Basic Information | |
---|---|
Family ID | F052233 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 143 |
Average Sequence Length | 43 residues |
Representative Sequence | GAVRDPGGADPRSRFVNPADAPLVQIPGTGVIWKISRDD |
Number of Associated Samples | 123 |
Number of Associated Scaffolds | 143 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 1.40 % |
% of genes from short scaffolds (< 2000 bps) | 1.40 % |
Associated GOLD sequencing projects | 116 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (98.601 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.776 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.364 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.559 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.96% β-sheet: 8.96% Coil/Unstructured: 82.09% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 143 Family Scaffolds |
---|---|---|
PF02646 | RmuC | 9.79 |
PF01292 | Ni_hydr_CYTB | 6.99 |
PF00248 | Aldo_ket_red | 4.90 |
PF13646 | HEAT_2 | 2.10 |
PF00501 | AMP-binding | 1.40 |
PF00027 | cNMP_binding | 1.40 |
PF06500 | FrsA-like | 1.40 |
PF01250 | Ribosomal_S6 | 1.40 |
PF02738 | MoCoBD_1 | 1.40 |
PF00126 | HTH_1 | 1.40 |
PF00033 | Cytochrome_B | 0.70 |
PF00582 | Usp | 0.70 |
PF04392 | ABC_sub_bind | 0.70 |
PF00078 | RVT_1 | 0.70 |
PF13276 | HTH_21 | 0.70 |
PF12695 | Abhydrolase_5 | 0.70 |
PF00282 | Pyridoxal_deC | 0.70 |
PF07228 | SpoIIE | 0.70 |
PF04879 | Molybdop_Fe4S4 | 0.70 |
PF05721 | PhyH | 0.70 |
PF12705 | PDDEXK_1 | 0.70 |
PF01636 | APH | 0.70 |
PF01546 | Peptidase_M20 | 0.70 |
PF00586 | AIRS | 0.70 |
PF00152 | tRNA-synt_2 | 0.70 |
PF07992 | Pyr_redox_2 | 0.70 |
PF11141 | DUF2914 | 0.70 |
PF00557 | Peptidase_M24 | 0.70 |
PF01264 | Chorismate_synt | 0.70 |
PF04986 | Y2_Tnp | 0.70 |
PF02371 | Transposase_20 | 0.70 |
PF01435 | Peptidase_M48 | 0.70 |
PF00211 | Guanylate_cyc | 0.70 |
PF13581 | HATPase_c_2 | 0.70 |
PF00725 | 3HCDH | 0.70 |
PF00652 | Ricin_B_lectin | 0.70 |
PF00528 | BPD_transp_1 | 0.70 |
PF13361 | UvrD_C | 0.70 |
PF12773 | DZR | 0.70 |
PF04909 | Amidohydro_2 | 0.70 |
PF13229 | Beta_helix | 0.70 |
PF01799 | Fer2_2 | 0.70 |
PF02518 | HATPase_c | 0.70 |
PF02687 | FtsX | 0.70 |
PF07883 | Cupin_2 | 0.70 |
PF00291 | PALP | 0.70 |
PF07963 | N_methyl | 0.70 |
PF13193 | AMP-binding_C | 0.70 |
PF02769 | AIRS_C | 0.70 |
PF00326 | Peptidase_S9 | 0.70 |
PF05494 | MlaC | 0.70 |
PF03466 | LysR_substrate | 0.70 |
PF07519 | Tannase | 0.70 |
PF12244 | DUF3606 | 0.70 |
COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
---|---|---|---|
COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 9.79 |
COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 6.99 |
COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 6.99 |
