NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052467

Metagenome / Metatranscriptome Family F052467

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052467
Family Type Metagenome / Metatranscriptome
Number of Sequences 142
Average Sequence Length 43 residues
Representative Sequence VNPEERELARKNNVWGWSLLALALVLALGTAAVGLIYNAVSSY
Number of Associated Samples 106
Number of Associated Scaffolds 142

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 66.20 %
% of genes near scaffold ends (potentially truncated) 26.76 %
% of genes from short scaffolds (< 2000 bps) 89.44 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.394 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.268 % of family members)
Environment Ontology (ENVO) Unclassified
(25.352 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.479 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.34%    β-sheet: 0.00%    Coil/Unstructured: 43.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 142 Family Scaffolds
PF14026DUF4242 49.30
PF01040UbiA 28.87
PF01425Amidase 7.75
PF13191AAA_16 2.11
PF00115COX1 1.41
PF01189Methyltr_RsmB-F 0.70
PF02615Ldh_2 0.70
PF13442Cytochrome_CBB3 0.70
PF03575Peptidase_S51 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 142 Family Scaffolds
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 7.75
COG014416S rRNA C967 or C1407 C5-methylase, RsmB/RsmF familyTranslation, ribosomal structure and biogenesis [J] 0.70
COG2055Malate/lactate/ureidoglycolate dehydrogenase, LDH2 familyEnergy production and conversion [C] 0.70

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.39 %
UnclassifiedrootN/A17.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_21761All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300000956|JGI10216J12902_101282606All Organisms → cellular organisms → Bacteria3135Open in IMG/M
3300001686|C688J18823_11084652All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300002568|C688J35102_119444673All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300002568|C688J35102_119539152All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300002568|C688J35102_119914640Not Available812Open in IMG/M
3300002568|C688J35102_120901614All Organisms → cellular organisms → Bacteria2150Open in IMG/M
3300004114|Ga0062593_100760557All Organisms → cellular organisms → Bacteria → Terrabacteria group956Open in IMG/M
3300004114|Ga0062593_101123650All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300004157|Ga0062590_101849972All Organisms → cellular organisms → Bacteria → Terrabacteria group621Open in IMG/M
3300004643|Ga0062591_100463153All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300004643|Ga0062591_100946696All Organisms → cellular organisms → Bacteria → Terrabacteria group813Open in IMG/M
3300005093|Ga0062594_100126254All Organisms → cellular organisms → Bacteria1608Open in IMG/M
3300005093|Ga0062594_100173357All Organisms → cellular organisms → Bacteria1457Open in IMG/M
3300005093|Ga0062594_103056913Not Available523Open in IMG/M
3300005186|Ga0066676_10210123All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300005186|Ga0066676_10865781Not Available608Open in IMG/M
3300005332|Ga0066388_100241553All Organisms → cellular organisms → Bacteria2442Open in IMG/M
3300005332|Ga0066388_100459604All Organisms → cellular organisms → Bacteria1914Open in IMG/M
3300005332|Ga0066388_103413243All Organisms → cellular organisms → Bacteria → Terrabacteria group811Open in IMG/M
3300005356|Ga0070674_100848009All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300005365|Ga0070688_100897809All Organisms → cellular organisms → Bacteria → Terrabacteria group699Open in IMG/M
