Basic Information | |
---|---|
Family ID | F052623 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 142 |
Average Sequence Length | 43 residues |
Representative Sequence | MNRAEIIRALIDGLIDSGMDVTVAASEADLRARVARRLGTPYR |
Number of Associated Samples | 121 |
Number of Associated Scaffolds | 142 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.93 % |
% of genes near scaffold ends (potentially truncated) | 90.85 % |
% of genes from short scaffolds (< 2000 bps) | 88.03 % |
Associated GOLD sequencing projects | 116 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.845 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.268 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.394 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.521 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 142 Family Scaffolds |
---|---|---|
PF07690 | MFS_1 | 16.20 |
PF00654 | Voltage_CLC | 9.15 |
PF01425 | Amidase | 7.75 |
PF12704 | MacB_PCD | 2.82 |
PF02518 | HATPase_c | 2.11 |
PF02738 | MoCoBD_1 | 1.41 |
PF03372 | Exo_endo_phos | 1.41 |
PF13426 | PAS_9 | 1.41 |
PF01019 | G_glu_transpept | 1.41 |
PF00805 | Pentapeptide | 0.70 |
PF10442 | FIST_C | 0.70 |
PF02355 | SecD_SecF | 0.70 |
PF00571 | CBS | 0.70 |
PF04389 | Peptidase_M28 | 0.70 |
PF13372 | Alginate_exp | 0.70 |
COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
---|---|---|---|
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 9.15 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 7.75 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.41 |
COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 0.70 |
COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.70 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.85 % |
Unclassified | root | N/A | 9.15 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2070309004|prs_FIHLEPW02RMLKP | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
2124908041|P3_CLC_ConsensusfromContig58823 | Not Available | 652 | Open in IMG/M |
3300002568|C688J35102_118587578 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300003321|soilH1_10109239 | Not Available | 1020 | Open in IMG/M |
3300004081|Ga0063454_100599277 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300004114|Ga0062593_100894413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
3300004153|Ga0063455_101654960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300004157|Ga0062590_102944175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300005093|Ga0062594_100866346 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300005178|Ga0066688_10232439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
3300005293|Ga0065715_10901234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300005294|Ga0065705_10869472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300005330|Ga0070690_100077663 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
3300005332|Ga0066388_103210642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
3300005343|Ga0070687_100592607 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300005354|Ga0070675_100868088 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300005355|Ga0070671_100664159 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300005356|Ga0070674_101745451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300005367|Ga0070667_100074556 | All Organisms → cellular organisms → Bacteria | 2895 | Open in IMG/M |
3300005440|Ga0070705_100928231 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300005441|Ga0070700_102006802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300005456|Ga0070678_100285269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1398 | Open in IMG/M |