COG3038 | Cytochrome b561 | Energy production and conversion [C] | 6.99 |
COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 6.99 |
COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 6.99 |
COG0360 | Ribosomal protein S6 | Translation, ribosomal structure and biogenesis [J] | 1.40 |
COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.70 |
COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.70 |
COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.70 |
COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.70 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.70 |
COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.70 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.70 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 98.60 % |
All Organisms | root | All Organisms | 1.40 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004463|Ga0063356_104056172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 630 | Open in IMG/M |
3300005454|Ga0066687_10810396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 557 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.79% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.09% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.29% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.40% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.40% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.40% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.40% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.70% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.70% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.70% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.70% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.70% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.70% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.70% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.70% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.70% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.70% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.70% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.70% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1005898501 | 3300000364 | Soil | RDFGRSVPATVFADPADAPLVQIPGTGTIWKISRIDNGRHDDDDDD* |
F12B_102521081 | 3300000443 | Soil | AYLVDYGAVRDFGRSDPRTLFANGADAPLPQIPGTGTIWRISRVDYDDNDDD* |
JGI10214J12806_121375871 | 3300000891 | Soil | AVRDFGRSDPRSMFTNSADAPLVQIPGTGVIWKISKR* |
JGI25384J37096_101839092 | 3300002561 | Grasslands Soil | VRDPGGADSRSRFVNPANAPLVQIPGTGTIWRISRSNESRDDDDD* |
JGI25390J43892_100863192 | 3300002911 | Grasslands Soil | VRDPGGSDPDSKFVSPADAPLVQIPGTGVIWKISRSDDRRGGDDD* |