3300005435|Ga0070714_101617759Not Available633Open in IMG/M
3300005436|Ga0070713_102472404All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300005440|Ga0070705_100916466Not Available706Open in IMG/M
3300005445|Ga0070708_101095195All Organisms → cellular organisms → Bacteria → Terrabacteria group746Open in IMG/M
3300005445|Ga0070708_102047556All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005471|Ga0070698_101566199Not Available611Open in IMG/M
3300005526|Ga0073909_10013207All Organisms → cellular organisms → Bacteria2558Open in IMG/M
3300005526|Ga0073909_10014747All Organisms → cellular organisms → Bacteria2443Open in IMG/M
3300005535|Ga0070684_100711153All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300005536|Ga0070697_100520838All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300005549|Ga0070704_100488678All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300005553|Ga0066695_10886107All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005558|Ga0066698_10732749All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005617|Ga0068859_101405220All Organisms → cellular organisms → Bacteria → Proteobacteria770Open in IMG/M
3300005713|Ga0066905_102239509Not Available510Open in IMG/M
3300005718|Ga0068866_11131525Not Available562Open in IMG/M
3300005764|Ga0066903_100037955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter5617Open in IMG/M
3300005764|Ga0066903_100283563All Organisms → cellular organisms → Bacteria → Terrabacteria group2600Open in IMG/M
3300005764|Ga0066903_100377583All Organisms → cellular organisms → Bacteria2314Open in IMG/M
3300005764|Ga0066903_104373880Not Available755Open in IMG/M
3300006804|Ga0079221_11762388Not Available506Open in IMG/M
3300009090|Ga0099827_10077852All Organisms → cellular organisms → Bacteria2580Open in IMG/M
3300009098|Ga0105245_11521196All Organisms → cellular organisms → Bacteria → Terrabacteria group720Open in IMG/M
3300009137|Ga0066709_101615471All Organisms → cellular organisms → Bacteria → Terrabacteria group927Open in IMG/M
3300009148|Ga0105243_11462443Not Available706Open in IMG/M
3300009176|Ga0105242_10138826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2107Open in IMG/M
3300009545|Ga0105237_11674895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300009553|Ga0105249_11148072All Organisms → cellular organisms → Bacteria → Terrabacteria group847Open in IMG/M
3300009840|Ga0126313_10123809All Organisms → cellular organisms → Bacteria → Terrabacteria group1927Open in IMG/M
3300009840|Ga0126313_11889006All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300010036|Ga0126305_10753666All Organisms → cellular organisms → Bacteria → Terrabacteria group660Open in IMG/M
3300010039|Ga0126309_10147557All Organisms → cellular organisms → Bacteria1261Open in IMG/M
3300010044|Ga0126310_10497335All Organisms → cellular organisms → Bacteria → Terrabacteria group890Open in IMG/M
3300010044|Ga0126310_10614347Not Available812Open in IMG/M
3300010045|Ga0126311_10482228All Organisms → cellular organisms → Bacteria → Terrabacteria group967Open in IMG/M
3300010147|Ga0126319_1556558All Organisms → cellular organisms → Bacteria → Terrabacteria group817Open in IMG/M
3300010326|Ga0134065_10494299Not Available508Open in IMG/M
3300010335|Ga0134063_10437973Not Available646Open in IMG/M
3300010359|Ga0126376_11494212All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300010366|Ga0126379_11364505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium815Open in IMG/M
3300010375|Ga0105239_13578727All Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
3300010398|Ga0126383_12982559All Organisms → cellular organisms → Bacteria → Terrabacteria group553Open in IMG/M