3300005457|Ga0070662_101086863 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300005458|Ga0070681_10060728 | All Organisms → cellular organisms → Bacteria | 3756 | Open in IMG/M |
3300005459|Ga0068867_101472305 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300005518|Ga0070699_101125488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300005546|Ga0070696_101577079 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300005555|Ga0066692_10940172 | Not Available | 529 | Open in IMG/M |
3300005718|Ga0068866_10060462 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
3300005719|Ga0068861_102099131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300005764|Ga0066903_100100428 | All Organisms → cellular organisms → Bacteria | 3906 | Open in IMG/M |
3300005764|Ga0066903_106798119 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300005764|Ga0066903_107938670 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005764|Ga0066903_109042462 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300005840|Ga0068870_10155984 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
3300005842|Ga0068858_101780201 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300006358|Ga0068871_100462293 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300006755|Ga0079222_10223883 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300006791|Ga0066653_10284471 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300006806|Ga0079220_11231030 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300006854|Ga0075425_102715861 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300006854|Ga0075425_102774917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300006871|Ga0075434_100043399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4460 | Open in IMG/M |
3300006871|Ga0075434_100630989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
3300006871|Ga0075434_101182245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300006880|Ga0075429_100446168 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300006881|Ga0068865_101122875 | Not Available | 693 | Open in IMG/M |
3300006904|Ga0075424_100161763 | All Organisms → cellular organisms → Bacteria | 2373 | Open in IMG/M |
3300006904|Ga0075424_101374198 | Not Available | 750 | Open in IMG/M |
3300006953|Ga0074063_12681931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
3300007076|Ga0075435_101008362 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300009012|Ga0066710_101111767 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300009038|Ga0099829_11022630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300009093|Ga0105240_11640474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300009101|Ga0105247_11462812 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300009137|Ga0066709_100355164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2015 | Open in IMG/M |
3300009137|Ga0066709_101342974 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300009137|Ga0066709_102717515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_66_4 | 659 | Open in IMG/M |
3300009147|Ga0114129_11606920 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300009147|Ga0114129_12272399 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300009156|Ga0111538_12975199 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300009162|Ga0075423_10548579 | Not Available | 1217 | Open in IMG/M |
3300009162|Ga0075423_11168123 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300009162|Ga0075423_12274825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300009162|Ga0075423_13123418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300009553|Ga0105249_12629052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300009553|Ga0105249_13328078 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300009660|Ga0105854_1232114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300010364|Ga0134066_10068335 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300010371|Ga0134125_11931238 | Not Available | 642 | Open in IMG/M |