soilH1_102092423 | 3300003321 | Sugarcane Root And Bulk Soil | LVDYGAVRDPGGADPLSMFTNPADAPLVQIPHTGTIWRISRVRDR* |
Ga0062590_1022468161 | 3300004157 | Soil | FSDPDSKFRNPADVPLVQIPGTGTIWKITRADGGGRGGHDDD* |
Ga0063356_1040561721 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LVDYGAVRDPGGSDPDSRFVNPANAPLVQIPGTGTIWKISRICGSGHGHGD* |
Ga0062595_1001075544 | 3300004479 | Soil | LVDYGAVRDFGQADPESQFLDPADAPLVQIPGTGVIWKVSRK* |
Ga0066680_103166102 | 3300005174 | Soil | LYLVDYGAVRDFGQGDPDSRFTNPADAPLVVIPHTGVIWRISTTRGIDD* |
Ga0066679_101521212 | 3300005176 | Soil | RDPGGSDPDSKFVSPADAPLVQIPGTGVIWKISRSDDRRGNNDHDD* |
Ga0066679_104648611 | 3300005176 | Soil | RDPGGSDPDSKFVSPADAPLVQIPGTGVIWKISRSDDRRGGDDD* |
Ga0066688_105975432 | 3300005178 | Soil | VDYGAVRDFGQSDPASRFKVAADAPLVQIPGTGVIWKICRE* |
Ga0066687_108103962 | 3300005454 | Soil | LYLVDYGAVRDFGQSDPKTKFNVAADAPLVQIPHTGVIWRISRVGQEAED* |
Ga0070699_1018041091 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DFGRSVPASRFAVDADAPLVQIPGTGTIWKISRDDRRGDNDDDD* |
Ga0070686_1018573172 | 3300005544 | Switchgrass Rhizosphere | YLVDFGAVRDFGRSDPRSMFTNSADAPLVQIPGTGVIWKISKR* |
Ga0058697_105551951 | 3300005562 | Agave | LYLVDYGAVRDFGQADPESQFLDPADAPLVQIPGTGVIWKISRAQ* |
Ga0066654_103306651 | 3300005587 | Soil | YLVDYGAVRDPGGSDPESAFHNPANAPLVQIPGTGVIWRISRIGGGHDRNDGGHDRDDD* |
Ga0066903_1037580651 | 3300005764 | Tropical Forest Soil | GGADPGSQFADPADAPLVQIPGTGVIWKISRTGKSGDGDHDD* |
Ga0074479_100628201 | 3300005829 | Sediment (Intertidal) | RSRFVNPNDAPLVQIPGTGTIWKISRIGDRRGDDDD* |
Ga0075028_1008430321 | 3300006050 | Watersheds | YGAVRDPGGSDPRSRFANPADAALVQIPGTGVIWKISRIGPQ* |
Ga0070715_101397921 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RDVGQSDPDTGFKNPADAALVQIPGTGAIWKICGQ* |
Ga0075428_1008024061 | 3300006844 | Populus Rhizosphere | VDFGAVRDFGRSTPASMFKNALDAPLVQIPGTGVIWKISRIGGSSHKHDDDHDHGHGHDKD* |
Ga0075421_1009362771 | 3300006845 | Populus Rhizosphere | GAFYLVDFGITRDGGESTPASAVVNSANTPIVQIPGTGVIWKISKR* |
Ga0075421_1015941331 | 3300006845 | Populus Rhizosphere | RSDPKTRFADPADAPLVQIPGTGTIWKISRVSNHRHDDDDDERD* |
Ga0075420_1002858321 | 3300006853 | Populus Rhizosphere | GAAYLVDYGAVRDPGGSDPRSAFQNPADAPLVQIPGTGTIWKISRIDDDHGKHGHGRHDDDD* |
Ga0075436_1006386111 | 3300006914 | Populus Rhizosphere | YGAVRDPGGSDRDSMFRNPDNAPLVQIPGTGTIWRISRDD* |
Ga0075419_104782562 | 3300006969 | Populus Rhizosphere | AVRDFGQSNPLTKFTVADDAPLVQIPGTGVIWRISRIGSDNNNDDD* |
Ga0099794_107523962 | 3300007265 | Vadose Zone Soil | AVRDPGGSDRDSGFRNPLDAPLVQIPGTGTIWKISRIRDGRDDGDDD* |
Ga0099830_114054863 | 3300009088 | Vadose Zone Soil | VRDFGRSDPASKFIGAGDGPLVQIPGTGVIWKICKQ* |
Ga0099828_100235105 | 3300009089 | Vadose Zone Soil | RDFGQSDPASRFKVAADAPLVQIPGTGVIWKICRE* |
Ga0099827_1000232115 | 3300009090 | Vadose Zone Soil | DFGQSDPASRFKVAADAPLVQIPGTGVIWKICRE* |
