NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F051788

Metagenome Family F051788

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051788
Family Type Metagenome
Number of Sequences 143
Average Sequence Length 53 residues
Representative Sequence MGVISTQGIEFQLVANGEILDLFQDEDIKLSDNVTGLFDLGVIPADFTRQI
Number of Associated Samples 110
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 95.10 %
% of genes from short scaffolds (< 2000 bps) 85.31 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (84.615 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(24.476 % of family members)
Environment Ontology (ENVO) Unclassified
(62.937 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(53.846 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 5.06%    Coil/Unstructured: 94.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF04860Phage_portal 3.50
PF07453NUMOD1 2.80
PF13385Laminin_G_3 0.70
PF07460NUMOD3 0.70


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.80 %
UnclassifiedrootN/A4.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352005|2200039535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300001282|B570J14230_10115786All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage792Open in IMG/M
3300002091|JGI24028J26656_1000536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11455Open in IMG/M
3300002091|JGI24028J26656_1015942Not Available804Open in IMG/M
3300002092|JGI24218J26658_1022720All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage832Open in IMG/M
3300002408|B570J29032_109340787All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage701Open in IMG/M
3300002408|B570J29032_109529884All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage842Open in IMG/M
3300002835|B570J40625_100371979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1405Open in IMG/M
3300002835|B570J40625_100889135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage772Open in IMG/M
3300003277|JGI25908J49247_10059756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage974Open in IMG/M
3300003277|JGI25908J49247_10085551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage772Open in IMG/M
3300004240|Ga0007787_10202353All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage967Open in IMG/M
3300004481|Ga0069718_15489079All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage832Open in IMG/M
3300005215|Ga0069001_10181035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300005527|Ga0068876_10421350All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300005580|Ga0049083_10045648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1552Open in IMG/M
3300005805|Ga0079957_1012104All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6426Open in IMG/M
3300005805|Ga0079957_1075689All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1924Open in IMG/M
3300006802|Ga0070749_10361629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage805Open in IMG/M
3300006805|Ga0075464_10545696All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage711Open in IMG/M
3300006805|Ga0075464_11004276All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300007346|Ga0070753_1216016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage705Open in IMG/M
3300007538|Ga0099851_1084230All Organisms → Viruses → Predicted Viral1222Open in IMG/M
3300007541|Ga0099848_1180253All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage767Open in IMG/M
3300007542|Ga0099846_1068374All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1329Open in IMG/M
3300007542|Ga0099846_1272895All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage583Open in IMG/M
3300007960|Ga0099850_1203965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300008114|Ga0114347_1000987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage25809Open in IMG/M
3300008117|Ga0114351_1033341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3343Open in IMG/M
