NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F051967

Metagenome Family F051967

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051967
Family Type Metagenome
Number of Sequences 143
Average Sequence Length 137 residues
Representative Sequence MLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Number of Associated Samples 123
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 66.67 %
% of genes near scaffold ends (potentially truncated) 50.35 %
% of genes from short scaffolds (< 2000 bps) 75.52 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.706 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(19.580 % of family members)
Environment Ontology (ENVO) Unclassified
(74.126 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.315 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.16%    β-sheet: 45.27%    Coil/Unstructured: 42.57%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF13673Acetyltransf_10 2.10
PF04851ResIII 1.40
PF00271Helicase_C 1.40
PF08774VRR_NUC 1.40
PF12802MarR_2 1.40
PF13479AAA_24 0.70
PF04545Sigma70_r4 0.70
PF13412HTH_24 0.70
PF03237Terminase_6N 0.70
PF13392HNH_3 0.70


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.50 %
UnclassifiedrootN/A3.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10123410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1012Open in IMG/M
3300000101|DelMOSum2010_c10197850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium678Open in IMG/M
3300000115|DelMOSum2011_c10048016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1716Open in IMG/M
3300000115|DelMOSum2011_c10119775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium826Open in IMG/M
3300000116|DelMOSpr2010_c10015089All Organisms → cellular organisms → Bacteria3894Open in IMG/M
3300000928|OpTDRAFT_10081775All Organisms → cellular organisms → Bacteria7033Open in IMG/M
3300000930|BpDRAFT_10152107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium851Open in IMG/M
3300001450|JGI24006J15134_10102187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1026Open in IMG/M
3300001460|JGI24003J15210_10048671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1425Open in IMG/M
3300001472|JGI24004J15324_10010215All Organisms → cellular organisms → Bacteria3409Open in IMG/M
3300001472|JGI24004J15324_10013008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium2953Open in IMG/M
3300001589|JGI24005J15628_10100411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium973Open in IMG/M
3300001589|JGI24005J15628_10124452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium824Open in IMG/M
3300001589|JGI24005J15628_10228660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium503Open in IMG/M
3300004448|Ga0065861_1078377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1493Open in IMG/M
3300004461|Ga0066223_1138225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium530Open in IMG/M
3300005912|Ga0075109_1046944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB21627Open in IMG/M
3300005935|Ga0075125_10013971All Organisms → cellular organisms → Bacteria3802Open in IMG/M
3300006029|Ga0075466_1129735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium662Open in IMG/M
3300006352|Ga0075448_10161836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium691Open in IMG/M
3300006735|Ga0098038_1011071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae3533Open in IMG/M
3300006752|Ga0098048_1084601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium967Open in IMG/M
3300006802|Ga0070749_10148427All Organisms → cellular organisms → Bacteria1364Open in IMG/M
3300006803|Ga0075467_10195747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1128Open in IMG/M
3300006810|Ga0070754_10076197All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300006810|Ga0070754_10150377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1113Open in IMG/M
3300006870|Ga0075479_10321603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium605Open in IMG/M
3300006916|Ga0070750_10099420All Organisms → Viruses → Predicted Viral1349Open in IMG/M
3300006919|Ga0070746_10058755All Organisms → cellular organisms → Bacteria1989Open in IMG/M
3300006920|Ga0070748_1077706All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300006947|Ga0075444_10360236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium552Open in IMG/M
3300007229|Ga0075468_10036124All Organisms → cellular organisms → Bacteria1740Open in IMG/M
3300007229|Ga0075468_10062765All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300007231|Ga0075469_10157190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium618Open in IMG/M
3300007276|Ga0070747_1169258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium780Open in IMG/M
3300007539|Ga0099849_1046570All Organisms → cellular organisms → Bacteria1818Open in IMG/M
3300007540|Ga0099847_1041929All Organisms → Viruses → Predicted Viral1454Open in IMG/M
3300007540|Ga0099847_1100302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium882Open in IMG/M
3300007540|Ga0099847_1136329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium735Open in IMG/M
3300007540|Ga0099847_1194516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium593Open in IMG/M
3300007862|Ga0105737_1070143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium864Open in IMG/M
3300007863|Ga0105744_1035014All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300007864|Ga0105749_1103627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium631Open in IMG/M
3300007956|Ga0105741_1168612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium538Open in IMG/M
3300007962|Ga0102907_1196043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium517Open in IMG/M
3300008221|Ga0114916_1012839All Organisms → cellular organisms → Bacteria3157Open in IMG/M
3300008964|Ga0102889_1064315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1105Open in IMG/M
