Basic Information | |
---|---|
Family ID | F052250 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 143 |
Average Sequence Length | 40 residues |
Representative Sequence | RHHEGRGAWVLTAYGISGLALFGVLAYFFSDFISH |
Number of Associated Samples | 128 |
Number of Associated Scaffolds | 143 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 2.82 % |
% of genes near scaffold ends (potentially truncated) | 83.92 % |
% of genes from short scaffolds (< 2000 bps) | 83.22 % |
Associated GOLD sequencing projects | 122 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (60.140 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.385 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.371 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.245 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.03% β-sheet: 0.00% Coil/Unstructured: 53.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 143 Family Scaffolds |
---|---|---|
PF00586 | AIRS | 24.48 |
PF02769 | AIRS_C | 16.08 |
PF12969 | DUF3857 | 4.90 |
PF00551 | Formyl_trans_N | 2.80 |
PF00579 | tRNA-synt_1b | 1.40 |
PF13432 | TPR_16 | 1.40 |
PF13517 | FG-GAP_3 | 1.40 |
PF00154 | RecA | 1.40 |
PF06800 | Sugar_transport | 0.70 |
PF14559 | TPR_19 | 0.70 |
PF03992 | ABM | 0.70 |
PF03069 | FmdA_AmdA | 0.70 |
PF05426 | Alginate_lyase | 0.70 |
PF13673 | Acetyltransf_10 | 0.70 |
PF12849 | PBP_like_2 | 0.70 |
PF13649 | Methyltransf_25 | 0.70 |
PF05960 | DUF885 | 0.70 |
PF02790 | COX2_TM | 0.70 |
PF01425 | Amidase | 0.70 |
COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
---|---|---|---|
COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.40 |
COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.40 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 1.40 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.70 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.70 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.70 |
COG4975 | Glucose uptake protein GlcU | Carbohydrate transport and metabolism [G] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 60.14 % |
All Organisms | root | All Organisms | 39.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_103279489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300001471|JGI12712J15308_10000549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11133 | Open in IMG/M |
3300005434|Ga0070709_10172087 | Not Available | 1514 | Open in IMG/M |
3300005434|Ga0070709_10289483 | Not Available | 1193 | Open in IMG/M |
3300005445|Ga0070708_102259450 | Not Available | 502 | Open in IMG/M |
3300005533|Ga0070734_10683220 | Not Available | 584 | Open in IMG/M |
3300005542|Ga0070732_10246116 | Not Available | 1071 | Open in IMG/M |
3300005542|Ga0070732_10337019 | Not Available | 907 | Open in IMG/M |
3300005559|Ga0066700_11160212 | Not Available | 504 | Open in IMG/M |
3300005591|Ga0070761_10007972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 6043 | Open in IMG/M |
3300005602|Ga0070762_10638044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
3300005610|Ga0070763_10803480 | Not Available | 556 | Open in IMG/M |
3300005712|Ga0070764_10032930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2619 | Open in IMG/M |
3300005764|Ga0066903_104470981 | Not Available | 746 | Open in IMG/M |
3300005764|Ga0066903_107331166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300005874|Ga0075288_1046832 | Not Available | 664 | Open in IMG/M |
3300005995|Ga0066790_10078944 | Not Available | 1415 | Open in IMG/M |
3300006028|Ga0070717_11996911 | Not Available | 523 | Open in IMG/M |
3300006162|Ga0075030_100585457 | Not Available | 885 | Open in IMG/M |