3300010375|Ga0105239_12939280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300010376|Ga0126381_100215493 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
3300010397|Ga0134124_10181941 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
3300010399|Ga0134127_10747946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
3300010399|Ga0134127_12557541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300010401|Ga0134121_10701256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
3300010401|Ga0134121_11976970 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300010401|Ga0134121_12729434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300011270|Ga0137391_10632438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
3300011270|Ga0137391_11129439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300012360|Ga0137375_10122613 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
3300012469|Ga0150984_115350245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
3300012469|Ga0150984_117109278 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300012925|Ga0137419_10007564 | All Organisms → cellular organisms → Bacteria | 5633 | Open in IMG/M |
3300012929|Ga0137404_11565856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
3300012930|Ga0137407_12442304 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300012944|Ga0137410_12071553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300012957|Ga0164303_11563850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300012961|Ga0164302_11550067 | Not Available | 548 | Open in IMG/M |
3300012972|Ga0134077_10197495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
3300013297|Ga0157378_12047284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300013306|Ga0163162_10223630 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
3300015372|Ga0132256_100900809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
3300015373|Ga0132257_100647698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1309 | Open in IMG/M |
3300015373|Ga0132257_103982049 | Not Available | 537 | Open in IMG/M |
3300015374|Ga0132255_103788257 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300016341|Ga0182035_11809441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300017974|Ga0187777_10021268 | All Organisms → cellular organisms → Bacteria | 4124 | Open in IMG/M |
3300018028|Ga0184608_10264897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
3300018076|Ga0184609_10506551 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300018078|Ga0184612_10314063 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300018431|Ga0066655_10058813 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
3300018481|Ga0190271_10011217 | All Organisms → cellular organisms → Bacteria | 6384 | Open in IMG/M |
3300021073|Ga0210378_10155048 | Not Available | 883 | Open in IMG/M |
3300021080|Ga0210382_10093768 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300021339|Ga0193706_1110924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
3300025271|Ga0207666_1008403 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
3300025315|Ga0207697_10221493 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300025893|Ga0207682_10340289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300025908|Ga0207643_10270049 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300025910|Ga0207684_10356231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia | 1259 | Open in IMG/M |