3300008266|Ga0114363_1068643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2021Open in IMG/M
3300008267|Ga0114364_1167639All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300008450|Ga0114880_1084848All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1256Open in IMG/M
3300008450|Ga0114880_1197268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300009051|Ga0102864_1203450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300009068|Ga0114973_10431677All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage687Open in IMG/M
3300009159|Ga0114978_10174931All Organisms → Viruses → Predicted Viral1369Open in IMG/M
3300009165|Ga0105102_10674715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage578Open in IMG/M
3300009168|Ga0105104_10523140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage669Open in IMG/M
3300009180|Ga0114979_10099636All Organisms → Viruses → Predicted Viral1797Open in IMG/M
3300009181|Ga0114969_10799373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300010354|Ga0129333_11638919All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
(restricted) 3300013127|Ga0172365_10276601All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1005Open in IMG/M
(restricted) 3300013128|Ga0172366_10053122All Organisms → Viruses → Predicted Viral2823Open in IMG/M
(restricted) 3300013129|Ga0172364_10799560All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
(restricted) 3300013130|Ga0172363_10586762All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage706Open in IMG/M
(restricted) 3300013131|Ga0172373_10087831All Organisms → Viruses → Predicted Viral2410Open in IMG/M
3300013372|Ga0177922_10322116All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage824Open in IMG/M
3300014811|Ga0119960_1037173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage745Open in IMG/M
3300015050|Ga0181338_1045145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300017701|Ga0181364_1015453All Organisms → Viruses → Predicted Viral1272Open in IMG/M
3300017701|Ga0181364_1040391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300017707|Ga0181363_1050180All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.749Open in IMG/M
3300017707|Ga0181363_1051789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage734Open in IMG/M
3300017723|Ga0181362_1074925All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage685Open in IMG/M
3300017770|Ga0187217_1224658All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage617Open in IMG/M
3300017774|Ga0181358_1048314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1618Open in IMG/M
3300017774|Ga0181358_1276222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300017780|Ga0181346_1019951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2821Open in IMG/M
3300017780|Ga0181346_1035903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2041Open in IMG/M
3300017780|Ga0181346_1234452Not Available648Open in IMG/M
3300017784|Ga0181348_1329804Not Available503Open in IMG/M
3300017785|Ga0181355_1388093All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300020159|Ga0211734_10918918All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage890Open in IMG/M
3300020161|Ga0211726_10414408All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300020205|Ga0211731_10191324All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300020506|Ga0208091_1016282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage886Open in IMG/M
3300020550|Ga0208600_1001028All Organisms → Viruses → Predicted Viral4256Open in IMG/M
3300020578|Ga0194129_10437623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage670Open in IMG/M
3300020810|Ga0181598_1107739All Organisms → Viruses → Predicted Viral1188Open in IMG/M
3300021438|Ga0213920_1033167All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1158Open in IMG/M