3300009079|Ga0102814_10092873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1657Open in IMG/M
3300009149|Ga0114918_10209093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1129Open in IMG/M
3300009413|Ga0114902_1178619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium524Open in IMG/M
3300009418|Ga0114908_1199970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium621Open in IMG/M
3300009428|Ga0114915_1134892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium710Open in IMG/M
3300009428|Ga0114915_1176137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium597Open in IMG/M
3300009449|Ga0115558_1057605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1772Open in IMG/M
3300009512|Ga0115003_10036322All Organisms → cellular organisms → Bacteria3185Open in IMG/M
3300009526|Ga0115004_10171918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB21304Open in IMG/M
3300009604|Ga0114901_1117394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium823Open in IMG/M
3300010149|Ga0098049_1148819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium724Open in IMG/M
3300010151|Ga0098061_1331639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium520Open in IMG/M
3300010312|Ga0102883_1175176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium610Open in IMG/M
3300010368|Ga0129324_10205459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium798Open in IMG/M
3300011128|Ga0151669_114227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium503Open in IMG/M
3300011245|Ga0151673_120045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1117Open in IMG/M
3300011253|Ga0151671_1027549All Organisms → cellular organisms → Bacteria5641Open in IMG/M
3300012953|Ga0163179_10056142All Organisms → Viruses → Predicted Viral2728Open in IMG/M
3300013010|Ga0129327_10144530All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300013010|Ga0129327_10268386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium876Open in IMG/M
3300013010|Ga0129327_10666065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium580Open in IMG/M
3300017697|Ga0180120_10418095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium525Open in IMG/M
3300017717|Ga0181404_1110512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium671Open in IMG/M
3300017730|Ga0181417_1008917All Organisms → cellular organisms → Bacteria2620Open in IMG/M
3300017738|Ga0181428_1020246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1537Open in IMG/M
3300017741|Ga0181421_1012495All Organisms → cellular organisms → Bacteria2350Open in IMG/M
3300017744|Ga0181397_1052261All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300017745|Ga0181427_1172695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium521Open in IMG/M
3300017750|Ga0181405_1075529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium865Open in IMG/M
3300017755|Ga0181411_1116037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium784Open in IMG/M
3300017760|Ga0181408_1123571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium670Open in IMG/M
3300017767|Ga0181406_1254143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium516Open in IMG/M
3300017768|Ga0187220_1090135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium925Open in IMG/M
3300017770|Ga0187217_1129365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium851Open in IMG/M
3300017786|Ga0181424_10075066All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300020294|Ga0211520_1002131All Organisms → cellular organisms → Bacteria3696Open in IMG/M
3300020336|Ga0211510_1031533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1353Open in IMG/M
3300020382|Ga0211686_10002441All Organisms → cellular organisms → Bacteria10063Open in IMG/M
3300020385|Ga0211677_10085434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1395Open in IMG/M
3300020438|Ga0211576_10173376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1158Open in IMG/M
3300020469|Ga0211577_10035122All Organisms → cellular organisms → Bacteria3769Open in IMG/M
3300020469|Ga0211577_10704230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium592Open in IMG/M
3300021371|Ga0213863_10008143All Organisms → cellular organisms → Bacteria6681Open in IMG/M
3300021389|Ga0213868_10182854All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1270Open in IMG/M
3300021957|Ga0222717_10002754All Organisms → cellular organisms → Bacteria13425Open in IMG/M
3300021957|Ga0222717_10186701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1238Open in IMG/M
3300021958|Ga0222718_10002161All Organisms → cellular organisms → Bacteria17934Open in IMG/M
3300022072|Ga0196889_1017789All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300022072|Ga0196889_1085364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium585Open in IMG/M
3300022178|Ga0196887_1005772All Organisms → cellular organisms → Bacteria4377Open in IMG/M
3300022821|Ga0222673_1008270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1951Open in IMG/M
3300022822|Ga0222646_100730All Organisms → cellular organisms → Bacteria8777Open in IMG/M
(restricted) 3300023109|Ga0233432_10295405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium751Open in IMG/M
3300023243|Ga0222630_1068763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium673Open in IMG/M
3300023251|Ga0222683_1045776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium700Open in IMG/M
3300024346|Ga0244775_10443441All Organisms → cellular organisms → Bacteria1065Open in IMG/M
(restricted) 3300024518|Ga0255048_10074449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1688Open in IMG/M
(restricted) 3300024520|Ga0255047_10117645All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300025048|Ga0207905_1043445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium704Open in IMG/M
3300025086|Ga0208157_1043935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1229Open in IMG/M
3300025098|Ga0208434_1110166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium528Open in IMG/M