3300011003|Ga0138514_100022790All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300012014|Ga0120159_1003028All Organisms → cellular organisms → Bacteria8777Open in IMG/M
3300012204|Ga0137374_10063243All Organisms → cellular organisms → Bacteria3698Open in IMG/M
3300012204|Ga0137374_10212445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1655Open in IMG/M
3300012204|Ga0137374_10323336All Organisms → cellular organisms → Bacteria → Terrabacteria group1255Open in IMG/M
3300012204|Ga0137374_10351047All Organisms → cellular organisms → Bacteria → Terrabacteria group1189Open in IMG/M
3300012204|Ga0137374_11279417Not Available507Open in IMG/M
3300012212|Ga0150985_103568344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium978Open in IMG/M
3300012212|Ga0150985_120935994All Organisms → cellular organisms → Bacteria → Terrabacteria group641Open in IMG/M
3300012350|Ga0137372_10001432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria23017Open in IMG/M
3300012353|Ga0137367_10118091All Organisms → cellular organisms → Bacteria → Terrabacteria group1949Open in IMG/M
3300012353|Ga0137367_10261205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1244Open in IMG/M
3300012355|Ga0137369_10227815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1423Open in IMG/M
3300012355|Ga0137369_10474274All Organisms → cellular organisms → Bacteria → Terrabacteria group889Open in IMG/M
3300012355|Ga0137369_10629416All Organisms → cellular organisms → Bacteria → Terrabacteria group743Open in IMG/M
3300012360|Ga0137375_11065798All Organisms → cellular organisms → Bacteria → Terrabacteria group630Open in IMG/M
3300012362|Ga0137361_11959806All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300012469|Ga0150984_112906863All Organisms → cellular organisms → Bacteria → Terrabacteria group627Open in IMG/M
3300012469|Ga0150984_116286869All Organisms → cellular organisms → Bacteria → Terrabacteria group549Open in IMG/M
3300012532|Ga0137373_10096153All Organisms → cellular organisms → Bacteria → Terrabacteria group2602Open in IMG/M
3300012955|Ga0164298_10338026All Organisms → cellular organisms → Bacteria → Terrabacteria group948Open in IMG/M
3300012955|Ga0164298_11588345All Organisms → cellular organisms → Bacteria → Terrabacteria group514Open in IMG/M
3300012957|Ga0164303_11162192All Organisms → cellular organisms → Bacteria → Terrabacteria group562Open in IMG/M
3300012960|Ga0164301_11433886Not Available566Open in IMG/M
3300012960|Ga0164301_11521221Not Available552Open in IMG/M
3300012989|Ga0164305_10306785All Organisms → cellular organisms → Bacteria → Terrabacteria group1175Open in IMG/M
3300013772|Ga0120158_10241468All Organisms → cellular organisms → Bacteria → Terrabacteria group910Open in IMG/M
3300014150|Ga0134081_10285420Not Available588Open in IMG/M
3300015265|Ga0182005_1136386Not Available706Open in IMG/M
3300015371|Ga0132258_13021734All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300015373|Ga0132257_103294006All Organisms → cellular organisms → Bacteria → Terrabacteria group588Open in IMG/M
3300016422|Ga0182039_10981350All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300017997|Ga0184610_1253559All Organisms → cellular organisms → Bacteria → Terrabacteria group584Open in IMG/M
3300018061|Ga0184619_10272741All Organisms → cellular organisms → Bacteria → Terrabacteria group777Open in IMG/M
3300018072|Ga0184635_10223792Not Available748Open in IMG/M
3300018431|Ga0066655_10597417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288743Open in IMG/M
3300018482|Ga0066669_11638777All Organisms → cellular organisms → Bacteria → Terrabacteria group589Open in IMG/M