3300006914|Ga0075436_100350581 | Not Available | 1064 | Open in IMG/M |
3300007076|Ga0075435_100342328 | Not Available | 1281 | Open in IMG/M |
3300009029|Ga0066793_10682540 | Not Available | 584 | Open in IMG/M |
3300009525|Ga0116220_10186801 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300009623|Ga0116133_1001187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 7625 | Open in IMG/M |
3300009628|Ga0116125_1173766 | Not Available | 604 | Open in IMG/M |
3300009638|Ga0116113_1208764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300009665|Ga0116135_1351725 | Not Available | 590 | Open in IMG/M |
3300009759|Ga0116101_1137025 | Not Available | 592 | Open in IMG/M |
3300009792|Ga0126374_10031589 | Not Available | 2488 | Open in IMG/M |
3300009792|Ga0126374_10232430 | Not Available | 1191 | Open in IMG/M |
3300009826|Ga0123355_10024740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9655 | Open in IMG/M |
3300010047|Ga0126382_11242916 | Not Available | 670 | Open in IMG/M |
3300010358|Ga0126370_10055939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2534 | Open in IMG/M |
3300010361|Ga0126378_11084053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
3300010376|Ga0126381_100589284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1580 | Open in IMG/M |
3300010376|Ga0126381_102829526 | Not Available | 692 | Open in IMG/M |
3300010379|Ga0136449_102984587 | Not Available | 661 | Open in IMG/M |
3300011120|Ga0150983_16168699 | Not Available | 1666 | Open in IMG/M |
3300011271|Ga0137393_11677008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300012211|Ga0137377_11371406 | Not Available | 636 | Open in IMG/M |
3300012212|Ga0150985_120183778 | Not Available | 761 | Open in IMG/M |
3300012925|Ga0137419_10754529 | Not Available | 793 | Open in IMG/M |
3300012927|Ga0137416_12227540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300012944|Ga0137410_12129492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300012971|Ga0126369_12525788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300012987|Ga0164307_10878848 | Not Available | 719 | Open in IMG/M |
3300014168|Ga0181534_10347163 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 810 | Open in IMG/M |
3300014169|Ga0181531_10432270 | Not Available | 810 | Open in IMG/M |
3300014968|Ga0157379_10198089 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
3300016387|Ga0182040_11183769 | Not Available | 642 | Open in IMG/M |
3300016404|Ga0182037_10704402 | Not Available | 865 | Open in IMG/M |
3300017927|Ga0187824_10374498 | Not Available | 516 | Open in IMG/M |
3300017928|Ga0187806_1361461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300017934|Ga0187803_10011582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3524 | Open in IMG/M |
3300017938|Ga0187854_10192350 | Not Available | 906 | Open in IMG/M |
3300017943|Ga0187819_10607711 | Not Available | 619 | Open in IMG/M |
3300017955|Ga0187817_10835195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300017966|Ga0187776_11412261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300017972|Ga0187781_10022761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4351 | Open in IMG/M |
3300018007|Ga0187805_10009177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4111 | Open in IMG/M |
3300018007|Ga0187805_10101843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1299 | Open in IMG/M |
3300018044|Ga0187890_10462271 | Not Available | 712 | Open in IMG/M |
3300018062|Ga0187784_10355541 | Not Available | 1187 | Open in IMG/M |