3300021956|Ga0213922_1018263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1812Open in IMG/M
3300021963|Ga0222712_10579553All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300022069|Ga0212026_1047484All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage646Open in IMG/M
3300022071|Ga0212028_1003909All Organisms → Viruses → Predicted Viral2000Open in IMG/M
3300022190|Ga0181354_1079045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1086Open in IMG/M
3300022190|Ga0181354_1087844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1021Open in IMG/M
3300022407|Ga0181351_1111108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1043Open in IMG/M
3300022407|Ga0181351_1232575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage589Open in IMG/M
3300024515|Ga0255183_1081218All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage658Open in IMG/M
3300025879|Ga0209555_10163967All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage916Open in IMG/M
3300027621|Ga0208951_1065174All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1037Open in IMG/M
3300027649|Ga0208960_1112613All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage720Open in IMG/M
3300027659|Ga0208975_1168009All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300027707|Ga0209443_1043131All Organisms → Viruses → Predicted Viral1871Open in IMG/M
3300027707|Ga0209443_1170831All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300027734|Ga0209087_1065587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1614Open in IMG/M
3300027764|Ga0209134_10219478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300027772|Ga0209768_10222238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage835Open in IMG/M
3300027772|Ga0209768_10225798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage826Open in IMG/M
3300027772|Ga0209768_10431926All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300027785|Ga0209246_10023627All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2316Open in IMG/M
3300027785|Ga0209246_10198486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage784Open in IMG/M
3300027798|Ga0209353_10192481All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage896Open in IMG/M
3300027804|Ga0209358_10010625All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6090Open in IMG/M
3300027804|Ga0209358_10501848All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage552Open in IMG/M
3300027808|Ga0209354_10434538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300027816|Ga0209990_10264110All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300027900|Ga0209253_10658635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage760Open in IMG/M
3300029306|Ga0135212_1034254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300029753|Ga0135224_1027830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage596Open in IMG/M
3300031566|Ga0307378_10058149All Organisms → Viruses → Predicted Viral4237Open in IMG/M
3300031706|Ga0307997_10058172All Organisms → Viruses → Predicted Viral1608Open in IMG/M
3300031746|Ga0315293_10256930All Organisms → Viruses → Predicted Viral1416Open in IMG/M
3300031746|Ga0315293_10650312All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage791Open in IMG/M
3300031746|Ga0315293_10869552All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage654Open in IMG/M
3300031772|Ga0315288_11547935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300031885|Ga0315285_10893894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300031952|Ga0315294_10311051All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1510Open in IMG/M
3300031999|Ga0315274_10392003All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1613Open in IMG/M
3300031999|Ga0315274_10922154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage906Open in IMG/M