3300019362|Ga0173479_10374485All Organisms → cellular organisms → Bacteria → Terrabacteria group677Open in IMG/M
3300021344|Ga0193719_10358073Not Available606Open in IMG/M
3300025899|Ga0207642_10632243All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300025922|Ga0207646_10303983All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300025922|Ga0207646_10645786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium948Open in IMG/M
3300025922|Ga0207646_10849504All Organisms → cellular organisms → Bacteria → Terrabacteria group811Open in IMG/M
3300025922|Ga0207646_11221407All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300025927|Ga0207687_11368195All Organisms → cellular organisms → Bacteria → Terrabacteria group608Open in IMG/M
3300025933|Ga0207706_11739175Not Available501Open in IMG/M
3300025934|Ga0207686_11045666All Organisms → cellular organisms → Bacteria → Terrabacteria group664Open in IMG/M
3300025937|Ga0207669_11210328All Organisms → cellular organisms → Bacteria → Terrabacteria group640Open in IMG/M
3300025937|Ga0207669_11645771Not Available548Open in IMG/M
3300025938|Ga0207704_11462844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300025939|Ga0207665_10813389All Organisms → cellular organisms → Bacteria → Terrabacteria group739Open in IMG/M
3300025944|Ga0207661_10691900All Organisms → cellular organisms → Bacteria → Terrabacteria group938Open in IMG/M
3300026075|Ga0207708_10558197All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300026075|Ga0207708_11489023All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300026121|Ga0207683_11092480Not Available740Open in IMG/M
3300026327|Ga0209266_1126015All Organisms → cellular organisms → Bacteria → Terrabacteria group1080Open in IMG/M
3300027821|Ga0209811_10068555All Organisms → cellular organisms → Bacteria → Terrabacteria group1237Open in IMG/M
3300027821|Ga0209811_10354550All Organisms → cellular organisms → Bacteria → Terrabacteria group568Open in IMG/M
3300027882|Ga0209590_10014682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3799Open in IMG/M
3300028381|Ga0268264_11077320All Organisms → cellular organisms → Bacteria → Terrabacteria group812Open in IMG/M
3300028716|Ga0307311_10262686All Organisms → cellular organisms → Bacteria → Terrabacteria group515Open in IMG/M
3300028720|Ga0307317_10054196All Organisms → cellular organisms → Bacteria → Terrabacteria group1289Open in IMG/M
3300028771|Ga0307320_10382449All Organisms → cellular organisms → Bacteria → Terrabacteria group564Open in IMG/M
3300028807|Ga0307305_10076691All Organisms → cellular organisms → Bacteria1543Open in IMG/M
3300028828|Ga0307312_11124071All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300028875|Ga0307289_10183788All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300031421|Ga0308194_10198191All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300031543|Ga0318516_10424436Not Available765Open in IMG/M
3300031544|Ga0318534_10110075All Organisms → cellular organisms → Bacteria → Terrabacteria group1580Open in IMG/M
3300031668|Ga0318542_10426181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300031799|Ga0318565_10466747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300031821|Ga0318567_10661806All Organisms → cellular organisms → Bacteria → Terrabacteria group593Open in IMG/M
3300031938|Ga0308175_100644641All Organisms → cellular organisms → Bacteria → Terrabacteria group1145Open in IMG/M
3300031938|Ga0308175_101620385All Organisms → cellular organisms → Bacteria → Terrabacteria group724Open in IMG/M
3300031996|Ga0308176_11571791All Organisms → cellular organisms → Bacteria → Terrabacteria group701Open in IMG/M