3300018085|Ga0187772_10341592 | Not Available | 1033 | Open in IMG/M |
3300018088|Ga0187771_10911993 | Not Available | 745 | Open in IMG/M |
3300018090|Ga0187770_11213102 | Not Available | 610 | Open in IMG/M |
3300020580|Ga0210403_10011407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7207 | Open in IMG/M |
3300020580|Ga0210403_10614447 | Not Available | 877 | Open in IMG/M |
3300020581|Ga0210399_11544971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300021046|Ga0215015_10191725 | Not Available | 1156 | Open in IMG/M |
3300021168|Ga0210406_11091184 | Not Available | 588 | Open in IMG/M |
3300021180|Ga0210396_10082490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2918 | Open in IMG/M |
3300021181|Ga0210388_10961645 | Not Available | 734 | Open in IMG/M |
3300021181|Ga0210388_11030958 | Not Available | 704 | Open in IMG/M |
3300021401|Ga0210393_11021979 | Not Available | 669 | Open in IMG/M |
3300021402|Ga0210385_10001688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 13543 | Open in IMG/M |
3300021402|Ga0210385_11434429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300021403|Ga0210397_10684574 | Not Available | 787 | Open in IMG/M |
3300021404|Ga0210389_10230984 | Not Available | 1446 | Open in IMG/M |
3300021432|Ga0210384_11180722 | Not Available | 669 | Open in IMG/M |
3300021433|Ga0210391_10046715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3449 | Open in IMG/M |
3300021474|Ga0210390_10656633 | Not Available | 876 | Open in IMG/M |
3300021474|Ga0210390_10671122 | Not Available | 865 | Open in IMG/M |
3300021475|Ga0210392_10276681 | Not Available | 1197 | Open in IMG/M |
3300021475|Ga0210392_10402913 | Not Available | 997 | Open in IMG/M |
3300022557|Ga0212123_10078144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2809 | Open in IMG/M |
3300024227|Ga0228598_1009869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1908 | Open in IMG/M |
3300024295|Ga0224556_1108895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300025412|Ga0208194_1001888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4207 | Open in IMG/M |
3300025898|Ga0207692_10561557 | Not Available | 730 | Open in IMG/M |
3300025900|Ga0207710_10615681 | Not Available | 568 | Open in IMG/M |
3300025906|Ga0207699_10135751 | Not Available | 1611 | Open in IMG/M |
3300026499|Ga0257181_1034992 | Not Available | 800 | Open in IMG/M |
3300027071|Ga0209214_1039221 | Not Available | 633 | Open in IMG/M |
3300027575|Ga0209525_1064715 | Not Available | 883 | Open in IMG/M |
3300027583|Ga0209527_1021172 | Not Available | 1437 | Open in IMG/M |
3300027643|Ga0209076_1209036 | Not Available | 533 | Open in IMG/M |
3300027648|Ga0209420_1154759 | Not Available | 627 | Open in IMG/M |
3300027842|Ga0209580_10086879 | Not Available | 1501 | Open in IMG/M |
3300027867|Ga0209167_10053398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1991 | Open in IMG/M |
3300027879|Ga0209169_10085037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1634 | Open in IMG/M |
3300027889|Ga0209380_10873053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300027895|Ga0209624_10001511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 18126 | Open in IMG/M |
3300027898|Ga0209067_10710271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300027905|Ga0209415_10149520 | Not Available | 2352 | Open in IMG/M |
3300027908|Ga0209006_10000362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 45273 | Open in IMG/M |
3300028882|Ga0302154_10178743 | Not Available | 1091 | Open in IMG/M |
3300028906|Ga0308309_11184052 | Not Available | 659 | Open in IMG/M |