3300031999|Ga0315274_10944736All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage890Open in IMG/M
3300032401|Ga0315275_12174641All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300032401|Ga0315275_12689516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300033981|Ga0334982_0334002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage704Open in IMG/M
3300033992|Ga0334992_0039488All Organisms → Viruses → Predicted Viral2753Open in IMG/M
3300033996|Ga0334979_0711490All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300034013|Ga0334991_0306485All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300034061|Ga0334987_0115899All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2028Open in IMG/M
3300034061|Ga0334987_0637525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300034062|Ga0334995_0016934All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6620Open in IMG/M
3300034062|Ga0334995_0308097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1034Open in IMG/M
3300034063|Ga0335000_0428280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300034082|Ga0335020_0429629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
3300034092|Ga0335010_0424140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage720Open in IMG/M
3300034095|Ga0335022_0586769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage566Open in IMG/M
3300034101|Ga0335027_0138731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1801Open in IMG/M
3300034101|Ga0335027_0367021All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage946Open in IMG/M
3300034101|Ga0335027_0466144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage801Open in IMG/M
3300034104|Ga0335031_0305432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1033Open in IMG/M
3300034104|Ga0335031_0578655All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300034104|Ga0335031_0622725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
3300034106|Ga0335036_0264032All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1160Open in IMG/M
3300034108|Ga0335050_0132582All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1385Open in IMG/M
3300034112|Ga0335066_0139584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1489Open in IMG/M
3300034117|Ga0335033_0071465All Organisms → Viruses → Predicted Viral2058Open in IMG/M
3300034117|Ga0335033_0443448All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300034119|Ga0335054_0354195All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage849Open in IMG/M
3300034122|Ga0335060_0251429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage985Open in IMG/M
3300034283|Ga0335007_0116409All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1957Open in IMG/M
3300034356|Ga0335048_0597797All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake24.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater19.58%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment10.49%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater4.20%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.50%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.80%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.80%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic2.10%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.10%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.10%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.40%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater1.40%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor1.40%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.70%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.70%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.70%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.70%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.70%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.70%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.70%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.70%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.70%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.70%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.70%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.70%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352005Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnionEnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002091Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenomeEnvironmentalOpen in IMG/M
3300002092Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenomeEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005215Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009051Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020506Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300020810Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022922Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaGEnvironmentalOpen in IMG/M
3300022923Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaGEnvironmentalOpen in IMG/M
3300024515Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8dEnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027649Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027707Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300029306Marine harbor viral communities from the Indian Ocean - SCH3EnvironmentalOpen in IMG/M
3300029753Marine harbor viral communities from the Indian Ocean - SRH3EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031706Marine microbial communities from David Island wharf, Antarctic Ocean - #36EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
22002539962199352005FreshwaterMGIISTQAFTFRLVADGTQLDIFQDEDIKLSNNVTGLFDVGVLPADFTRQITLPGTKVNNAF
B570J14230_1011578623300001282FreshwaterMGVISTQGFSFKLIANGTQLDLFDDEEILVSDNITGLFDIGVLPSDFT
JGI24028J26656_100053613300002091LenticMSVISTQGIKFQLVANGVILDLYQDEIITLSNNSTQLFDL
JGI24028J26656_101594213300002091LenticMSVISTQGIKFQLVANGVILDLYQDEIITLSNNSTQLFD
JGI24218J26658_102272013300002092LenticMSVISTQGIKFQLVANGVILDLYQDEIITLSNNSTQLFDLGQLP
B570J29032_10934078713300002408FreshwaterMGVLSTQGIQFQLVADGQILDLFKDEDILLSDNVTGLFDLGIIPADFTRQITLPGTKK
B570J29032_10952988413300002408FreshwaterMGIASTQGLEFKLVANDEILDLFKDEQILLSDNVTGLFDL
B570J40625_10037197923300002835FreshwaterMGVISTQAFTFRLVANGQQLDTFEDEDITLSNNVTGLFDIGVLPSDFTRQITLPGTKVNNAF
B570J40625_10088913513300002835FreshwaterMGLLSTQGIEFQLVADGQILDLFKDEDILLSDNVTGLFDLG
JGI25908J49247_1005975623300003277Freshwater LakeMGVTSTQGFLFRLVANETQLDLFEDEDYLVSNNATGLFDIGVLPSD
JGI25908J49247_1008555123300003277Freshwater LakeMGQTSTQGFIFKLVANDVILDLFADEDIKLSDNVTGLFDLGVLPTDFTRQIQLPGTKKN
Ga0007787_1020235313300004240Freshwater LakeMAITTTQGFIFKLVANDIILDLFADEDILLSDNVTGLFDLGIVPADFTRQITLPGTKKNNAFFEHVYD
Ga0069718_1548907913300004481SedimentMGVLSTQGIEFQLVANDTILDLFKDEDILLSDNVTGLFDLGIIPADFTR
Ga0069001_1018103513300005215Natural And Restored WetlandsMGVQSTQGLSFRLVANDVALDLFKDEEIKVSDNVTGLFDIGELPSD
Ga0068876_1042135023300005527Freshwater LakeMGIISTQAFTFRLIANGQQLDTFDDEDIQLSNNVTGLFDLGVLPSDFTRQIT
Ga0049083_1004564833300005580Freshwater LenticMGVTSTQGFSFKLIANGDTQLDLFDDEEILVSDNITGLFDIGVLPADFTRQITVPGTK
Ga0079957_1012104103300005805LakeMGVLSTQGIEFQLVADGQILDLFKDEDILLSDNVTGLFDLGIIPADFTRQITLPGSKKNNAF
Ga0079957_107568943300005805LakeMGVLSTQGIQFQLVANGEILDLFKDEDILLSDNVTGLFDLGIIPADFTRQITLPGSKKNNAF
Ga0070749_1036162923300006802AqueousMGVLSTQGIQFQLIANDTILDLFKYEDILLSDNVTGLFDLGIIP
Ga0075464_1054569623300006805AqueousMGVISTQAFTFRLVADGQQLDLFEDEDIKLSNNVTGLFDIGQLPSDFTRQITLPGTK
Ga0075464_1100427613300006805AqueousMGVISTQGFQFRLLAGTPYQQLDLFKDEDIKLSNNVTGIFDIGVLPADFTRQITLP
Ga0070753_121601613300007346AqueousMGVVSTQGFNFKLVANGVTLDLFKDEVITISDNITGLFDVGTLPTDFTRQ
Ga0099851_108423023300007538AqueousMGVQSTQGRNFQLVAGDNVILDLFKDEEILLSDNVTGLFDLGKLPSDFTR