3300031996|Ga0308176_12350925All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300032008|Ga0318562_10094632All Organisms → cellular organisms → Bacteria1689Open in IMG/M
3300032074|Ga0308173_10672742All Organisms → cellular organisms → Bacteria → Terrabacteria group944Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.63%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.52%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.11%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.11%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.11%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.11%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.11%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.11%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.41%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.41%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.41%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.41%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.41%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.41%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.70%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.70%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.70%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.70%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.70%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_033738002199352025SoilVNDQERELAHKNNVFGWSLFALALVLGLGTAAIALIYNAVSSY
JGI10216J12902_10128260623300000956SoilVNDQERELAHKNNVFGWSLFALALVLALGTAAIALIYNAVSSY*
C688J18823_1108465213300001686SoilGAALRRHGGGRSLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY*
C688J35102_11944467323300002568SoilMNPEERELARKNNVWGWSLLALVLVLALGTAAVGLIYNAVSSY*
C688J35102_11953915223300002568SoilLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY*
C688J35102_11991464023300002568SoilVNPEERELARKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY*
C688J35102_12090161433300002568SoilVTPEERELARKNNALGWSLFALAVVLTLGTVAVALVYNAVSSS*
Ga0062593_10076055723300004114SoilMNDQERELAHKNNVFGWSLFALALVLGLGTAAIALIYNAVSSY*
Ga0062593_10112365023300004114SoilVSDEERELAHKNNVLGWSLFALALVLGLGTAAVALIFNAVSSY*
Ga0062590_10184997223300004157SoilVNEEERELAHKNNVWGWSLFALALVLGLGTAAIALIFNAVSSY*
Ga0062591_10046315313300004643SoilVNEEERELAHKNNVWGWSLFALALVLALGTVAVALIYNAVASS*
Ga0062591_10094669633300004643SoilVNPEERELSRKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY*
Ga0062594_10012625423300005093SoilLTPEEREIARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY*
Ga0062594_10017335733300005093SoilVNPEERELARRNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY*
Ga0062594_10305691313300005093SoilVNVDEERELAHKNNVWGWSLFALALVLGLGTVAVALIYNAVASS*
Ga0066676_1021012333300005186SoilALRRDGGGRPVTPDERELAKTNNVWGWSLLALAVVIALGTVAVALIYDAVASY*
Ga0066676_1086578123300005186SoilLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNSVSSY*
Ga0066388_10024155323300005332Tropical Forest SoilVTPDERELAKTNNVWGWSLLALAVVIGLGTVAVGLIYNAVSSY*
Ga0066388_10045960413300005332Tropical Forest SoilEERELARKNNVLGWSLLALAIVLALGTVAVGLIYNAVSSS*
Ga0066388_10341324323300005332Tropical Forest SoilVTPEERELARKNNVLGWSLLVLAIVLALGTVAVGLIYNAVSSN*
Ga0070674_10084800923300005356Miscanthus RhizosphereVNDQERELARRNNAFGWSLFALALALGLGTVAIALIYNAVSSY*
Ga0070688_10089780933300005365Switchgrass RhizosphereVTPEEQELARKNNALGWSLFALAVVLALGTIAVALIYDAVASS*
Ga0070714_10161775923300005435Agricultural SoilVNGDERELARRNNVLGWSLLALAIVLALGTVAVGLIYNAVANG*
Ga0070713_10247240413300005436Corn, Switchgrass And Miscanthus RhizosphereVNPEERELARRNNTLGWSLLALAIVLALGTVAVGLIYNAVSSY*
Ga0070705_10091646623300005440Corn, Switchgrass And Miscanthus RhizosphereVNDQERELAHKNNVLGWSLFALALVLGLGTAAVALIYNAVSSY*