3300029907|Ga0311329_10175457 | Not Available | 1668 | Open in IMG/M |
3300029910|Ga0311369_10604605 | Not Available | 914 | Open in IMG/M |
3300029944|Ga0311352_11165239 | Not Available | 587 | Open in IMG/M |
3300029999|Ga0311339_10376959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium | 1489 | Open in IMG/M |
3300029999|Ga0311339_11366340 | Not Available | 638 | Open in IMG/M |
3300030007|Ga0311338_10586075 | Not Available | 1150 | Open in IMG/M |
3300030007|Ga0311338_10786305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium | 950 | Open in IMG/M |
3300030399|Ga0311353_10025543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6377 | Open in IMG/M |
3300030509|Ga0302183_10281162 | Not Available | 644 | Open in IMG/M |
3300030580|Ga0311355_11458657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300030596|Ga0210278_1203252 | Not Available | 516 | Open in IMG/M |
3300030693|Ga0302313_10081611 | Not Available | 1364 | Open in IMG/M |
3300030743|Ga0265461_12973907 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300031231|Ga0170824_105155714 | Not Available | 592 | Open in IMG/M |
3300031524|Ga0302320_11978993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300031682|Ga0318560_10695043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300031708|Ga0310686_100429047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1690 | Open in IMG/M |
3300031715|Ga0307476_10295273 | Not Available | 1188 | Open in IMG/M |
3300031719|Ga0306917_11078914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300031753|Ga0307477_10462483 | Not Available | 865 | Open in IMG/M |
3300031754|Ga0307475_10199358 | Not Available | 1600 | Open in IMG/M |
3300031823|Ga0307478_11709604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300031912|Ga0306921_11854576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
3300031962|Ga0307479_11289686 | Not Available | 692 | Open in IMG/M |
3300032160|Ga0311301_10723108 | Not Available | 1392 | Open in IMG/M |
3300032174|Ga0307470_10496617 | Not Available | 889 | Open in IMG/M |
3300032180|Ga0307471_100943574 | Not Available | 1030 | Open in IMG/M |
3300032805|Ga0335078_10095499 | All Organisms → cellular organisms → Bacteria | 4303 | Open in IMG/M |
3300032805|Ga0335078_11555374 | Not Available | 735 | Open in IMG/M |
3300032828|Ga0335080_10436402 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300032954|Ga0335083_10118698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2561 | Open in IMG/M |
3300033004|Ga0335084_11451873 | Not Available | 679 | Open in IMG/M |
3300033158|Ga0335077_10256902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1933 | Open in IMG/M |
3300034163|Ga0370515_0016254 | Not Available | 3460 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.38% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.99% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.59% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.59% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.90% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.90% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.90% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.90% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.20% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.20% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.20% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.20% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.50% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.10% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.10% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.40% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.40% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.40% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.40% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.40% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.70% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.70% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.70% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.70% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.70% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.70% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.70% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.70% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1032794892 | 3300000364 | Soil | SIKHEGRGAWVLTAYGLSGLALFGVLAYFFSDFISH* |
JGI12712J15308_100005493 | 3300001471 | Forest Soil | MQHEGRGAWVLTAYGISGLALFGVIAYFFSDFISR* |
Ga0070709_101720871 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | STTTTSIRKREGRGAWVLTCYGISGLALFGVLAYFFSDFIAH* |
Ga0070709_102894831 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TTSAIRHKEGRGAWVLTCYSICGLALFGVLAYFISDFLAH* |
Ga0070708_1022594501 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SAVQQSTRKREGRGAWVLTAYGISGLALFGLLAYFFSDFISH* |
Ga0070734_106832202 | 3300005533 | Surface Soil | AAIRHHEGRGAWVLTCYGICGLALFGVLAYFFSDFIAH* |
Ga0070732_102461161 | 3300005542 | Surface Soil | MENQSVSSKSSATQREGRGAWVLTAYGISGLALFGILIYYAS |
Ga0070732_103370192 | 3300005542 | Surface Soil | PSASQSTLIRKREGRGAWVLTAYGISGLALFGILAYFFSDFIAR* |
Ga0066700_111602121 | 3300005559 | Soil | VQQSTTTRKHEGRGAWVLTAYGISGLALFGLLAYFFSDFISH* |
Ga0070761_100079722 | 3300005591 | Soil | MRHHEGRGAWVLTAYGICGLALFGVLAYFFSDFIAH* |
Ga0070762_106380442 | 3300005602 | Soil | SATRHLAGRGAWVLTAYGISGLALFGLLAYFFSDFIAH* |
Ga0070763_108034801 | 3300005610 | Soil | AIRQREGRGAWVLTAYGVSGLALFGVLAYFFSDFISH* |
Ga0070764_100329304 | 3300005712 | Soil | STTTSAIRQHEGRGAWVLTCYGICGLGLFGVLAYFVSDFIAH* |
Ga0066903_1044709812 | 3300005764 | Tropical Forest Soil | SVKAHPREGRNFWVLTVYGISGLVLFGILAYYFSDFVAR* |
Ga0066903_1073311662 | 3300005764 | Tropical Forest Soil | TTTTSIRKREGRGAWVLTAYSISGLALFGVLAYFISDFISH* |
Ga0075288_10468321 | 3300005874 | Rice Paddy Soil | TISKHQHEGRGAWVLTAYGVSALALFGVLAYFFSDFIAH* |
Ga0066790_100789442 | 3300005995 | Soil | RHHEGRGAWVLTAYGISGLALFGVLAYFFSDFISH* |
Ga0070717_119969112 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VKHHEGRGAWVLTAYGVVGLALFGVLAYFFSDFISH* |
Ga0075030_1005854571 | 3300006162 | Watersheds | TRQHEGRGAWVLTCYGICGLALFGVLAYFFSDFIAH* |
Ga0075436_1003505811 | 3300006914 | Populus Rhizosphere | PHEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH* |
Ga0075435_1003423282 | 3300007076 | Populus Rhizosphere | SHPHEGRNFWVLTAYGISGLALFGVLAYYFSDFVAH* |
Ga0066793_106825402 | 3300009029 | Prmafrost Soil | RHHEGRGAWVLTCYGICGLALFGVLAYFFSDFISH* |
Ga0116220_101868011 | 3300009525 | Peatlands Soil | RQKEGRGAWVLTAYGIAGLAMFGVLAYFISEFISH* |
Ga0116133_10011876 | 3300009623 | Peatland | MSGRHHEGRGAWVLTAYGISGLALFGILAYFFSDFIAH* |
Ga0116125_11737661 | 3300009628 | Peatland | SGTHREGRGAWVLTAYGISGLALFGVLAYFFSDFIAH* |
Ga0116113_12087642 | 3300009638 | Peatland | VSPSYSQPSASGKQREGRGAWVLTAYGISGLALFAVLAYFFSDFIAH* |
Ga0116135_13517251 | 3300009665 | Peatland | QQSPQTSSSQAMSGRHHEGRGAWVLTAYGISGLALFGILAYFFSDFIAH* |
Ga0116101_11370252 | 3300009759 | Peatland | SALTRQREGRGAWVLTAYGISGLAVFAVLAYFFSDFIAR* |
Ga0126374_100315891 | 3300009792 | Tropical Forest Soil | VHPHEGRNFWVLTAYGISGLALFGVLAYYFSDFVSH* |