Ga0099848_118025313300007541AqueousMGTTSTQGFAFKLVANGVQLDLFADEEIFLSDNVTGLFDVGV
Ga0099846_106837423300007542AqueousMGVLSTQGISFQLVANDTILDLFQDEDILLSDNVTGLFDLGVIPADFTRQITLPGTKKNNAFFEH
Ga0099846_127289523300007542AqueousMGVISTQNITYRLIANEQQLDVFEDEDLKISNNVTGLFDIGVLPSDFTRQITLPGTK
Ga0099850_120396513300007960AqueousMGVQSTQGRNFQLVAGDNVILDLFKDEEILLSDNVTGLFDLGKLPSDFTRQI
Ga0114347_1000987283300008114Freshwater, PlanktonMGIISTQAFTFRLIANGQQLDTFDDEDIQLSNNVTGLFDLGVLPSDFTRQITLPGTKVNN
Ga0114351_103334113300008117Freshwater, PlanktonMAIVSTQGFIFKLVADGQILDLFADEEIKLSDNVTGLFDLGVLPSDFTRQ
Ga0114363_106864313300008266Freshwater, PlanktonMGIISTQGFVYRVIANGDTQLDLFEDEDIFLSDNVTGLFDLGVLPADFTRQITVPGTKKNNAFFEHVYDI
Ga0114364_116763913300008267Freshwater, PlanktonMGVISTQGFSFKLIANGDTQLDLFDDEEILVSDNVTGLFDIGVLPADFTRQITVPGTKVNNAFFEHV
Ga0114880_108484823300008450Freshwater LakeMGIISTQAFTFRLLAGDPSVQLDLFDDEDIQLSNNITGLFDVGVLPSDFTKQISIPGT
Ga0114880_119726813300008450Freshwater LakeMGLSSTQGLAFKLVANGEILDLFKDEQIFLSDNVT
Ga0102864_120345013300009051EstuarineMGITSTQGFKFKLMASGSYGTEQLDLFQDEEIKLSDNVTGLFDLGVLPADFTRQINLP
Ga0114973_1043167713300009068Freshwater LakeMGVISTQNITYRLIANGQQLDVFKDEDLKISNNVTGIFDIGVLPSDFTRQITLPGTKINNAF
Ga0114978_1017493113300009159Freshwater LakeMSIISTQAFTFRLVANGTQLDIFQDEDIKLSNNVTGLFDIGQLPSDFTRQITLPGTKVNNAFFEH
Ga0105102_1067471523300009165Freshwater SedimentMAITTTQGFVFKLVANDIILDLFADEDILLSDNVT
Ga0105104_1052314023300009168Freshwater SedimentMGLLSTQGLEFQLVANGLILDLFKDEDILLSDNVTGLFDLGVIPADFTR
Ga0114979_1009963613300009180Freshwater LakeMGIISTQGFVFKLIANGQQLDLFKDEQILLSDNVTGLFDLGILPADFTRQITIPGTKVNN
Ga0114969_1079937313300009181Freshwater LakeMGGVISQQGIEFQLVADGQILDLFTDEEIKLSDNVTGLFDLGVIPADFTRQITLPGTKKNNAF
Ga0129333_1163891923300010354Freshwater To Marine Saline GradientMGIISTQGFTFRLIANGTQLDLFADEDYLISNNVTGLFDVSVLPADFTRQI
(restricted) Ga0172365_1027660123300013127SedimentMGVVSTQGFLFRLIANDVQLDLFDDEDIFLSDNVTGLFDLGVLPSDFTRQITLPGTKKNNAFFEHV
(restricted) Ga0172366_1005312253300013128SedimentMGVISTQGFLFRLIANDVQLDLFDDEDIFLSDNVTGLFDLGVLPSDFTRQI
(restricted) Ga0172364_1079956023300013129SedimentMGILSTQGIEFQLVANDTILDLFKDEDILLSDNVTGLFDLGIIPADFTRQITL
(restricted) Ga0172363_1058676213300013130SedimentMGILSTQGIEFQLVANDTILDLFKDEDILLSNNVTGLFDLGIIPADFTRQIT
(restricted) Ga0172373_1008783113300013131FreshwaterMGVVSTQGFLFRLIANDVQLDLFDDEDIFLSDNVTGLFDLGVLPSDFTRQ
Ga0177922_1032211613300013372FreshwaterMGVTSTQGFSYKLVANGTQLDLFTDEDILVSDNVTGLFDIGVLPSDFTRQITVPGTKSNNAFFEHV
Ga0119960_103717323300014811AquaticMGIISTQAFTFRLIANGTQLDIFQDEDILISNNITGLFDIGVLPAEFTRQINLPGS*
Ga0181338_104514523300015050Freshwater LakeMGVVTTQGFVFKLVADGQILDLFADEEIKLSDNVTGLFDLGVLPTDFTRQINLPGSKKNNAFFEHCY
Ga0181364_101545313300017701Freshwater LakeMGQTSTQGFIFKLVANDVILDLFADEDIKLSDNVTGLFDLGVLPTD
Ga0181364_104039113300017701Freshwater LakeMGVTSTQGFLFRLVANETQLDLFEDEDYLVSNNATGLFDIGVLPSDYTRQITLPGTKVNNAFFEHCYDI
Ga0181363_105018033300017707Freshwater LakeMGIISTQAFTFRLVANGQQLDLFDDEDIQLSNNVTGLFDIGVLPSDFTRQITLPGT
Ga0181363_105178923300017707Freshwater LakeMGVISTQGFQFRLLAGTPSQQLDLFKDEDIKLSNNVTGLFDIGVLPADFTRQITLPGTKV
Ga0181362_100274313300017723Freshwater LakeMGVTSTQGFLFRLVANETQLDLFEDEDYLVSNNATGLFDI
Ga0181362_107492513300017723Freshwater LakeMGVTSTQGFLFRLVANETQLDLFEDEDYLVSNNATGLFDVGVLPSDYTRQ
Ga0187217_122465813300017770SeawaterMGVVSTQGLSFQLVANDVTLDLFKDEEIKVSDNITGLFDIGDLPSDF
Ga0181358_104831433300017774Freshwater LakeMGVLSTQGLEFQLVANGEILDLFKDEDILLSDNVTGLFDLGIIPADFTRQITL
Ga0181358_127622213300017774Freshwater LakeMGIVSTQAFTFRLVANGQQLDVFNDEDIKLSNNVTGLFDLGVLPSDFTRQ
Ga0181346_101995153300017780Freshwater LakeMGVTSTQGFLFRLVANETQLDLFEDEDYLVSNNATGLFDIGVLPSDYTRQITLPGT
Ga0181346_103590313300017780Freshwater LakeMGILSTQGIEFQLVAEGQILDLFKDEDILLSDNVTG
Ga0181346_123445213300017780Freshwater LakeMGILSTQGIQFQLVAEGQILDLFKDEDILLSDNVTGLFDLGIIPADF
Ga0181348_132980423300017784Freshwater LakeMGILSTQGIQFQLVAEGQILDLFKDEDILLSDNVTGLFDLGV