Ga0099827_102505871 | 3300009090 | Vadose Zone Soil | LYLVDYGVVRDPGGSDPESKFVNPADAPLVQIPGTGVIWRISRAGNDD* |
Ga0099827_110051852 | 3300009090 | Vadose Zone Soil | PDDALYLVDYGAVRDFGRSDPAQRFRNPGDAPLAQIPGTGTIWKISRTGR* |
Ga0099827_112056841 | 3300009090 | Vadose Zone Soil | VRDFGQAGPAAKFITPGDGPLVQIPGTGVIWKICATK* |
Ga0099827_112898611 | 3300009090 | Vadose Zone Soil | YGAVRDPGGSDPDSRFVNPADAPLVQIPGTGVIWRISRDDGRDDD* |
Ga0099827_114741522 | 3300009090 | Vadose Zone Soil | VDYGAVRDPGGSDPESKFVNPADAPLVQIPGTGVIWRISRDGGPQ* |
Ga0111539_106515733 | 3300009094 | Populus Rhizosphere | AVRDFGRATPDSAFHNPLDAPLVQIPGTGVIWKIERE* |
Ga0066709_1001960971 | 3300009137 | Grasslands Soil | LVDYGAVRDFGKGDSETKFKVAADAPLVQIPGTGVIWKFCKKE* |
Ga0105243_126953822 | 3300009148 | Miscanthus Rhizosphere | LVDFGAVRDFGRSDPRSMFTNSADAPLVQIPGTGVIWKISKR* |
Ga0111538_104688743 | 3300009156 | Populus Rhizosphere | VDYGAVRDGGQSDPESQFLDPADAPLVQIPGTGVIWKISRAQ* |
Ga0111538_112880722 | 3300009156 | Populus Rhizosphere | AVRDFGQSNPASKFKVNGDGPLLQIPGTGVIWRICPQ* |
Ga0111538_135412732 | 3300009156 | Populus Rhizosphere | YLVDYGAVRDPGNSDEGSRFQNPADAPLVQIPGTGTIWKISRVDNGRGRHDDDDDD* |
Ga0105249_1000775011 | 3300009553 | Switchgrass Rhizosphere | GAVRDPGGSDPASSVVSPANLPLVQIPGTGVIWRISRDN* |
Ga0126313_101136061 | 3300009840 | Serpentine Soil | VVDYGAVRDFGLGNPDAKFEVEEDQPLVQIPGTGVIWRISRAGA* |
Ga0126384_113305211 | 3300010046 | Tropical Forest Soil | DFGRSDPDAGFKNGADAALVQIPGTGVIWKICAE* |
Ga0126382_117524013 | 3300010047 | Tropical Forest Soil | VRDFGKGDSETKFIDPADAPLVQIPGTGVIWKICKR* |
Ga0126382_122891152 | 3300010047 | Tropical Forest Soil | DGGNSESESKVQNPDNAPLVQIPGTGVIWKISRAE* |
Ga0134063_102347553 | 3300010335 | Grasslands Soil | AVRDFGQSDPDSKFQVAGDGPLVQFPGTGVVWKICRTAGH* |
Ga0126378_119068912 | 3300010361 | Tropical Forest Soil | YVADYGAIRDFGRSDPDTGFKNPADAALVQIPGTGVIWKICRQ* |
Ga0126377_118111512 | 3300010362 | Tropical Forest Soil | DYGAVRDFGQSDPATRFVDEPGFPSNGPLVQIPGTGTIWKICRQ* |
Ga0126379_110079923 | 3300010366 | Tropical Forest Soil | VDYGAVRDFGQSDPRAQFQNPADAPLVQIPGTGVIWKITRTK* |
Ga0134125_127299412 | 3300010371 | Terrestrial Soil | GFSDPDSKFRNPADVPLVQIPGTGTIWKITRADGGGRGGHDDD* |
Ga0126381_1021911522 | 3300010376 | Tropical Forest Soil | AVRDFGRSDPDAGFKNGADAALVQIPGTGVIWKICAE* |
Ga0126381_1035711661 | 3300010376 | Tropical Forest Soil | GAVRDFGRSDPDAGFKNGADAALVQIPGTGVIWKICAE* |
Ga0126383_109365252 | 3300010398 | Tropical Forest Soil | YGAVRDFGRSDPDAGFKNGADAALVQIPGTGVIWKICAE* |
Ga0134127_102800043 | 3300010399 | Terrestrial Soil | RDFGQADPESQFLDPADAPLVQIPGTGVIWKVSRK* |
Ga0134122_109690451 | 3300010400 | Terrestrial Soil | GAVRDFGRSVPASMFDSFADAPLVQIPGTGTIWKISRIADDRRARDGDDDDD* |