Ga0126374_102324302 | 3300009792 | Tropical Forest Soil | GVKSHAHEGRNFWVLTAYGISGLALFGVLAYYFSDFVSH* |
Ga0123355_100247401 | 3300009826 | Termite Gut | MKKYEGRGAWVLTCYSICGLALFGVLAYFFSDFIAH* |
Ga0126382_112429161 | 3300010047 | Tropical Forest Soil | KHEGRGAWVLTAYGISGLALFGVLAYFFSDFISH* |
Ga0126370_100559391 | 3300010358 | Tropical Forest Soil | MTRKKEGRGAWVLTAYGISGLALFGVLAYFFSDFISH* |
Ga0126378_110840531 | 3300010361 | Tropical Forest Soil | AQSTAHHHHEGRSVWVLTAYGISGLVLFGVLAYYFSQYIAN* |
Ga0126381_1005892842 | 3300010376 | Tropical Forest Soil | MTRKKEGRGAWVLTAYGISGLALFGVLAYFLADFISH* |
Ga0126381_1028295261 | 3300010376 | Tropical Forest Soil | KKHEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH* |
Ga0136449_1029845871 | 3300010379 | Peatlands Soil | EQSSATTKHHEGRGAWVLTCYGICGLALFGVLAYFFSEFISH* |
Ga0150983_161686991 | 3300011120 | Forest Soil | QPHVHHEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH* |
Ga0137393_116770081 | 3300011271 | Vadose Zone Soil | LSQPSSTSVKHHEGRGAWVLTAYGVVGLALFGVLAYFFSDFISH* |
Ga0137377_113714061 | 3300012211 | Vadose Zone Soil | RKHEGRGAWVLTCYGISGLALFGVLAYFFSDFISH* |
Ga0150985_1201837781 | 3300012212 | Avena Fatua Rhizosphere | PHETHHEGRGTWVLTAYGISGLALFGVLLYFFATYVTH* |
Ga0137419_107545291 | 3300012925 | Vadose Zone Soil | KHHEGRGAWVLTAYGISGLALFGILAYFISDFIAH* |
Ga0137416_122275403 | 3300012927 | Vadose Zone Soil | VSSSSVSQPSSPSLKHHEGRGAWVLTAYGIVGLALFGVLAYFFSDFISH* |
Ga0137410_121294921 | 3300012944 | Vadose Zone Soil | MLRRKEGRGAWVLTAYGISGLALFGVLAYFFSDFISH* |
Ga0126369_125257881 | 3300012971 | Tropical Forest Soil | TTSIKREGRGAWVLTAYGLSGLALFGVLAYFFSDFIAH* |
Ga0164307_108788481 | 3300012987 | Soil | GQSSTANMKHQHEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH* |
Ga0181534_103471632 | 3300014168 | Bog | VRKHEGRGAWVLTAYGISGLALFGVIAYFFSDFISR* |
Ga0181531_104322701 | 3300014169 | Bog | SSTTTSAIRKHEGRGAWVLTAYGISGLALFGVLAYFFSDFISH* |
Ga0157379_101980891 | 3300014968 | Switchgrass Rhizosphere | THHEGRGTWVLTAYGISGLALFGILLYFFSTYVTH* |
Ga0182040_111837692 | 3300016387 | Soil | STSTTTMKHHEGRGAWVLTCYSICGLALFGVLAYFFSDFISH |
Ga0182037_107044021 | 3300016404 | Soil | TTTMKHHEGRGAWVLTCYSICGLALFGVLAYFFSDFISH |
Ga0187824_103744981 | 3300017927 | Freshwater Sediment | SSTYTKHYEKRGTWVLTAYGISGLALFGVLTYFFSDFIAH |
Ga0187806_13614611 | 3300017928 | Freshwater Sediment | AEQSATVATKQYEGRGAWVLTAYGICGLTLFGVLAYFFSDFIAH |
Ga0187803_100115821 | 3300017934 | Freshwater Sediment | PTVQSSASTKQHEGRGAWVLTAYGICGLALFGVLAYFFSNFISH |
Ga0187854_101923502 | 3300017938 | Peatland | SSSQAAGSRHHEGRGAWVLTAYGISGLALFGLLAYFFSDFIAH |
Ga0187819_106077111 | 3300017943 | Freshwater Sediment | SAIRRREGRGAWVLTAYGISGLALLGVLAYFFSDFIAR |
Ga0187817_108351951 | 3300017955 | Freshwater Sediment | SATTRQHEGRGAWVLTCYGICGLALFGVFAYFFAEYFAH |
Ga0187776_114122611 | 3300017966 | Tropical Peatland | SSTSTTTTSALKRHEGRGAWVLTCYAVCGLAMFGAIAYFISDFLSH |
Ga0187781_100227613 | 3300017972 | Tropical Peatland | MTSSALRRKEGRGAWVLTAYGISGLALFGVLAYFFSDYIAH |
Ga0187805_100091774 | 3300018007 | Freshwater Sediment | MRRHEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
Ga0187805_101018432 | 3300018007 | Freshwater Sediment | MSAIRRREGRGAWVLTAYGISGLALFGVLAYFFSDFIAR |
Ga0187890_104622712 | 3300018044 | Peatland | VSQPTTTGKHHEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
Ga0187784_103555412 | 3300018062 | Tropical Peatland | RRKEGRGAWVLTAYGISGLALFGLLAYFFSEYIAH |
Ga0187772_103415921 | 3300018085 | Tropical Peatland | TASIKRHEGRGAWVLTAYGITGLALFGVLAYFFSDFISH |
Ga0187771_104624212 | 3300018088 | Tropical Peatland | MPREGRGVWVLTAYGISGLVLFGILLYYFSTYVTH |