3300025099|Ga0208669_1000772All Organisms → cellular organisms → Bacteria12403Open in IMG/M
3300025120|Ga0209535_1000143All Organisms → cellular organisms → Bacteria45879Open in IMG/M
3300025120|Ga0209535_1012932All Organisms → cellular organisms → Bacteria4567Open in IMG/M
3300025120|Ga0209535_1071458All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300025137|Ga0209336_10110849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium763Open in IMG/M
3300025138|Ga0209634_1143868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium983Open in IMG/M
3300025138|Ga0209634_1311518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium536Open in IMG/M
3300025168|Ga0209337_1030047All Organisms → Viruses → Predicted Viral3026Open in IMG/M
3300025301|Ga0208450_1066295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium849Open in IMG/M
3300025508|Ga0208148_1003072All Organisms → cellular organisms → Bacteria5807Open in IMG/M
3300025508|Ga0208148_1027590All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300025543|Ga0208303_1048026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1049Open in IMG/M
3300025570|Ga0208660_1091789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium678Open in IMG/M
3300025645|Ga0208643_1005788All Organisms → cellular organisms → Bacteria5292Open in IMG/M
3300025661|Ga0208905_1136344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium702Open in IMG/M
3300025676|Ga0209657_1006145All Organisms → cellular organisms → Bacteria5949Open in IMG/M
3300025680|Ga0209306_1057394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1234Open in IMG/M
3300025685|Ga0209095_1049372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1524Open in IMG/M
3300025707|Ga0209667_1191143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium580Open in IMG/M
3300025809|Ga0209199_1151934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium863Open in IMG/M
3300025822|Ga0209714_1057645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1223Open in IMG/M
3300025890|Ga0209631_10415521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium620Open in IMG/M
3300025897|Ga0209425_10009311All Organisms → cellular organisms → Bacteria8883Open in IMG/M
3300027788|Ga0209711_10360428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium609Open in IMG/M
3300031519|Ga0307488_10672956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium589Open in IMG/M
3300031569|Ga0307489_11110103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium568Open in IMG/M
3300031596|Ga0302134_10239267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2715Open in IMG/M
3300031621|Ga0302114_10015811All Organisms → cellular organisms → Bacteria4134Open in IMG/M
3300032277|Ga0316202_10013460All Organisms → cellular organisms → Bacteria4148Open in IMG/M
3300033742|Ga0314858_066744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium890Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine19.58%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous18.18%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.09%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.29%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water5.59%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean4.90%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.50%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.50%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.50%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.80%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.80%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.10%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.10%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.10%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.40%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.40%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.40%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.40%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.40%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine1.40%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.40%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.70%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.70%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.70%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.70%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.70%
Lake WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Lake Water0.70%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005912Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKDEnvironmentalOpen in IMG/M
3300005935Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKNEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300007962Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02EnvironmentalOpen in IMG/M
3300008221Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66EnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009413Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12EnvironmentalOpen in IMG/M
3300009418Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009604Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010312Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011128Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02EnvironmentalOpen in IMG/M
3300011245Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.2EnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020294Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153)EnvironmentalOpen in IMG/M
3300020336Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022821Saline water microbial communities from Ace Lake, Antarctica - #801EnvironmentalOpen in IMG/M
3300022822Saline water microbial communities from Ace Lake, Antarctica - #293EnvironmentalOpen in IMG/M
3300022843Saline water microbial communities from Ace Lake, Antarctica - #5EnvironmentalOpen in IMG/M