Ga0137391_105775481 | 3300011270 | Vadose Zone Soil | DNGQSDPATKFQVAGDGPLVQFPGTGVIWKICPSQ* |
Ga0137391_111792662 | 3300011270 | Vadose Zone Soil | YGAVRDFGQSDPAAKFQVPGEGPLVQFPRTGVIWKICPM* |
Ga0137340_10181053 | 3300011405 | Soil | YLVDYGAVRDFGRSVPASRFALDADAPLVQIPGTGTIWKISRIDDRRGHDDDDD* |
Ga0137462_10802702 | 3300011421 | Soil | YLVDYGAVRDFGRSVPASRFALDADAPLVQIPGTGTIWKISRINDRRGHNDDED* |
Ga0137443_10065231 | 3300011433 | Soil | YLVDYGAVRDPGGAEPASQFVNPANAPLVQIPGTGVIWRISRDD* |
Ga0137452_10080811 | 3300011441 | Soil | RDFGRSVPASRFALDADAPLVQIPGTGTIWKISRIDDRRGHNDDDD* |
Ga0137437_10245193 | 3300011442 | Soil | YGAVRDPGGADPRSQFANPADAPLVQIPGTGVIWKISRDD* |
Ga0120139_10079461 | 3300012019 | Permafrost | DYGAVRDLGNSDPNSAVKNPADGPLVQIPHTGTIWRITKTETDD* |
Ga0137430_11844542 | 3300012041 | Soil | VDYGAVRDPGGAEPASQFVNPANAPLVQIPGTGVIWRISRDD* |
Ga0137389_114964271 | 3300012096 | Vadose Zone Soil | SDSRSGFVGPSNAPLVQIPQTGVIWRISRDDKRGKGDKD* |
Ga0137388_101431265 | 3300012189 | Vadose Zone Soil | AYLVDYGAGRDPGNSDPGSRFRNPANAPLVQIPGTGTIWKITRVGGGRDRDDD* |
Ga0137388_104143983 | 3300012189 | Vadose Zone Soil | YGAVRDFGQSDPASRFTVAADAPLVQIPGTGVIWKICRE* |
Ga0137388_117660921 | 3300012189 | Vadose Zone Soil | NGQSDPATKFQVAGDGPLVQFPGTGVIWKICPSQ* |
Ga0137364_114266291 | 3300012198 | Vadose Zone Soil | DYGAVRDPGGSDRDSRFVNPANAPLVQLPGTGTIWRISRDDD* |
Ga0137382_100717693 | 3300012200 | Vadose Zone Soil | YGAVRDPGGSDPDSRFVNPANAPLVQIPGTGTIWKISRTDDHGNADDND* |
Ga0137381_102126493 | 3300012207 | Vadose Zone Soil | VDYGAVRDFGQSDPASKFTNPLDAPLVQIPGTGVIWKICKAG* |
Ga0137378_111660982 | 3300012210 | Vadose Zone Soil | RDFGQSDPAAKFITPGDGPLVQIPQTGVIWKICTE* |
Ga0137465_10559061 | 3300012231 | Soil | DPGGADPRSQFADPADAPLVQIPGTGVIWKISRDD* |
Ga0137367_1000550814 | 3300012353 | Vadose Zone Soil | AVRDFGQSDPASKFIDPADAPLVQIPGTGVIWKICKQ* |
Ga0137369_111264032 | 3300012355 | Vadose Zone Soil | DFGQSDPASKFIDPADGPLVQIPGTGVIWKICKQ* |
Ga0137371_109569021 | 3300012356 | Vadose Zone Soil | AVRDNGQSDPASKWLDPADKPLVQFPGTGVIWKICPM* |
Ga0137384_104761611 | 3300012357 | Vadose Zone Soil | RDNGQSDPASKWLDPADSPLVQFPGTGVIWKICPM* |
Ga0137360_105888613 | 3300012361 | Vadose Zone Soil | GSDPESRVVVIPDDLPLVQIPGTGVIWKISRDGGRDDD* |
Ga0137390_101607141 | 3300012363 | Vadose Zone Soil | AVRDFGQSDPDSRFLVAGDGPLLQIPGTGVVWKICRVGE* |
Ga0150984_1149253833 | 3300012469 | Avena Fatua Rhizosphere | VDYGAVRDPGGSDPDSGFRNSLNAPLVQIPGTGVIWRISRIGGGHDRDDD* |
Ga0137395_112568211 | 3300012917 | Vadose Zone Soil | VDYGAVRDPGGSDAGSRFHNPANAPLVQIPGTGTIGKISRIRDGRDDGDDD* |
Ga0137396_105594062 | 3300012918 | Vadose Zone Soil | AYLVDYGAVRDPGGADSRSRFVNGADAPLVQIPGTGTIWRISRDDRGGDDD* |
Ga0137394_105382403 | 3300012922 | Vadose Zone Soil | YLVDYGAVRDPGGSDPDSKFRSDANAPLVQIPGTGTIWKISRDDRGDDDD* |