Ga0070708_10109519533300005445Corn, Switchgrass And Miscanthus RhizosphereMTPEERELARKNNVMGWSLFALALVIGLGTAAVALIYNAISSS*
Ga0070708_10204755623300005445Corn, Switchgrass And Miscanthus RhizosphereVNDEERELAHKNNVLGWSLFALAIVLGLGTAAVALIYNAVSSY*
Ga0070698_10156619913300005471Corn, Switchgrass And Miscanthus RhizosphereVNDQERELAHKNNVLGWSLFALAIVLGLGTAAVALIYNAVSSY*
Ga0073909_1001320723300005526Surface SoilVTPEERELSRRNNVLGWSLLALAVVLALGTVAVGLIFNAVSSS*
Ga0073909_1001474733300005526Surface SoilVNDQERELAHKNNVFGWSLFALALVLGLGTAAIALIYNAVSSY*
Ga0070684_10071115313300005535Corn RhizosphereVSPEEQELARKNNALGWSLFALAVVLALGTIAVALIYDAVASS*
Ga0070697_10052083823300005536Corn, Switchgrass And Miscanthus RhizosphereVNGDERELAHKNNVLGWSLFALALVLGLGTAAVALIFNAVSSY*
Ga0070704_10048867833300005549Corn, Switchgrass And Miscanthus RhizosphereMNQRSANSDEQTERDLARRNNVLGWSLFALALVLGLGTAAVALIFNAVSSS*
Ga0066695_1088610723300005553SoilVTPDERELAKTNNVWGWSLLALAVVIALGTVAVALIYDAVASY*
Ga0066698_1073274923300005558SoilVTEDEREVATRNNVLGWSLLALALVLGLGTAAVALIFNAVSSY*
Ga0068859_10140522033300005617Switchgrass RhizosphereARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY*
Ga0066905_10223950923300005713Tropical Forest SoilMTPEERELARKNNVLGWSLLALAIVLALGTVAVGLIYNAVSSN*
Ga0068866_1113152523300005718Miscanthus RhizosphereVNEQERELARRNNAFGWSLFALALVLGLGTVAIALIYNAVSSY*
Ga0066903_10003795523300005764Tropical Forest SoilVTPEEREIARRNNVWGWSLLAFAIVLALGTVAIGLIYNAVSSY*
Ga0066903_10028356333300005764Tropical Forest SoilVTPEERDLARRNNVLGWSLLALAIVLALGTVAVGLIYNAVANG*
Ga0066903_10037758333300005764Tropical Forest SoilMDEERELAHRNNVLGWSLLALAIVLALGTVAVGLIYNAVANG*
Ga0066903_10437388023300005764Tropical Forest SoilVTRPAMTPEEQALARKNNVWGWSLLALAVVIALGTVAVALIYNSIAGS*
Ga0079221_1176238813300006804Agricultural SoilVNHPEERELARRNNVLGWSLLALAIVLALGTVAVALIYNAVATG*
Ga0099827_1007785223300009090Vadose Zone SoilVNEAERELARKNNVLGWSLFALALVLGLGTVAVALIFNAVSSY*
Ga0105245_1152119633300009098Miscanthus RhizosphereELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY*
Ga0066709_10161547123300009137Grasslands SoilVTEDGREVATRNNVLGWSLLALALVLGLGTAAVALIFNAVSSY*
Ga0105243_1146244323300009148Miscanthus RhizosphereVNDQERELARRNNAFGWSLFALALVLGLGTVAIALIYNAVSSY*
Ga0105242_1013882633300009176Miscanthus RhizosphereLTPEEREIARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSN*
Ga0105237_1167489523300009545Corn RhizosphereVTPEEQELARRNNVWGWSLFALAVVLALGTAAIALIYNAVSGS*
Ga0105249_1114807223300009553Switchgrass RhizosphereLTPEEQELARKNNALGWSLFALAVVLALGTIAVALIYNAVSSS*
Ga0126313_1012380933300009840Serpentine SoilVNPEERELARKNNVWGWSLLALALVLALGTAAVGLIYNAVSSY*
Ga0126313_1188900623300009840Serpentine SoilVTPEERELARKNNVWGWSLLALAILLALGTAAVGLIYNAVSSY*
Ga0126305_1075366623300010036Serpentine SoilVTPEERELARKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY*
Ga0126309_1014755723300010039Serpentine SoilMTPEEQEVARRNNVWGWSLFVLAVVLGLGTAAVALIYNAVSSY*
Ga0126310_1049733533300010044Serpentine SoilVNEREREIAGKNNVLGWSLLALAVVLGLGTAAVALIFNAVSSY*
Ga0126310_1061434713300010044Serpentine SoilVTSEEREIAARNNVWGWWLFALALVLGLGTVAVAFIFNAVSSY*
Ga0126311_1048222833300010045Serpentine SoilVNEHERELARKNNVWGWSLLALALVLGLGTAAVALIFNAVSSY*
Ga0126319_155655823300010147SoilVNDQERELARRNNAFGWSLFALALLLGLGTVAIALIYNAVSSY*
Ga0134065_1049429913300010326Grasslands SoilVTPDERELAKTNNVWGWSLLALAVVIALGTVAVALIYDAVACY*
Ga0134063_1043797313300010335Grasslands SoilLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNSISSY*
Ga0126376_1149421223300010359Tropical Forest SoilMTPEEQELARKNNVWGWSLFALAVVLALGTTAIALIYNAVASS*
Ga0126379_1136450523300010366Tropical Forest SoilVTEPVHDEREIARRNNVLGWSLLALAIVLCLGTVAVAFIYNAVSSY*
Ga0105239_1357872723300010375Corn RhizospherePLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY*