3300022866Saline water microbial communities from Ace Lake, Antarctica - #369EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023242Saline water microbial communities from Ace Lake, Antarctica - #1576EnvironmentalOpen in IMG/M
3300023243Saline water microbial communities from Ace Lake, Antarctica - #3EnvironmentalOpen in IMG/M
3300023251Saline water microbial communities from Ace Lake, Antarctica - #1073EnvironmentalOpen in IMG/M
3300023501Saline water microbial communities from Ace Lake, Antarctica - #1159EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025301Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025661Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS (SPAdes)EnvironmentalOpen in IMG/M
3300025676Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025685Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes)EnvironmentalOpen in IMG/M
3300025707Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031596Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCMEnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1012341013300000101MarineMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTID
DelMOSum2010_1019785023300000101MarineYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
DelMOSum2011_1004801643300000115MarineMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMRVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKR
DelMOSum2011_1011977513300000115MarineMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVA
DelMOSpr2010_1001508923300000116MarineMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMRVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
OpTDRAFT_1008177533300000928Freshwater And MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKSPH*
BpDRAFT_1015210713300000930Freshwater And MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSV
JGI24006J15134_1010218723300001450MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQNYDAAYDACLQFTYRGKITGMSNKLMKTVMEANGIYMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSSEWHSVRKSKHRRKRVAYAWEIKAPH*
JGI24003J15210_1004867143300001460MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCREVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTID
JGI24004J15324_1001021593300001472MarineMLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH*
JGI24004J15324_1001300813300001472MarineYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH*
JGI24005J15628_1010041133300001589MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQNYDAAYDACLQFTYRGKITGMSNKLMKTVMEANGIYMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQS
JGI24005J15628_1012445233300001589MarineMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHS
JGI24005J15628_1022866013300001589MarineMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQS
Ga0065861_107837723300004448MarineMLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0066223_113822513300004461MarineMLPRTAQSHTPLRTSKSRHTWCGPYAAAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0075109_104694423300005912Saline LakeMLPRTAQAHTPLRASKSLRTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0075125_1001397143300005935Saline LakeMLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYAKDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0075466_112973523300006029AqueousMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIK
Ga0075448_1016183623300006352MarineMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDRTIDNQSGEWH
Ga0098038_101107183300006735MarineMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPN*
Ga0098048_108460123300006752MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPN*
Ga0070749_1014842723300006802AqueousMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMRVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0075467_1019574713300006803AqueousPMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKSPH*
Ga0070754_1007619763300006810AqueousMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKR
Ga0070754_1015037733300006810AqueousMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKR
Ga0075479_1032160313300006870AqueousLTIQSGDHPMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0070750_1009942023300006916AqueousMLPRTAQSHTPLRASKSLRTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0070746_1005875563300006919AqueousMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0070748_107770643300006920AqueousMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIK
Ga0075444_1036023613300006947MarineMLPRTAQAHTPLRASKSLRTWCGPYAVAVFLRQLYGAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0075468_1003612453300007229AqueousMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRK
Ga0075468_1006276533300007229AqueousMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRK
Ga0075469_1015719013300007231AqueousIQSGDHPMLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0070747_116925813300007276AqueousNMKFAINQNGASAPPTIQSGDHQMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH*
Ga0099849_104657023300007539AqueousVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0099847_104192913300007540AqueousMKFAINQNGASAPTTIQSGDHPMLPRTAQSHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYI
Ga0099847_110030223300007540AqueousMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0099847_113632923300007540AqueousMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH*
Ga0099847_119451623300007540AqueousMLPRTAQSHTPLRASKSLRTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAY
Ga0105737_107014323300007862Estuary WaterMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH*
Ga0105744_103501423300007863Estuary WaterMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0105749_110362723300007864Estuary WaterNGDYPMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0105741_116861213300007956Estuary WaterMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKSPH*