Ga0137407_102289352 | 3300012930 | Vadose Zone Soil | FGQSDPATQFTNPADAPLVQIPHTGVIWRISRDSRP* |
Ga0126369_135969941 | 3300012971 | Tropical Forest Soil | VVRDGGQSDPASGVIVPGDGPLVQIPRTGVIWKICAQ* |
Ga0137411_10386602 | 3300015052 | Vadose Zone Soil | GGADSRSRFVNGADAPLVQIPGTGTIWKISRDDRGGDDD* |
Ga0137409_102989153 | 3300015245 | Vadose Zone Soil | YLVDYGAVRDPGGADSRSRFVNGADAPLVQIPGTGTIWKISRDDRGGDDD* |
Ga0137403_107204541 | 3300015264 | Vadose Zone Soil | AYLVDYGAVRDPGGADSRSRFVNAANAPLVQLPGTGTIWRISREDD* |
Ga0182034_100832764 | 3300016371 | Soil | RDFGRSDPDTGVKNPADGALVQIPGTGVIWKICAR |
Ga0182037_109057381 | 3300016404 | Soil | GAIRDFGRSDPDTGVKNPADGALVQIPGTGVIWKICPQ |
Ga0182038_105362223 | 3300016445 | Soil | DYGAVRDLGLSDPATAIKNPADAALVQIPSTGVIWKICPQ |
Ga0066669_100051471 | 3300018482 | Grasslands Soil | VRDPGGSDPDSKFVSPADAPLVQIPGTGVIWKISRSDDRRGGDDD |
Ga0066669_105375032 | 3300018482 | Grasslands Soil | VRDPGGSDPDSKFVSPADAPLVQIPGTGVIWKISRSDDRRGNNDHDD |
Ga0066669_124272342 | 3300018482 | Grasslands Soil | DFGQSDPFSKFKNPADAPLVQIPQTGTIWKITRSNG |
Ga0137408_14006711 | 3300019789 | Vadose Zone Soil | DYGAVRDPGGSDPDSKFVNPADAPLVQIPGTGVIWRISRDDGRDDD |
Ga0180113_12767991 | 3300020065 | Groundwater Sediment | ALYLVDYGAVRDFGQADPESKFLDPADAPLVQFPGTGVIFRISRIKK |
Ga0193699_104287972 | 3300021363 | Soil | YLVDYGAVRDPGGSDPESRVVVIPADLPLVQIPGTGVIWKITRIGDGRHDDD |
Ga0210410_113347753 | 3300021479 | Soil | RDFGQSDLETKYRNPADAGLPHIPGTGVIWKICPR |
Ga0126371_102965691 | 3300021560 | Tropical Forest Soil | GAVRDFGRSDPDAGFKNGADAALVQIPGTGVIWKICPK |
Ga0207692_109788521 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | YLVDFGAVRDFGQSDPAAKFTNPADAPLVQIPHTGVIWRISRTSDS |
Ga0207663_102483521 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | YVADYGAIRDVGQSDPDTGFKNPADAALVQIPGTGAIWKICGQ |
Ga0207712_100188041 | 3300025961 | Switchgrass Rhizosphere | GAVRDPGGSDPASSVVSPANLPLVQIPGTGVIWRISRDN |
Ga0209350_10360361 | 3300026277 | Grasslands Soil | AVRDPGGSDPDSKFVSPADAPLVQIPGTGVIWKISRSDDRRGGDDD |
Ga0209235_12112361 | 3300026296 | Grasslands Soil | VRDPGGADSRSRFVNPANAPLVQIPGTETIWRISRSNESRDDDDD |
Ga0209761_11885832 | 3300026313 | Grasslands Soil | VRDPGGADSRSRFVNPANAPLVQIPGTGTIWRISRSNESRDDDDD |
Ga0209471_10424313 | 3300026318 | Soil | AVRDPGGSDPDSKFVSPADAPLVQIPGTGVIWKISRSDDRRGNNDHDD |
Ga0209159_11686322 | 3300026343 | Soil | FGQSDPDSGFKVDGDGPLVQIPRTGVIWKICGPAGP |
Ga0209474_105969782 | 3300026550 | Soil | VDYGAVRDFGRSDPGQRFAVPADAPLVQIPHTGVIWKISSTERARDADEDD |
Ga0209466_10395652 | 3300027646 | Tropical Forest Soil | GAVRDPGGSDPDSRVLNPADLPLVQMPGTGVIWKITRIGGGGGDEDNDNQDDNK |
Ga0208981_10736282 | 3300027669 | Forest Soil | GAVRDPGGADPRSRFVNGADAPLVQIPGTGTIWKISRIDDGDNNDEND |
Ga0209701_102959631 | 3300027862 | Vadose Zone Soil | YGAVRDFGQSDPASRFKVAADAPLVQIPGTGVIWKICRE |