Ga0187771_109119931 | 3300018088 | Tropical Peatland | MLQQPLSRESAASKHREGRGAWVLTAYGICGLALFGLFAYFFSNYIAH |
Ga0187770_112131021 | 3300018090 | Tropical Peatland | TTTSAIRRKEGRGAWVLTAYGICGLALFGVLAYFFSDFISH |
Ga0210403_100114075 | 3300020580 | Soil | MRRREGRGAWVLTCYGISGLILFATLAYFFSNFIAH |
Ga0210403_106144471 | 3300020580 | Soil | QSLSSSSTAMRRREGRGAWVLTAYGISGLALFGLLAYFFSDFIAH |
Ga0210399_115449711 | 3300020581 | Soil | LSQPAGRRFAGRGAWVLTAYGISGLALFGLLAYFFSDFIAH |
Ga0215015_101917252 | 3300021046 | Soil | SQPSSTSVKHHEGRGAWVLTAYGIVGLALFGVLAYFFSDFISH |
Ga0210406_110911842 | 3300021168 | Soil | IDQSSSTTTTSAVRKHEGRGAWVLTCYGICGLALFGVLAYFFSDFISH |
Ga0210396_100824901 | 3300021180 | Soil | SAIRQREGRGAWVLTAYGVSGLALFGVLAYFFSDFISH |
Ga0210388_109616452 | 3300021181 | Soil | TAAAGKHREGRGAWVLTAYGVSGLALFGVLAYFFSDFIAH |
Ga0210388_110309581 | 3300021181 | Soil | STTTSAIKHEGRGAWVLTAYGLSGLALFGVLAYFFSDFISH |
Ga0210393_110219791 | 3300021401 | Soil | GTHREGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
Ga0210385_100016887 | 3300021402 | Soil | MGSKHREGRGAWVLTAYGISGLILFGILAYFFSDFVAH |
Ga0210385_114344291 | 3300021402 | Soil | QQSVSQQSVSSRQREGRGAWVLTAYGVSGLAVIALLAYFFSDFIVH |
Ga0210397_106845743 | 3300021403 | Soil | TKHHEGRGAWVLTAYGISGLALFGVLAYFISDFVAH |
Ga0210389_102309842 | 3300021404 | Soil | EQSSTTTSAIRKHEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
Ga0210384_111807221 | 3300021432 | Soil | QSPQQATGKHREGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
Ga0210391_100467151 | 3300021433 | Soil | MRHHEGRGAWVLTAYGICGLALFGVLAYFFSDFIAH |
Ga0210390_106566331 | 3300021474 | Soil | STASRHREGRGAWVLTAYGISGLALFGILAYFFSDFIAH |
Ga0210390_106711221 | 3300021474 | Soil | SQPHVHHEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
Ga0210392_102766811 | 3300021475 | Soil | SSTTTSAIRKHEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
Ga0210392_104029132 | 3300021475 | Soil | PGRHFEGRGAWVLTCYGISGLILFAILAYFFSDFIAH |
Ga0212123_100781443 | 3300022557 | Iron-Sulfur Acid Spring | MRKHEGRGAWVLTAYGISGLALFGVIAYFVSDFISH |
Ga0228598_10098693 | 3300024227 | Rhizosphere | QSLSQASTTRQFEGRGAWVLTAYGISGLALFAILAYFFSDFIAH |
Ga0224556_11088951 | 3300024295 | Soil | SVRKHEGRGAWVLTAYGISGLALFGVIAYFFSDFISR |
Ga0208194_10018885 | 3300025412 | Peatland | MSGRHHEGRGAWVLTAYGISGLALFGILAYFFSDFIAH |
Ga0207692_105615572 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | QSSATTTSIKKHEGRGAWVLTAYGISGLALFGVIAYFFSDFIAH |
Ga0207710_106156811 | 3300025900 | Switchgrass Rhizosphere | TPQAHPHETHHEGRGAWVLTAYGISGLALFGVLLYFFSTYVTN |
Ga0207699_101357513 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | STTTTSIRKREGRGAWVLTCYGISGLALFGVLAYFFSDFIAH |
Ga0257181_10349921 | 3300026499 | Soil | SSPSVKHHEGRGAWVLTAYGIVGLALFGVLAYFFSDFISH |
Ga0209214_10392212 | 3300027071 | Forest Soil | VSQQTAAKHYEGRGTWVLTGYCISGLALFGILAYFISQFLSH |
Ga0209525_10647152 | 3300027575 | Forest Soil | SVQPSTAGRHREGRGAWVLTAYGISGLALFGILAYFFSDFIAH |
Ga0209527_10211721 | 3300027583 | Forest Soil | EQSSTSTSITRQHEGRGAWVLTAYGISGLALFGVLAYFFSDFISH |
Ga0209076_12090361 | 3300027643 | Vadose Zone Soil | SAKSHPHEGRNFWVLTAYGISGLALFGVLAYYFSDFVSR |
Ga0209420_11547592 | 3300027648 | Forest Soil | SISQQSISQSALTRQREGRGAWVLTAYGISGLAVFAVLAYFFSDFIAR |
Ga0209580_100868791 | 3300027842 | Surface Soil | HPHEGRNFWVLTAYGISGLALFGILAYYFSDFVSH |
Ga0209167_100533983 | 3300027867 | Surface Soil | SMSSSGLRRHEGRGAWVFTAYGICGLALFGVLAYFFSDFIAR |
Ga0209169_100850373 | 3300027879 | Soil | STTTSAIRQHEGRGAWVLTCYGICGLGLFGVLAYFVSDFIAH |
Ga0209380_108730532 | 3300027889 | Soil | SQQSLSSRQREGRGAWVLTAYGVSGLAVVALLAYFFSDFIAH |
Ga0209624_100015118 | 3300027895 | Forest Soil | MKHREGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