Ga0126383_1298255923300010398Tropical Forest SoilPVTPEERDLARRNNVLGWSLLALAIVLALGTVAVGLIYNAVANG*
Ga0138514_10002279023300011003SoilVNDAERELARKNNVLGWSLFALALVLGLGTVAVALIFNAVSSY*
Ga0120159_100302873300012014PermafrostVNEEERALARRNNVLGWSLFALALVLGLGTAAVALIFNAVSNS*
Ga0137374_1006324333300012204Vadose Zone SoilVNDQERELARRNNIWGWSLLALALVLGLGTAAVALIYNAVSSS*
Ga0137374_1021244513300012204Vadose Zone SoilVNEQERELARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSS*
Ga0137374_1032333613300012204Vadose Zone SoilRELARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSS*
Ga0137374_1035104723300012204Vadose Zone SoilVTENERDLARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSY*
Ga0137374_1127941713300012204Vadose Zone SoilVNDEDLARKNNVWGWSLFALALVLGLGTAAVALIFNAV
Ga0150985_10356834423300012212Avena Fatua RhizosphereMNPEERELSRKNNVWGWSLLALTIVLALGTAAVGLIYNAVSSY*
Ga0150985_12093599433300012212Avena Fatua RhizosphereELARKNNVWGWSLLALVLVLALGTAAVGLIYNAVSSY*
Ga0137372_10001432243300012350Vadose Zone SoilVNEHERELARENNVWGWSLFALALVLGLGTAAVALIFNAVSSY*
Ga0137367_1011809123300012353Vadose Zone SoilVNDQERELARRNNIWGWSLLALALVLGLCTAAVALIYNAVSSS*
Ga0137367_1026120513300012353Vadose Zone SoilVTKNERDLARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSY*
Ga0137369_1022781533300012355Vadose Zone SoilVTKNERDLARKNNVWGWSLFALALVLGLGTAAVALIFNA
Ga0137369_1047427433300012355Vadose Zone SoilGVGRAVTKNERDLARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSS*
Ga0137369_1062941633300012355Vadose Zone SoilVNDEDLARKNNVWGWSLFALALALGLGTAAVALIFNAVSSY*
Ga0137375_1106579813300012360Vadose Zone SoilNERDLARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSY*
Ga0137361_1195980613300012362Vadose Zone SoilEERTLAHKNNVLGWSLFTLAIVLGLGTAAVALIYNALSSY*
Ga0150984_11290686313300012469Avena Fatua RhizosphereLARKNNVWGWSLLALVLVLALGTAAVGLIYNAVSSY*
Ga0150984_11628686913300012469Avena Fatua RhizosphereLARKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY*
Ga0137373_1009615333300012532Vadose Zone SoilRDGVGRAVTKNERDLARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSY*
Ga0164298_1033802633300012955SoilRDGGRRSVTPEERELSRRNNVLGWSLLALAVVLALGTVAVGLIFNAVSSS*
Ga0164298_1158834513300012955SoilEEQELARRNNALGWSLFALAVVLALGTVAVALIYNAVSNS*
Ga0164303_1116219233300012957SoilLSRRNNVLGWSLLALAVVLALGTVAVGLIFNAVSSS*
Ga0164301_1143388623300012960SoilVSPEEQKLARKNNALGWSLFALAVVLALGTIAVALIYDAVASS*
Ga0164301_1152122123300012960SoilLSPEEQELARRNNALGWSLFALAVVLALGTVAVALIYNAVSNS*
Ga0164305_1030678523300012989SoilLSPEEQELARRNNALGWSLFALAVVLALGTIAVALIYDAVASS*
Ga0120158_1024146833300013772PermafrostVNEEERALARRNNVLGWSLFALALVLGLGTAAVALIFNAVSSS*
Ga0134081_1028542013300014150Grasslands SoilLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLI
Ga0182005_113638623300015265RhizosphereLTPEEQELARKNNALGWSLFALALVLALGTVAVALIYDAVASS*
Ga0132258_1302173423300015371Arabidopsis RhizosphereVNVDEERELAHKNNVWGWSLFALALAIALGTVAVALIYNAVASS*
Ga0132257_10329400613300015373Arabidopsis RhizosphereMTPEEQELARKNNALGWSLFALAVVLALGTVAVALIYNAVSSS*
Ga0182039_1098135023300016422SoilRRPVTPEDRELAHKNNVLGWSLLAFAIVLALATVAIGLIFNAVSSY
Ga0184610_125355923300017997Groundwater SedimentVNDQERELAHKNNVWGWSLFALALVLGLGTAAVALIFNAVSSY
Ga0184619_1027274133300018061Groundwater SedimentNDAERELARKNNVLGWSLFALAVVLGLGTVAVALIFNALASY
Ga0184635_1022379223300018072Groundwater SedimentMNDQERELAHKNNVFGWSLFALALVLGLGTAAIALIYNAVSSY
Ga0066655_1059741723300018431Grasslands SoilLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNSVSSY
Ga0066669_1163877723300018482Grasslands SoilCIPGAALRRHGGGRPLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNSVSSY
Ga0173479_1037448533300019362SoilMTPEEQELARKNNALGWSLFALAVVLALGTVAVALIYNAVSSS
Ga0193719_1035807323300021344SoilVREDEREIARRNNVLGWSLFALAIVLGLGTAAVGLIFNALSSY
