLAAGVTWVVVRLTPSKRGGSGAAKS |
Ga0335085_104055922 | 3300032770 | Soil | VSAALSLLAFVGYVLLIVGVAAGVTWIVVRLTPSRKPDGPAQQ |
Ga0335079_116865641 | 3300032783 | Soil | GLLAFVAYVLVIVGLAAGVTWVVVRLTPSKRGGSGAAKS |
Ga0335078_101258365 | 3300032805 | Soil | VSNALGLIAFIGYALAVVGVAAGVTWVVVRVTPTRQANGPTKR |
Ga0335081_101885772 | 3300032892 | Soil | VSTALGLLAFLAYVVAVVGAAAAVTWVVVRVTPTRKS |
Ga0335072_100419992 | 3300032898 | Soil | VSNAFGLIEFVLYVLVIVGLAAGVTWVVVRLTPSKSKPSGSARN |
Ga0314862_0015214_1157_1288 | 3300033803 | Peatland | VSTVLSLLAFVGYVILIVGVAAGVTWIVVRLTPSRKPDGPAQQ |
⦗Top⦘ |