Ga0181355_138809323300017785Freshwater LakeMGVTSTQGFSYKLVANGTQLDLFTDEDILVSDNVTGLFDIGVLPSDFTRQITVPGTKSN
Ga0211734_1091891823300020159FreshwaterMGITSTQGFKFKLMASGSYGTEQLDLFQDEEIKLSDNVTGLFDLGVLPA
Ga0211726_1041440823300020161FreshwaterMGVISTQGIQFQLVANGEILDLFEDEDIKLSDNVTGLFDLGIIPADFT
Ga0211731_1019132423300020205FreshwaterMGVISTQGIEFQLVANGEILDLFQDEDIKLSDNVTGLFDLGIIPADFTRQITLPGTKKNNAFFEHVYD
Ga0208091_101628213300020506FreshwaterMGQTSTQGFVFKLVANDTILDLFADEDIKLSDNVTGLFDLGVLPTDFTRQI
Ga0208600_100102853300020550FreshwaterMGIISTQAFTFRLIANGTQLDIFDDEDIKLSNNVTGLFDIGVLPATFTRQISLPGT
Ga0194129_1043762323300020578Freshwater LakeMGLTTTQGFKFKLVANDEILDLYKDEEILLSNNVTGLFDLGILPSDFTRQITLPG
Ga0181598_110773923300020810Salt MarshMGVTSTQGLSFQLIANDITLDLFKDEEIKVSDNVTGLFDIGELPSEFSRTITLPGTKKNNAFF
Ga0213920_103316723300021438FreshwaterMGVISTQGIKFNLVANGTILDLFQDEQIKLSDNVTGLFDLGIVPADFTRQITLPG
Ga0213922_101826313300021956FreshwaterMGVISTQGIKFNLVANGTILDLFQDEQIKLSDNVTGLFDLGIVPADFTRQITL
Ga0222712_1057955323300021963Estuarine WaterMGVISTQGFVFRLLAGTPYEQLDLFADEDIKLSNNVAGIFDIGVLPADFTR
Ga0212026_104748413300022069AqueousMGVQSTQGRNFQLVAGDNVILDLFKDEDILLSDNVTGLFDLGK
Ga0212028_100390933300022071AqueousMGVQSTQGRNFQLVAGDNVILDLFKDEDILLSDNVTGLFDLGKLPSDFTRQITLPGTKKNNA
Ga0181354_107904523300022190Freshwater LakeMGQTSTQGFIFKLVANDVILDLFADEDIKLSDNVTGLFDLGVLPTDFTRQIQLPGT
Ga0181354_108784423300022190Freshwater LakeMGVLSTQGLEFQLVANGEILDLFKDEDILLSDNVTGLFDLGIIPADFTRQITLPGTKKNNAFFEHVYDIS
Ga0181351_111110823300022407Freshwater LakeMGVTSTQGFLFRLVANETQLDLFEDEDYLVSNNATGLFDIGVLPSDY
Ga0181351_123257523300022407Freshwater LakeMGVTSTQGFLFRLVANETQLDLFEDEDYLVSNNATGLFDVGVL
Ga0255779_117419113300022922Salt MarshMGVNSSKSFTFRIVANGVQLDTFKDETVTISNNVTGLFDLGVLPSDFTRQILVPGTKKNNAF
Ga0255783_1023286313300022923Salt MarshMGVNSSKSFTFRIVANGVQLDTFKDETVTISNNVTGLFDLGVLPSDFTRQILVPGTKKNNAFF
Ga0255183_108121823300024515FreshwaterMGVISTQGFSFKLIANGTQLDLFDDEEIFVSDNVTGLFDVGVLPADFTR
Ga0209555_1016396723300025879MarineMGVTSTQGLSFQLVANGITLDLFKDEEIKVSDNVTGLFDI
Ga0208951_106517423300027621Freshwater LenticMGVTSTQGFSFKLIANGDTQLDLFDDEEILVSDNITGLFDIGVLPADFTRQITVPGTKV
Ga0208960_111261313300027649Freshwater LenticMGVISTQGIKFQLVANDTILDLFKDEDIKLSNNVTGLFDLGVIPADFTRQIT
Ga0208975_116800913300027659Freshwater LenticMGIISTQAFTFRLIANGQQLDLFEDEDIQLSNNVTGLFDIGVLPSDFTRQITLPGTKVNNAFFEH
Ga0209443_104313133300027707Freshwater LakeMGGIISTQAFTFRLVADGTQLDIFDDEDIKLSNNVTGLFDIGQLPSDFTRQISLPGTKVNNAFFE
Ga0209443_117083113300027707Freshwater LakeMGQTSTQGFIFKLVANDVILDLFADEDIKLSDNVTGLFDLGVLPTDFTRQIQLPGTKKNNAFFEHVYDIS
Ga0209087_106558713300027734Freshwater LakeMAGVISTQGFQFKLIADGVQLDLFADEDIKLSNNVTGLFDVGVLPADFTRQLTVPGTKKNNAFFEH
Ga0209134_1021947823300027764Freshwater LakeMGVISTQSFTFRLVANGQQLDLFADEDIKLSNNVTGLFDIGVLPSDFTRQITL
Ga0209768_1022223813300027772Freshwater LakeMGQTSTQGFIFKLVANDVILDLFADEDIKLSDNVTGLFDLGVLPTDF
Ga0209768_1022579823300027772Freshwater LakeMGVTSTQGFSFKLIANGDTQLDLFDDEEILVSDNITGLFDIGVLPAD
Ga0209768_1043192613300027772Freshwater LakeMGIISTQAFTFRLVADGTQLDIFDDEDIKLSNNVTGLFDIGQLPSEFTRQITLPGTKVNNAFF
Ga0209246_1002362713300027785Freshwater LakeMGVTSTQGFLFRLVANETQLDLFEDEDYLVSNNATGLFDVGVLPSDYTRQITLPGTKINNAFFEH
Ga0209246_1019848623300027785Freshwater LakeMGQTSTQGFIFKLVANDVILDLFADEDIKLSDNVTGLFDLGVLPTDFTRQIQLP
Ga0209353_1019248123300027798Freshwater LakeMGVISTQSFRFRLVANGQQLDTFKDEDIKLSNNVTGLFDLGILPSDFTRQI
Ga0209358_1001062513300027804Freshwater LakeMGIISTQSFTFRLIADGQQLDLFEDEDIQLSNNVTGLFDIGVLPSDFTRQITLLG
Ga0209358_1050184813300027804Freshwater LakeMGVISTQGFAFKLIANGTQLDLFDDEEIFVSDNVTGLFDIGVLPADFTRQITVPGTKKNNAFF
Ga0209354_1043453823300027808Freshwater LakeMGVTSTQGFKFKLVADGQQLDLFKDEEIKLSDNVTGLFDLGVLPADFTR
Ga0209990_1026411013300027816Freshwater LakeMGIISTQGFTFRLIANGQQLDLFDDEDIQLSNNVTGLFDIGVLPSNFTRQITLPGTKVNN
Ga0209253_1065863513300027900Freshwater Lake SedimentMGVTSTQGFKFRLIANGTQLDLFDDEEIFVSNNVTGLFDLGVLPSDF
Ga0135212_103425423300029306Marine HarborMGILSTQGIEFQLVAIDTILDLFKDEDILLSDNVTGLFDLGVIPADFTLQIVTGK