3300025917|Ga0207660_10759357 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300025927|Ga0207687_11853704 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300025933|Ga0207706_10048794 | All Organisms → cellular organisms → Bacteria | 3744 | Open in IMG/M |
3300025933|Ga0207706_11462379 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300025934|Ga0207686_11007813 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300025938|Ga0207704_10883288 | Not Available | 751 | Open in IMG/M |
3300025941|Ga0207711_11961648 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300025961|Ga0207712_11250223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
3300026023|Ga0207677_10679396 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300026142|Ga0207698_11838918 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300026276|Ga0209847_1092760 | Not Available | 561 | Open in IMG/M |
3300027869|Ga0209579_10483883 | Not Available | 672 | Open in IMG/M |
3300028381|Ga0268264_10121579 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
3300031226|Ga0307497_10608602 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300031231|Ga0170824_118504130 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300031547|Ga0310887_10260661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
3300031562|Ga0310886_10501726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
3300031731|Ga0307405_11700827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300031879|Ga0306919_10570727 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300031912|Ga0306921_12248233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300031939|Ga0308174_10387491 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300031943|Ga0310885_10174288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
3300032000|Ga0310903_10490065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300032013|Ga0310906_10575445 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300032064|Ga0318510_10163402 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300032075|Ga0310890_11417710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300032089|Ga0318525_10467627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300032211|Ga0310896_10181209 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300032782|Ga0335082_10046844 | All Organisms → cellular organisms → Bacteria | 4499 | Open in IMG/M |
3300034268|Ga0372943_0697360 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300034819|Ga0373958_0223968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.27% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.63% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.52% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.52% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.11% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.11% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.11% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.11% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.11% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.11% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.41% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.41% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.41% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.41% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.41% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.41% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.41% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.70% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.70% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.70% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.70% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.70% |
Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.70% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.70% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.70% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.70% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.70% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.70% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.70% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.70% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.70% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026276 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
prs_00954540 | 2070309004 | Green-Waste Compost | MNRAEIIRALIDGLIDSGMDVTVAASEADLRARVARRLGTPYR |
P3_CLC_02322750 | 2124908041 | Soil | LTKDMRSKSGKAMNRAEIIRALIDGLIESGMDVAGAGSEANLQARVARRLGTPYR |
C688J35102_1185875782 | 3300002568 | Soil | KTGRALNRAEIIRALIDGLIESGLDVHASPTEADLRAMVARRLGTPYR* |
soilH1_101092392 | 3300003321 | Sugarcane Root And Bulk Soil | EIIRALIDGLIDSGMDVSVAASEADLRARVARRLGTPFR* |
Ga0063454_1005992771 | 3300004081 | Soil | TDGRGKTGRALNRAEIIRALIDGLIESGLDVHASPTEADLRAMVARRLGTPYR* |
Ga0062593_1008944131 | 3300004114 | Soil | SGKVLNRAEIIRALIDGLIDSGMDITSTATEADLRAKVARHLGTPFR* |
Ga0063455_1016549601 | 3300004153 | Soil | TRGTRDRNGKAMNRAEVIRALIDGLIESGMDLADASSEATLRARVARRLGTPYR* |
Ga0062590_1029441752 | 3300004157 | Soil | NRAEIIRALIDGLIDSGLDITGSGTEADLRARVARRLGTPFR* |
Ga0062594_1008663461 | 3300005093 | Soil | GKTGKLLNRAEIIRALIDGLIDSGMDITGAESERDLRGRVARRLGTPYR* |
Ga0066688_102324393 | 3300005178 | Soil | MSRKSLNRAEIIRALIDGLIDSGMDITTSATEADLRARVARRLGTPYR* |
Ga0065715_109012341 | 3300005293 | Miscanthus Rhizosphere | IRGKSGKVLNRAEIIRALIDGLIDSGIDVGATPSEADLRAKVARHLGTPFR* |
Ga0065705_108694722 | 3300005294 | Switchgrass Rhizosphere | TDIRGKTGKLLNRAEIIRALIDGLIESGMDITATASEADLRGRVARRLGTPYR* |
Ga0070690_1000776634 | 3300005330 | Switchgrass Rhizosphere | MLNRAEIIRALIDGLLDSGMDITGSASEADLRARVARRLGSPYR* |
Ga0066388_1032106422 | 3300005332 | Tropical Forest Soil | RNGKVFNRTEIIRALIDGLIDSGMDIDGAASEADLRARVARRLGTPYR* |
Ga0070687_1005926071 | 3300005343 | Switchgrass Rhizosphere | TRARTGKSLNRAEIIRALIDALIDSGMDITAIGSEADLRARVARRLATPYR* |
Ga0070675_1008680881 | 3300005354 | Miscanthus Rhizosphere | SGKVLNRAGLIRALIDALIDSGLDITTSASETAVRAQVARRLGTPFR* |
Ga0070671_1006641591 | 3300005355 | Switchgrass Rhizosphere | KSVGRSLNRAEIIRALIDALIESGIDIDSVTSEADLRARVARRLATPFR* |
Ga0070674_1017454511 | 3300005356 | Miscanthus Rhizosphere | MNRAEIIRALIDGLIESGMDIVGAASEADLRARVARRLATPYR* |
Ga0070667_1000745563 | 3300005367 | Switchgrass Rhizosphere | MRSRNGKAMNRAEIIRALIDGLIESGMDVVAAGSEANLRARVARRLGTPYR* |
Ga0070705_1009282311 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | KVINRAEIIRALIDALIDSGLDVTSSGSEADLRGRVARRLGTSLR* |
Ga0070700_1020068022 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | KSGKVLNRAEIIRALIDGLIDSGMDITAAATEADLRARVARRLGSPYR* |
Ga0070678_1002852692 | 3300005456 | Miscanthus Rhizosphere | MRSKHGKTMNRAEIIRALIDGLIESGMDVAAAGSEADLRARVARRLGTPY |
Ga0070662_1010868631 | 3300005457 | Corn Rhizosphere | NRAEIIRALIDGLIDSGMDVTAADSEADLRALLGRRLGSPHR* |
Ga0070681_100607284 | 3300005458 | Corn Rhizosphere | GASGKVLNRAEIIRALIDGLIDSGMDVTAAASEADLRGRVARRLGTPFR* |
Ga0068867_1014723052 | 3300005459 | Miscanthus Rhizosphere | RAEIIRALIDALIESGIDIDSVTSEADLRARVARRLATPFR* |
Ga0070699_1011254881 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | NRAEIIRALIDGLLDSGMDITGSASEADLRARVARRLGSPYR* |
Ga0070696_1015770792 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | TGKLLNRAEIIRALIDGLIDSGMDITGAESERDLRGRVARRLGTPSR* |
Ga0066692_109401721 | 3300005555 | Soil | NRAEIIRALIDALLESGMDLKGAASEAELRARVSRRLGTPYR* |
Ga0068866_100604621 | 3300005718 | Miscanthus Rhizosphere | AEIIRALIDGLIESGMDVVAAGSEANLRARVARRLGTPYR* |
Ga0068861_1020991311 | 3300005719 | Switchgrass Rhizosphere | EIRGKSGKLLNRAEIIRALIDGLIDSGMDITAAATEADLRARVARRLGSPYR* |