Ga0207642_1063224323300025899Miscanthus RhizosphereVNEQERELARRNNAFGWSLFALALVLGLGTVAIALIYNAVSSY
Ga0207646_1030398323300025922Corn, Switchgrass And Miscanthus RhizosphereVNDEERELAHKNNVLGWSLFALAIVLGLGTAAVALIYNAVSSY
Ga0207646_1064578623300025922Corn, Switchgrass And Miscanthus RhizosphereVNGDERELAHKNNVLGWSLLALALVLGLGTAAVALIFNAVSSY
Ga0207646_1084950423300025922Corn, Switchgrass And Miscanthus RhizosphereVNDQERELAHKNNVLGWWLFALALVLGLGTAAVALIYNAVSSY
Ga0207646_1122140723300025922Corn, Switchgrass And Miscanthus RhizosphereMTPEERELARKNNVMGWSLFALALVIGLGTAAVALIYNAISSS
Ga0207687_1136819533300025927Miscanthus RhizosphereELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY
Ga0207706_1173917523300025933Corn RhizosphereVNDQERELARRNNAFGWSLFALALVLGLGTVAIALIYNAVSSY
Ga0207686_1104566613300025934Miscanthus RhizosphereARRNNAFGWSLFALALVLGLGTVAIALIYNAVSSY
Ga0207669_1121032813300025937Miscanthus RhizosphereVNDQERELARRNNAFGWSLFALALALGLGTVAIALIYNAVSSY
Ga0207669_1164577113300025937Miscanthus RhizosphereLTPEEREIARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSN
Ga0207704_1146284423300025938Miscanthus RhizosphereVRRHGGRRSVNPDERELARKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY
Ga0207665_1081338913300025939Corn, Switchgrass And Miscanthus RhizosphereERELARRNNVLGWSLFALAIVLALGTVAVGLIYNAVANG
Ga0207661_1069190023300025944Corn RhizosphereVNPEERELARRNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY
Ga0207708_1055819723300026075Corn, Switchgrass And Miscanthus RhizosphereVNVDEERELARKNNVWGWSLFALALVLGLGTVAVALIYNAVASS
Ga0207708_1148902323300026075Corn, Switchgrass And Miscanthus RhizosphereLPRAALRRHGGGRPLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY
Ga0207683_1109248023300026121Miscanthus RhizosphereVNPDERELARKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY
Ga0209266_112601523300026327SoilVTPDERELAKTNNVWGWSLLALAVVIALGTVAVALIYDAVASY
Ga0209811_1006855533300027821Surface SoilLRRDGGRRPVTPEERELSRRNNVLGWSLLALAVVLALGTVAVGLIFNAVSSS
Ga0209811_1035455023300027821Surface SoilVNDQERELAHRNNVFGWWLFALALILGLGTAAVALIYNAVSSY
Ga0209590_1001468233300027882Vadose Zone SoilVNEAERELARKNNVLGWSLFALALVLGLGTVAVALIFNAVSSY
Ga0268264_1107732023300028381Switchgrass RhizosphereVSPEEQELARKNNALGWSLFALAVVLALGTIAVALIYDAVASS
Ga0307311_1026268623300028716SoilVNDAERELARKNNVLGWSLFALAVVLGLGTVAVALIFNALASY
Ga0307317_1005419633300028720SoilVPMTPEEQELARKNNALGWSLFALAVVLALGTVAVALIYNAVSSS
Ga0307320_1038244913300028771SoilALRPDGGGRPVTPEEREIARRNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY
Ga0307305_1007669133300028807SoilVNDAERELARKNNVLGWSLFALALVLGLGTVAVALIFNAVASY
Ga0307312_1112407123300028828SoilVNDAERELARKNNVLGWSLFALALVLGLGTVAVALIFNAVSNS
Ga0307289_1018378813300028875SoilLNPEERELARKNNVWGWSLLALVLVLALGTAAVGLIYNA
Ga0308194_1019819123300031421SoilVNDAERELARKNNVLGWSLFALAVVLGLGTVAVALIFNAVSSY
Ga0318516_1042443623300031543SoilVTRPAMTPEEQALARKNNVWGWSLLALAVVIALGTVAVALIYNSIAG
Ga0318534_1011007533300031544SoilVTPEDRELAHKNNVLGWSLLAFAIVLALATVAIGLIFNAVSSY
Ga0318542_1042618123300031668SoilVTRPAMTPEEQALARKNNVWGWSLLALAVVIALGTVAVALIYNSIAGS
Ga0318565_1046674723300031799SoilAVTRPAMTPEEQALARKNNVWGWSLLALAVVIALGTVAVALIYNSIAGS
Ga0318567_1066180613300031821SoilLAHKNNVLGWSLLAFAIVLALATVAIGLIFNAVSSY
Ga0308175_10064464123300031938SoilVNPEERELARKNNVWGWSLLALAIALALGTAAVGLIYNAVSSY
Ga0308175_10162038533300031938SoilVNPEERELARRNNVWGWSLLALAIVLALGTVAIGYIFNAVSSY
Ga0308176_1157179133300031996SoilVNPEERELSRKNNVWGWSLLALAVVLALGTAAVGLIYNAVSSY
Ga0308176_1235092523300031996SoilVTPEEREVARKNNALGWSLFALAVVLTLGTVAVALVYNAVSGS
Ga0318562_1009463233300032008SoilMTPEEQALARKNNVWGWSLLALAVVIALGTVAVALIYNSIAGS
Ga0308173_1067274223300032074SoilVNPEERELSRKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.