Ga0209814_100288341 | 3300027873 | Populus Rhizosphere | ALYLVDYGAVRDFGQSNPLTKFTVADDAPLVQIPGTGVIWRISRIGSDNNNDDD |
Ga0209814_100963161 | 3300027873 | Populus Rhizosphere | LYVVDYGAVRDFGQSDPRAKFKVASRPERAGTGDGPLVQIPGTGVIWKITRK |
Ga0209382_111908621 | 3300027909 | Populus Rhizosphere | AAYLVDYGAVRDFGRSDPKTRFADPADAPLVQIPGTGTIWKISRVSNHRHDDDDDERD |
Ga0247685_10249303 | 3300028065 | Soil | LVDYGAVRDPGGADPRSRFVNPADAPLVQIPGTGVIWKISRDD |
Ga0247663_10728301 | 3300028145 | Soil | AVRDPGGADPRSRFVNPADAPLVQIPGTGVIWKISRDD |
Ga0268265_116667571 | 3300028380 | Switchgrass Rhizosphere | GPDEALYLVDYGAVRDFGQADPASKYLDPADAPLVQIPGTGVIFHISRIKK |
Ga0307503_100903472 | 3300028802 | Soil | YLVDYGAVRDPGGSDPASQFKDPADAPLVQIPGTGVIWKITRIGGDRRDD |
Ga0307503_101310081 | 3300028802 | Soil | GAVRDPGGADPRSRFVNPADAPLVQIPGTGVIWKISRDD |
Ga0247826_103841182 | 3300030336 | Soil | LVDFGITRDGGESTPASAVVNSANTPIVQIPGTGVIWKISKR |
Ga0308187_100175392 | 3300031114 | Soil | VDYGVVRDPGGSDPASKFVNPADAPLVQIPGTGVIWRISRTND |
Ga0170818_1119574992 | 3300031474 | Forest Soil | VRDFGQSDPATMFVGALNGPLVQIPGTGTIWKICRQ |
Ga0318541_103134231 | 3300031545 | Soil | YGAIRDFGRSDPDTGVKNPADAALVQIPATGVIWKICPK |
Ga0318542_101660403 | 3300031668 | Soil | VADYGAIRDLGRSDPDTGFKNPADAALVQIPGTGVIWKICSE |
Ga0307469_108072862 | 3300031720 | Hardwood Forest Soil | GALYLVDYGAVRDPGGADPESGFADPADAPLVQIPGTGVIWKITRIGGGGHDDD |
Ga0318502_104802062 | 3300031747 | Soil | DYGALRDFGRSDPDTGVKNPADGALVQIPGTGVIWKICAR |
Ga0318521_105809742 | 3300031770 | Soil | GAVRDFGQSDPAAKFITPGDGPLVQIPGTGVIWRICPQ |
Ga0318517_101644241 | 3300031835 | Soil | YGAIRDFGRSDPDTGVKIPADAALVQIPGTGVIWKICPK |
Ga0318536_104514451 | 3300031893 | Soil | VADYGAIRDVGQSDSDTKYKVPADCILVQIPGTGVIWKICRQSQP |
Ga0307412_108190581 | 3300031911 | Rhizosphere | FYLVDFGAVRDFGRATPASLFTNPDDAPLVQIPGTGVIWKISKQ |
Ga0306921_125007341 | 3300031912 | Soil | AIRDVGQSNPDTKYKVAADGILVQIPGTGVIWKICPQ |
Ga0310916_112138271 | 3300031942 | Soil | AVRDFGQSDPAAKFITPGDGPLVQIPGTGVIWRICPQ |
Ga0306926_115336521 | 3300031954 | Soil | AIRDFGRSDPDTEVKIPADAALVQIPSTGVIRKICPQ |
Ga0318507_103113351 | 3300032025 | Soil | IRDFGRSDPDTGFKNPADAALVQIPGTGVIWKICPQ |
Ga0318533_105680411 | 3300032059 | Soil | IRDPGQSAPDMKVPNPADAAFLQIPGTGVIWKICPQ |
Ga0318533_109562231 | 3300032059 | Soil | YGAIRDFGRSDPDTGVKIPADAALVQIPSTGVIWKICPQ |
Ga0318510_105167252 | 3300032064 | Soil | ADYGAVRDFGRSDPDAAFKNPADAALVQIPGTGVIWKICRQ |
Ga0307471_1015272612 | 3300032180 | Hardwood Forest Soil | AVRDFGQSDPATMFVGAGNGPLVQIPGTGTIWKICRQ |
Ga0364943_0038995_3_143 | 3300034354 | Sediment | RDFGRSVPASRFALDADAPLVQIPGTGTIWKISRINDRRGHNDDED |
Ga0364943_0226193_1_135 | 3300034354 | Sediment | FGRSVPASRFALDADAPLVQIPGTGTIWKISRIDDRRGHNDDDD |
⦗Top⦘ |