Ga0066903_1001004285 | 3300005764 | Tropical Forest Soil | MRTRNGKAMNRAEIIRALIDGLIESGMDVVGAGSEANLRARVARRLGTPYR* |
Ga0066903_1067981191 | 3300005764 | Tropical Forest Soil | MLNRAEIIRALIDGLLDSGMDISGTISEADLRARVARRLGSPYR* |
Ga0066903_1079386701 | 3300005764 | Tropical Forest Soil | NRAEIIRALIDGLIDSGMDVTASGSEADLRAKVARRLGTPFR* |
Ga0066903_1090424621 | 3300005764 | Tropical Forest Soil | LIDGLIDSGMDVTGTGSEADLRARVARRLGPAVR* |
Ga0068870_101559842 | 3300005840 | Miscanthus Rhizosphere | PLNRAEIIRALIDALIESGMDIAAVSSEADLRARVARRLATPFR* |
Ga0068858_1017802013 | 3300005842 | Switchgrass Rhizosphere | IRALIDGLLDSGMDITATGSEAELRARVARRLGSSSR* |
Ga0068871_1004622933 | 3300006358 | Miscanthus Rhizosphere | MNRAEIIRALIDGLIESGMDVVGAGSEANLRARVARRLGTPYR* |
Ga0079222_102238832 | 3300006755 | Agricultural Soil | AEIIRALIDGLIDSGMDITAAGSEADLRIRVARRLAAASR* |
Ga0066653_102844712 | 3300006791 | Soil | MLNRAEIIRALIDGLLDSGMDISGTISEADLRSRVARRLGPPYR* |
Ga0079220_112310301 | 3300006806 | Agricultural Soil | IRALIDGLIDSGMDITAAGSEADLRIRVARRLAAASR* |
Ga0075425_1027158611 | 3300006854 | Populus Rhizosphere | LIDGLIDSGMDITSTASEADLRARVARRLGTPYR* |
Ga0075425_1027749171 | 3300006854 | Populus Rhizosphere | IIRALIDALIESGMDITAVGSEADLRARVARRLGTPYR* |
Ga0075434_1000433991 | 3300006871 | Populus Rhizosphere | ALIDGLLDSGMDLTGSASEADLRARIARRLGSAYR* |
Ga0075434_1006309892 | 3300006871 | Populus Rhizosphere | MRGRGVRTKPFTRAEIIRALIDGLIDSGMDISGSGSEADLRARVARHLGTSFR* |
Ga0075434_1011822451 | 3300006871 | Populus Rhizosphere | IRALIDGLIDSGMDITGAASEADLRARVARRLGTPFR* |
Ga0075429_1004461683 | 3300006880 | Populus Rhizosphere | LNRAEIIRALIDGLIDSGMDITGAESERDLRGRVARRLGTPYR* |
Ga0068865_1011228752 | 3300006881 | Miscanthus Rhizosphere | RALIDGLIDSGMDVTATASEADLRARVARRLGTPYR* |
Ga0075424_1001617633 | 3300006904 | Populus Rhizosphere | GRVLNRAEIIRALIDGLIDSGIDVTATGSEADLRARVARRLGSPYR* |
Ga0075424_1013741981 | 3300006904 | Populus Rhizosphere | LIDGLIDSGMDVTATGSEADLRARVARRLGTSLR* |
Ga0074063_126819313 | 3300006953 | Soil | IIRALIDGLIESGMDIAGAGSEANLRARVARRLGTPYR* |
Ga0075435_1010083622 | 3300007076 | Populus Rhizosphere | LIDALIDSGMDITAVGSEADLRARVARRLGTPYR* |
Ga0066710_1011117671 | 3300009012 | Grasslands Soil | NRAEIIRALIDGFIASGMDISATASERDLRDHVTRRLA |
Ga0099829_110226301 | 3300009038 | Vadose Zone Soil | IRGHSGKGLNRAEIIRALIDGLIDSGMDVTSTASEADLRGRLARRLGSPYR* |
Ga0105240_116404743 | 3300009093 | Corn Rhizosphere | EIIRALIDGLIESGMDVASAGSEADLRARVARRLGTPYR* |
Ga0105247_114628121 | 3300009101 | Switchgrass Rhizosphere | RALIDGVIDSGMDIAGAGSEADLRARVARRLGTPSR* |
Ga0066709_1003551641 | 3300009137 | Grasslands Soil | KVLNRAEIIRALIDGLIDSGMDITAVSSEADLRARIARRLGSPFR* |
Ga0066709_1013429741 | 3300009137 | Grasslands Soil | AMNRAKIIRALIDGLIDSGMDITGSGSEGDLRARVARRLGTSFR* |
Ga0066709_1027175151 | 3300009137 | Grasslands Soil | KSLNRAEIIRALIDGLIDSGMDITTSATEADLRARVARRLGTPYR* |
Ga0114129_116069204 | 3300009147 | Populus Rhizosphere | ALIDGLIDSGMDVTATGSEADLRARVARRLGSPYR* |
Ga0114129_122723991 | 3300009147 | Populus Rhizosphere | EIIRALIDGLIDSGIDVTATGSEADLRARVARRLGSPYR* |
Ga0111538_129751993 | 3300009156 | Populus Rhizosphere | IRALIDGLIDSGMDIIGAESERDLRGRVARRLGPSYR* |
Ga0075423_105485791 | 3300009162 | Populus Rhizosphere | KVLNRAEIIRALIDGLLDSGMDVSGSASEADLRARVARRLGTPYR* |
Ga0075423_111681233 | 3300009162 | Populus Rhizosphere | LIDGLIDSGMDITGSESERDLRGRVARRLGTPYR* |
Ga0075423_122748251 | 3300009162 | Populus Rhizosphere | KTGKVLNRAEIIRALIDGLIDSGMDITASASESDLRARVARRLGSPYR* |
Ga0075423_131234181 | 3300009162 | Populus Rhizosphere | ALIDGLIDSGMDITAAGSEADLRARIARRLGSPYR* |
Ga0105249_126290522 | 3300009553 | Switchgrass Rhizosphere | AEIIRALIDGLIESGMDITASGSEADLRARVARRLGTPFR* |
Ga0105249_133280783 | 3300009553 | Switchgrass Rhizosphere | IKGGKLLNRAEIIRALIDGLIDSGMDISGTTSERELRTRVARRLATPYR* |