Ga0209067_107102711 | 3300027898 | Watersheds | STTTSAIKHEGRGAWVLTAYGLSGLALFGVLAYFFSDFIAH |
Ga0209415_101495201 | 3300027905 | Peatlands Soil | EQSSATTKHHEGRGAWVLTCYGICGLALFGVLAYFFSEFISH |
Ga0209006_1000036233 | 3300027908 | Forest Soil | MQHEGRGAWVLTAYGISGLALFGVIAYFFSDFISR |
Ga0302154_101787431 | 3300028882 | Bog | SQQSISQSALTRQREGRGAWVLTAYGISGLALFAVLAYFFSDFIAR |
Ga0308309_111840522 | 3300028906 | Soil | EQSSTTTTSQHEGRGAWVLTCYGICGLAMFGVLAYFFSDFIAH |
Ga0311329_101754571 | 3300029907 | Bog | RQREGRGAWVLTAYGISGLALFAVLAYFFSDFIAR |
Ga0311369_106046051 | 3300029910 | Palsa | QQSVSGRQREGRGAWVLTAYGISGLALFALLAYFFSDFIAH |
Ga0311352_111652392 | 3300029944 | Palsa | SVSQQSITQQSVSGRQREGRGAWVLTAYGISGLALFALLAYFFSDFIAH |
Ga0311339_103769591 | 3300029999 | Palsa | AHHEGRGAWVLTAYGISGLALFGVIAYFFSDFISR |
Ga0311339_113663402 | 3300029999 | Palsa | ESFPTPSTTVKHHEGRGAWVLTAYGISGLALFGILAYYFSDFIAH |
Ga0311338_105860752 | 3300030007 | Palsa | SQRPISQQSVSSRQREGRGAWVLTAYGVSGLAVIALLAYFFSDFIAH |
Ga0311338_107863052 | 3300030007 | Palsa | TTAHHEGRGAWVLTAYGISGLALFGVIAYFFSDFISR |
Ga0311353_100255437 | 3300030399 | Palsa | QSLSQSSASKRFAGRGAWVLTAYGICGLALFGVLAYFFSDFIAH |
Ga0302183_102811621 | 3300030509 | Palsa | QQSVSSRQREGRGAWVLTAYGISGLALFALLAYFFSDFIAH |
Ga0311355_114586571 | 3300030580 | Palsa | SRQREGRGAWVLTAYGVSGLAVIALLAYFFSDFIAH |
Ga0210278_12032521 | 3300030596 | Soil | TRHFEGRGAWVLTAYGVSGLALFGVLAYFFSDFISH |
Ga0302313_100816112 | 3300030693 | Palsa | TPSTSGRQREGRGAWVLTAYGISGLALFGILAYYFSDFIAH |
Ga0265461_129739071 | 3300030743 | Soil | RRFAGRGAWVLTAYGISGLALFGLLAYFFSDFIAH |
Ga0170824_1051557141 | 3300031231 | Forest Soil | AIRQHEGRGAWVLTCYGICGLALFGVLAYFFSDFISH |
Ga0302320_119789931 | 3300031524 | Bog | SSATRHIAGRGAWVLTAYSISGLALFGLLAYFFSDFIAH |
Ga0318560_106950431 | 3300031682 | Soil | TSTTTMKHHEGRGAWVLTCYSICGLALFGVLAYFFSDFISH |
Ga0310686_1004290472 | 3300031708 | Soil | MGGKHREGRGAWVLTAYGISGLILFGILAYFFSDFVAH |
Ga0307476_102952731 | 3300031715 | Hardwood Forest Soil | MRRYEGRGAWVLTAYGISGLALFGVLAYFFSDFVAH |
Ga0306917_110789141 | 3300031719 | Soil | HPREGRNFWVLTAYGISGLVLFGILAYYFSDFISH |
Ga0307477_104624831 | 3300031753 | Hardwood Forest Soil | SVKHHEGRGAWVLTAYGIVGLALFGVLAYFFSDFISH |
Ga0307475_101993581 | 3300031754 | Hardwood Forest Soil | TALHRKHEGRGAWVLTAYGISGLVLFGVLAYFFSDFIAH |
Ga0307478_117096041 | 3300031823 | Hardwood Forest Soil | QSSTSTSATRHHEGRGAWVLTAYGICGLALFGVLAYFFSDFIAH |
Ga0306921_118545761 | 3300031912 | Soil | SHPHEGRSFWVLTAYGISGLVLFGILAYYFSDFISH |
Ga0307479_112896861 | 3300031962 | Hardwood Forest Soil | SSQSSGGRRFAGRGAWVLTAYGISGLAVFGLLAYFFSDFIAH |
Ga0311301_107231081 | 3300032160 | Peatlands Soil | SSTTTTSAIRKHEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
Ga0307470_104966172 | 3300032174 | Hardwood Forest Soil | MRRYEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
Ga0307471_1009435742 | 3300032180 | Hardwood Forest Soil | QSTGTKSHPHEGRNFWVLTAYGISGLALFGILAYYFSDFVSH |
Ga0335078_100954996 | 3300032805 | Soil | RRHEGRGAWVLTCYGICGLAMFGAIAYFISDSLSH |
Ga0335078_115553741 | 3300032805 | Soil | TREIHREGRATWVLTAYGISGLALFGVLLYYFSTYVTH |
Ga0335080_104364023 | 3300032828 | Soil | TTSAIRKHEGRGAWVLTAYGISGLALFGLLAYFFSDFIAH |
Ga0335083_101186982 | 3300032954 | Soil | MIRHKEGRGAWVLTCYGICGLALFGVLAYFFSDFIAH |
Ga0335084_114518731 | 3300033004 | Soil | SSTTTTSIKQREGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
Ga0335077_102569022 | 3300033158 | Soil | MHHEGRGTWVLTAYGIAGLALFGVLLYFFSTYVTH |
Ga0370515_0016254_1130_1243 | 3300034163 | Untreated Peat Soil | MIRKHEGRGAWVLTAYGISGLALFGVLAYFFSDFIAH |
⦗Top⦘ |