Ga0102907_119604313300007962EstuarineKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0114916_101283973300008221Deep OceanMLPRTAQAHTPLRASKSLRTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLATWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKATH*
Ga0102889_106431513300008964EstuarineTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0102814_1009287333300009079EstuarineMLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKSPH*
Ga0114918_1020909323300009149Deep SubsurfaceMLPRTAQSHTPLRTSKSRHTWCGPYAAAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0114902_117861913300009413Deep OceanQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARDNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH*
Ga0114908_119997013300009418Deep OceanYPMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARDNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH*
Ga0114915_113489223300009428Deep OceanVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0114915_117613713300009428Deep OceanVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRK
Ga0115558_105760563300009449Pelagic MarineQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0115003_1003632273300009512MarineMKFAINQNGAIAPHPPSNGDHPMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0115004_1017191823300009526MarineMLPRTAQSHTPLRTRKSRHTWCGPYAAAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0114901_111739423300009604Deep OceanWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARDNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH*
Ga0098049_114881913300010149MarineMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPN*
Ga0098061_133163913300010151MarineAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPN*
Ga0102883_117517613300010312EstuarineGDYPMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYMREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNPSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0129324_1020545913300010368Freshwater To Marine Saline GradientRTAQSHTPLRASKSLRTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMRVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0151669_11422713300011128MarineHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKNTGMSNKFMTTVKAANGNQRTLHYCRDVGSYPRHNPTPTAWLKTRDRKKTYLVNITGHYILVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0151673_12004523300011245MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYDACLQFTYRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKSPH*
Ga0151671_1027549103300011253MarineMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0163179_1005614243300012953SeawaterMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTLRGKITGMSNKLMKTVMEANGIYMTLHYCRDVGSYARQNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH*
Ga0129327_1014453013300013010Freshwater To Marine Saline GradientMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRK
Ga0129327_1026838623300013010Freshwater To Marine Saline GradientMLPRTAQSHTPLRASKSLRTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMRVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH*
Ga0129327_1066606523300013010Freshwater To Marine Saline GradientVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRR
Ga0180120_1041809513300017697Freshwater To Marine Saline GradientMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSV
Ga0181404_111051213300017717SeawaterYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPR
Ga0181417_100891723300017730SeawaterMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPR
Ga0181428_102024643300017738SeawaterMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARDNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH
Ga0181421_101249523300017741SeawaterMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCREVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPR
Ga0181397_105226123300017744SeawaterMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPR
Ga0181427_117269513300017745SeawaterMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWE
Ga0181405_107552913300017750SeawaterMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHR
Ga0181411_111603723300017755SeawaterMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKSPH
Ga0181408_112357113300017760SeawaterDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPR
Ga0181406_125414313300017767SeawaterKVDLVIKTGLRPHPPSNQGDSTMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKSPH
Ga0187220_109013533300017768SeawaterMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMEANGIYMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKR
Ga0187217_112936513300017770SeawaterMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH
Ga0181424_1007506633300017786SeawaterAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKSPH
Ga0211520_1002131103300020294MarineMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTLHGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARDNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPR
Ga0211510_103153343300020336MarineMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTLHGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARDNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH
Ga0211686_1000244143300020382MarineMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNNLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDRTIDNQSGEWHSVRKSKHRRKRVAYAWEIKATH
Ga0211677_1008543423300020385MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMEANGIQMTLHYCREVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH
Ga0211576_1017337623300020438MarineKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKSPH
Ga0211577_1003512283300020469MarineMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARDNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH
Ga0211577_1070423013300020469MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0213863_10008143143300021371SeawaterMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0213868_1018285423300021389SeawaterRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0222717_1000275453300021957Estuarine WaterMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0222717_1018670123300021957Estuarine WaterAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKSP
Ga0222718_1000216193300021958Estuarine WaterMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKSPH
Ga0196889_101778923300022072AqueousMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0196889_108536423300022072AqueousMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWH
Ga0196887_1005772103300022178AqueousMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWH
Ga0222673_100827053300022821Saline WaterMLPRTAQAHTPLRASKSLRTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWE
Ga0222646_100730103300022822Saline WaterMLPRTAQAHTPLRASKSLRTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0222631_104003223300022843Saline WaterDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0222651_104032413300022866Saline WaterRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
(restricted) Ga0233432_1029540523300023109SeawaterQAHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0222708_102251713300023242Saline WaterFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0222630_106876313300023243Saline WaterPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0222683_104577623300023251Saline WaterKSLRTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0222686_101951633300023501Saline WaterACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0244775_1044344123300024346EstuarineMLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
(restricted) Ga0255048_1007444913300024518SeawaterMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKS
(restricted) Ga0255047_1011764523300024520SeawaterMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKSPH
Ga0207905_104344523300025048MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0208157_104393543300025086MarineRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPN
Ga0208434_111016613300025098MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHS
Ga0208669_1000772143300025099MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPN
Ga0209535_1000143403300025120MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCREVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKSPH
Ga0209535_101293293300025120MarineMLPRTAQSHTPLRTSKSRHTWCGPYAAAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMRVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0209535_107145813300025120MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKSPH
Ga0209336_1011084913300025137MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQNYDAAYDACLQFTYRGKITGMSNKLMKTVMEANGIYMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSSEWHS
Ga0209634_114386823300025138MarineMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQNYDAAYDACLQFTYRGKITGMSNKLMKTVMEANGIYMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSSEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0209634_131151813300025138MarineMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDN
Ga0209337_103004753300025168MarineMLPRTAQSHTPLRASKSRRTWCGPYAAAVFMRQHYDAAYDACLQFTYRGKITGMSNSLMRVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0208450_106629523300025301Deep OceanLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARDNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH
Ga0208148_100307213300025508AqueousMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRR
Ga0208148_102759033300025508AqueousMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKSPH
Ga0208303_104802633300025543AqueousMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVGYAWEIKAPH
Ga0208660_109178923300025570AqueousTSKSRHTWCGPYAAAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0208643_100578893300025645AqueousMLPRTAQAHTPLRTSKSRHTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKSPH
Ga0208905_113634413300025661Lake WaterMLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYAKDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0209657_100614513300025676MarineMLPRTAQSHTPLRASKSLRTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKS
Ga0209306_105739413300025680Pelagic MarineMLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWH
Ga0209095_104937243300025685Pelagic MarineMLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0209667_119114313300025707MarineMLPRTAQSHTPLRASKSLRTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0209199_115193413300025809Pelagic MarineMLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTID
Ga0209714_105764513300025822Pelagic MarineMLPRTAQAHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSG
Ga0209631_1041552113300025890Pelagic MarineMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSV
Ga0209425_1000931113300025897Pelagic MarinePPHPPTIQSGDYLMLPRTAQAHTPLRTSKSRRTWCGPYAAAVFMRQHYDAAYEVCLCHTFRGKITGMSNKLMKTVMGANGIQMTLHYCRDVGSYARHNPTLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0209711_1036042813300027788MarineMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0209092_1001240013300027833MarineCLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0307488_1067295613300031519Sackhole BrineGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0307489_1111010313300031569Sackhole BrineMLPRTAQSHTPLRTRKSRHTWCGPYAAAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKA
Ga0302134_1023926713300031596MarineMLPRTAQSHTPLRTRKSRHTWCGPYAAAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDN
Ga0302114_1001581193300031621MarineMLPRTAQSHTPLRASKSLRTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMRVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0316202_1001346093300032277Microbial MatMLPRTAQSHTPLRASKSLRTWCGPYAVAVFLRQHYDAAYDACLQFTYRGKITGMSNSLMKVVMGANGIQMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDNQSGEWHSVRKSKHRRKRVAYAWEIKAPH
Ga0314858_066744_1_3633300033742Sea-Ice BrineMLPRTAQSHTPLRTSKSRHTWCGPYAVAVFLRQNYDAAYDACLQFTYRGKITGMSNSLMKVVMGANNVEMTFHYKREIGSYARDNATLAAWLKTRDRKKTYLVNITGHYIVVSGDKTIDN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.