Ga0105854_12321141 | 3300009660 | Permafrost Soil | IIRALIDGLIDSGMDVTGTASEADLRARVARRLGSPFR* |
Ga0134066_100683352 | 3300010364 | Grasslands Soil | VAARRKDGRSLNRAEVIRALIDGLIDSGMDITAAGSEADLRARVARRLAAPSR* |
Ga0134125_119312381 | 3300010371 | Terrestrial Soil | LIDGLLDSGMDVTASQSEADLRGRISRRLGTPFR* |
Ga0105239_129392801 | 3300010375 | Corn Rhizosphere | GKILNRAEIIRALIDGLLDSGMDVTTIASEADLHARVARRLGSPFR* |
Ga0126381_1002154931 | 3300010376 | Tropical Forest Soil | RAEIIRALIDGLIDSGMDIATSASEADLRARVARRLGTPFR* |
Ga0134124_101819411 | 3300010397 | Terrestrial Soil | EIIRALIDGLLDSGMDITGSASEADLRARVARRLGSPYR* |
Ga0134127_107479461 | 3300010399 | Terrestrial Soil | IRGLIDGLIESGMDITSTASEADLRGRVARRLGSPYR* |
Ga0134127_125575411 | 3300010399 | Terrestrial Soil | RALIDGLIDSGMDISATLSEADLRARVVRRLGSPYR* |
Ga0134121_107012561 | 3300010401 | Terrestrial Soil | IIRALIDGLIDSRMDVTAVSSEGDLRARVARRLGSPYR* |
Ga0134121_119769701 | 3300010401 | Terrestrial Soil | KSVGRPLNRAEIIRALIDALIESGIDIDSVTSEADLRARVARRLATPFR* |
Ga0134121_127294341 | 3300010401 | Terrestrial Soil | ALIDGLIDSGMDITGTGSEGDLRARVARRLGSPFR* |
Ga0137391_106324383 | 3300011270 | Vadose Zone Soil | ALIDGLIDSGMDITGTASESDLRGRVARRLGSPFR* |
Ga0137391_111294391 | 3300011270 | Vadose Zone Soil | NRAEIIRALIDGLIDSGMDVTSTASEADLRGRLARRLGSPYR* |
Ga0137375_101226131 | 3300012360 | Vadose Zone Soil | IIRALIDGLLDSGMDVTASASEADLRARVARRLGSQYR* |
Ga0150984_1153502451 | 3300012469 | Avena Fatua Rhizosphere | SLNRAEIIRALIDALIDSGMDITAVGSEADLRARVARRLGTPYR* |
Ga0150984_1171092783 | 3300012469 | Avena Fatua Rhizosphere | IRALIDGLIDSGMDITAAGSEADLRARVARRLGSSR* |
Ga0137419_100075641 | 3300012925 | Vadose Zone Soil | EIIRALIDGLIDSGMDVTAAGSEADLRARVARRLGSPYR* |
Ga0137404_115658561 | 3300012929 | Vadose Zone Soil | KTMNRAEIIRALIDGLIESGMDVAAAGSEADLRARVARRLGTPYR* |
Ga0137407_124423042 | 3300012930 | Vadose Zone Soil | RALVDALIESGMDVTPAGSESDLRGRIARRLGTPYR* |
Ga0137410_120715531 | 3300012944 | Vadose Zone Soil | IRALIDGLIESGMDVAAAGSEADLRARVARRLGTPYR* |
Ga0164303_115638501 | 3300012957 | Soil | LNRAEIIRALIDALIDSGMDITAIASEADLRARVARRLGTPYR* |
Ga0164302_115500671 | 3300012961 | Soil | ALIDGLIDSGMDIIGAESERDLRGRVARRLGPSYR* |
Ga0134077_101974953 | 3300012972 | Grasslands Soil | AEIIRALIDGLIDSGLDITATDSEADLRARVARRLGPLYR* |
Ga0157378_120472841 | 3300013297 | Miscanthus Rhizosphere | IIRALIDGLLDSGMDIAGSASEADLRSRVARRLGSPYR* |
Ga0163162_102236301 | 3300013306 | Switchgrass Rhizosphere | RAEIIRALIDGLLDSGMDITGSASEADLRARVARRLGSPYR* |
Ga0132256_1009008091 | 3300015372 | Arabidopsis Rhizosphere | LNRAEIIRALIDGLLDSGMDITGSASEADLRSRVARRLGSPYR* |
Ga0132257_1006476981 | 3300015373 | Arabidopsis Rhizosphere | IIRALIDALIDSGMDVAASASEADLRSRVARRLGTQLR* |
Ga0132257_1039820491 | 3300015373 | Arabidopsis Rhizosphere | LIDGLIDSGMDVRTTGSEADLRAKVARRLGTPYR* |
Ga0132255_1037882573 | 3300015374 | Arabidopsis Rhizosphere | ISGKILNRAEIIRALIDGLIDSGMDVRTTGSEADLRAKVARRLGTPYR* |
Ga0182035_118094412 | 3300016341 | Soil | RAEIIRALIDGLIDSGMDISTAGSEADLRARVARRLGTPYR |
Ga0187777_100212685 | 3300017974 | Tropical Peatland | RGHSGRILNRAELIRALIDGFIDSGMDITGAASEADMRARVARRLGSPFR |
Ga0184608_102648972 | 3300018028 | Groundwater Sediment | IRALIDGLIDSGMDVTGSGSEADLRARVARRLGTSFR |
Ga0184609_105065511 | 3300018076 | Groundwater Sediment | KVLNRAEIIRALIDGLIDSGMDITGTGSEGDLRARVARRLGSPFR |
Ga0184612_103140631 | 3300018078 | Groundwater Sediment | KVLNRAEIIRALIDGLFDSGMDVTGAASEADLRARVARRLGTPYR |
Ga0066655_100588133 | 3300018431 | Grasslands Soil | NRAEIIRALIDGLIDSGMDITTSATEADLRARVARRLGTPYR |
Ga0190271_100112174 | 3300018481 | Soil | MRGRNGKVMNRAEIIRALIDGLIDSGMDITSSGSEADLRAKVARHLGTPFR |
Ga0210378_101550481 | 3300021073 | Groundwater Sediment | IKRAELIRALIDALVDSGLDLTAAGSEAALKALLSARLGGT |
Ga0210382_100937683 | 3300021080 | Groundwater Sediment | KVVNRAEIIRALIDGLIESGMDITGSGSEADLRARVARRLGTPFR |
Ga0193706_11109243 | 3300021339 | Soil | TDIRGKSGKVINRAEIIRALIDGFIDSGLDVTGSESERDLRARLARRLGKAVR |
Ga0207666_10084032 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNRAEIIRALIDGLIDSGMDITAAATEADLRARIARRLGSPYR |
Ga0207697_102214932 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | IRALIDALIESGMDIAAVSSEADLRARVARRLATPFR |
Ga0207682_103402891 | 3300025893 | Miscanthus Rhizosphere | IRALIDVLIDSGMDITAAASESDLRARVARRLGSPYR |
Ga0207643_102700493 | 3300025908 | Miscanthus Rhizosphere | MNRAEIIRALIDGLIESGMDVAGTGSEADLRARVARRLGTPYR |
Ga0207684_103562312 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ALIDGLIDSGMDVMASGSEADLRAKVARRLGTHYR |
Ga0207660_107593572 | 3300025917 | Corn Rhizosphere | RAEIIRALIDGLIDSGMDITGAASESDLRTRVARRLGSPFR |
Ga0207687_118537041 | 3300025927 | Miscanthus Rhizosphere | LNRAEIIRGLIDGLIDSGMDITGAGSEADLRARIARRLGSPLR |
Ga0207706_100487943 | 3300025933 | Corn Rhizosphere | MLNRAEIIRALIDGLLDSGMDITGSASEADLRARVARRLGSPYR |
Ga0207706_114623792 | 3300025933 | Corn Rhizosphere | GKVLNRAEIIRALIDGLIDSGMDVTAADSEADLRALLGRRLGSPHR |
Ga0207686_110078132 | 3300025934 | Miscanthus Rhizosphere | LDDYGNSRLKSNGRSLNRAEIIRALIDALIESGIDIAAITSEADLRARVARRLATPFR |
Ga0207704_108832881 | 3300025938 | Miscanthus Rhizosphere | RALIDGLIDSGMDVTATASEADLRARVARRLGTPYR |
Ga0207711_119616482 | 3300025941 | Switchgrass Rhizosphere | AEIIRALIDGLIDSGMDVTATVSEADLRARVARRLGTPYR |
Ga0207712_112502231 | 3300025961 | Switchgrass Rhizosphere | LNRAEIIRALIDGLIDSGMDITAAATEADLRARIARRLGSPYR |
Ga0207677_106793961 | 3300026023 | Miscanthus Rhizosphere | IIRALIDGLIESGMDVAGTGSEADLRARVARRLGTPYR |
Ga0207698_118389182 | 3300026142 | Corn Rhizosphere | LNRAEIIRALIDALIESGIDIDSVTSEADLRARVARRLATPFR |
Ga0209847_10927602 | 3300026276 | Permafrost Soil | GKAMNRAEIIRALIDGFIESGMDVAGAGSEADLRARVARRLGTP |
Ga0209579_104838831 | 3300027869 | Surface Soil | RADTIRALIDGLLDSGMDISGTISEADLRARVARRLGSPYR |
Ga0268264_101215792 | 3300028381 | Switchgrass Rhizosphere | MRSRNGKAMNRAEIIRALIDGLIESGMDVVAAGSEANLRARVARRLGTPYR |
Ga0307497_106086021 | 3300031226 | Soil | GRPLNRAEIIRALIDALIESGMDVAAVTSEADLRARVARRLATPFR |
Ga0170824_1185041301 | 3300031231 | Forest Soil | MRNKHGKAMNRAEIIRALIDGLIESGMDIAGAGSEANLRARVARRLGTPYR |
Ga0310887_102606612 | 3300031547 | Soil | AEIIRALIDGLIDSGMDITSTATEADLRAKVARHLGTPFR |
Ga0310886_105017261 | 3300031562 | Soil | RALIDGLIDSGMDITAAATEADLRARIARRLGSPYR |
Ga0307405_117008272 | 3300031731 | Rhizosphere | SGKLLNRAEIIRALIDGLLDSGMDITSSATEADLRAKVARHLGTPFR |
Ga0306919_105707271 | 3300031879 | Soil | VNRTRSGKFLNRAEIIRALIDGLIDSGMDISTAGSEADLRARVARRLGTPYR |
Ga0306921_122482331 | 3300031912 | Soil | TRNGKAMNRAEIIRALIDGLIESGMDVIGAGSEANLRARVARRLGTPYR |
Ga0308174_103874911 | 3300031939 | Soil | AHLDGNDRSKSTGRPLNRAEIIRALIDALIESGIDIAAISSEADLRARVARRLATPFR |
Ga0310885_101742882 | 3300031943 | Soil | GKSGKVLNRAEIIRALIDGLIDSGIDVGATPSEADLRAKVARHLGTPFR |
Ga0310903_104900652 | 3300032000 | Soil | RSGKVLNRAEIIRALIDGLIDSGMDITSTATEADLRAKVARHLGTPFR |
Ga0310906_105754451 | 3300032013 | Soil | ALIDGLIDSGMDIIGAESERDLRGRVARRLGPSYR |
Ga0318510_101634022 | 3300032064 | Soil | LNRAEVIRALIDGLIDSGMDITSSPSEADLRARVARRLGTPFR |
Ga0310890_114177101 | 3300032075 | Soil | AEIIRSLIDGLIDSGMDVTGSGSESDLRARVARRLGTPFR |
Ga0318525_104676271 | 3300032089 | Soil | VNRARSGKFLNRAEIIRALIDGLIDSGMDISTAGSEADLRARVARRLGTPYR |
Ga0310896_101812091 | 3300032211 | Soil | RAITRAEIIRSLIDGLIDSGMDVTGSGSESDLRARVARRLGTPFR |
Ga0335082_100468441 | 3300032782 | Soil | LGDHNGAPRQGRSLNRAEIIRALIDGLIDSGMDVTTSGTEADLRARVARRLGTPFR |
Ga0372943_0697360_547_669 | 3300034268 | Soil | AEIIRALIDGFIESGMDITASGSEADLRARVARRLGTAIR |
Ga0373958_0223968_5_139 | 3300034819 | Rhizosphere Soil | VLNRAEIIRALIDGLLDSGMDITGSASEADLRARVARRLGSPYR |
⦗Top⦘ |