Ga0135224_102783013300029753Marine HarborMGILSTQGIEFQLVANDTILDLFKDEDILLSDNVTGLFKIVTGKQNQIK
Ga0307378_1005814963300031566SoilMGVVSSQGLSYRLVANGLQLDLFKDEEIKVSDNITGLFDIGTLPADFTRQITL
Ga0307997_1005817223300031706MarineMGITSTQGLAFQLVANGQTLDLFKDEEIKISDNVTGLFDIGEL
Ga0315293_1025693033300031746SedimentMGVISTQGIEFQLVANGEILDLFQDEDIKLSDNVT
Ga0315293_1065031223300031746SedimentMGIISTQGFVFKLIANGQQLDLFKDEQILLSDNVTGLFDLGILPAD
Ga0315293_1086955223300031746SedimentMGGVISQQGIEFQLVADGEILDLFTDEEIKLSDNVTGLFDLGVIPADFT
Ga0315288_1154793513300031772SedimentMGGVISQQGIEFQLVANGEILDLFADEEIKLSDNVTGLFDLG
Ga0315285_1089389413300031885SedimentMGITSTQGFVYKLIANGEQLDVFDDEEILLSDNVTGLFDLGV
Ga0315294_1031105133300031952SedimentMGIISTQGFQFRLLAGTPSQQLDLFKDEDIKLSNNVTGIFDIGVLPADFSRTLTLPGTKVNNAFFEHVYDI
Ga0315274_1039200313300031999SedimentMGIISTQGFQFRLLAGTPSQQLDLFKDEDIKLSNNVTGLFDIGVLPADFTRQMSLPGTKVNNAFFEHVY
Ga0315274_1092215413300031999SedimentMGVVSQQGINYQLVADGQILDLFNDEDIKLSDNVTG
Ga0315274_1094473613300031999SedimentMGGVISQQGIEFQLVANGEILDLFADEEIKLSDNVTGLFDLGIIPADFTRQITLPGTKKNNAFFEHV
Ga0315275_1217464123300032401SedimentMGVISTQGIEFQLVANGEILDLFQDEDIKLSDNVTGLFDLGI
Ga0315275_1268951623300032401SedimentMGIISTQGFVCRLIANGQQLDLFKDEEILLSDNVTGLFDLGILPSDFTRQIT
Ga0334982_0334002_540_7043300033981FreshwaterMGVISTQGIQFQLVANGEILDLFEDEDIKLSDNVTGLFDLGIIPADFTRQITLPG
Ga0334992_0039488_2577_27533300033992FreshwaterMGLVTTQGVKFQLVANNVILDLFEDEQILLSDNVTGLFDLGLIPADFTRQINLPGSKKN
Ga0334979_0711490_2_1243300033996FreshwaterMGVLSTQGIQFQLVADGQILDLFKDEDILLSDNVTGLFDLG
Ga0334991_0306485_482_6403300034013FreshwaterMGVISTQGFAFRLIANNETQLDLFDDEEIKISDNVTGLFDLGVLPADFTRQIT
Ga0334987_0115899_1876_20283300034061FreshwaterMGVISTQGIEFQLVANGEILDLFQDEDIKLSDNVTGLFDLGVIPADFTRQI
Ga0334987_0637525_456_6203300034061FreshwaterMGLVTTQGVKFQLVANNVILDLFEDEQILLSDNVTGLFDLGLIPADFTRQINLPG
Ga0334995_0016934_6458_66193300034062FreshwaterMGVVTTQGFIFKLVANGEILDLFADEEIKLSDNVTGLFDLGVIPADFTRQISLP
Ga0334995_0308097_1_1653300034062FreshwaterMGVISTQGIEFQLVANGEILDLFQDEDIKLSDNVTGLFDLGVIPADFTRQITLPG
Ga0335000_0428280_635_7783300034063FreshwaterMGVISTQGIEFQLVANGEILDLFTDEDIKLSDNVTGLFDLGIIPADFT
Ga0335020_0429629_442_6333300034082FreshwaterMGVTSTQGFKFKLVANGETLDIFKDEDITLSDNVTGLFDLGVLPADFTRQISLPGTKKNNAFFE
Ga0335010_0424140_573_7193300034092FreshwaterMGQTSTQGFIFKLVANDVILDLFADEEIKLSDNVTGLFDLGVLPTDFTR
Ga0335022_0586769_12_1613300034095FreshwaterMGVISTQGIQFQLVANGEILDLFEDEDIKLSDNVTGLFDLGVIPADFTR
Ga0335027_0138731_1609_18003300034101FreshwaterMGVISTQGIQFQLVANGQILDLFEDEDIKLSDNVTGLFDLGVIPADFTRQITLPGTKKNNAFFE
Ga0335027_0367021_822_9443300034101FreshwaterMGITTTQGFVFKLVANGEILDLFADEEIKLSDNVTGLFDLG
Ga0335027_0466144_689_7993300034101FreshwaterMGVTSTQGFNFKLVANGEILDIFKDEEILLSDNVTGL
Ga0335031_0305432_3_1943300034104FreshwaterMGIISTQSFTFRLLAGDPSVQLDIFEDEDIQLSNNITGLFDVGILPSDFTKQISLPGTKVNNAF
Ga0335031_0578655_3_1703300034104FreshwaterMGVTSTQGFNFKLVANGEILDIFKDEEILLSDNVTGLFDLGVLPADFTRQISLPGT
Ga0335031_0622725_468_6323300034104FreshwaterMGVISTQGFQFRLLAGTPYQQLDLFKDEDIKLSNNVTGIFDIGVLPADFTRQITL
Ga0335036_0264032_967_11583300034106FreshwaterMGIISTQAFTFRLVADGTQLDLFDDEDIKLSNNVTGLFDIGQLPSDFTRQITIPGTKVNNAFFE
Ga0335050_0132582_1249_13833300034108FreshwaterMGLVTTQGVKFQLVANNVILDLFEDEQILLSDNVTGLFDLGLIPA
Ga0335066_0139584_1349_14893300034112FreshwaterMGLVTTQGVKFQLVANNVILDLFEDEQILLSDNVTGVFDLGLIPADF
Ga0335033_0071465_1936_20583300034117FreshwaterMGVISTQGIQFQLVANGEILDLFEDEDIKLSDNVTGLFDLG
Ga0335033_0443448_436_6303300034117FreshwaterMGVTSTQGFNFKLVANGEILDIFKDEEILLSDNVTGLFDLGVLPADFSRQISLPGTKKNNAFFEH
Ga0335054_0354195_644_8473300034119FreshwaterMGVISTQGFQFRLLAGTPSQQLDLFKDEDIKLSNNVTGIFDIGVLPADFTRTLTLPGTKVNNAFFEHV
Ga0335060_0251429_787_9843300034122FreshwaterMSIISTQAFTFRLVANGTQLDTFDDEDIQLSNNVTGLFDIGVLPSDFTRQITLPGTKVNNAFFEHV
Ga0335007_0116409_1_1473300034283FreshwaterMGVISTQGIEFQLVANGEILDLFQDEDIKLSDNVTGLFDLGVIPADFTR
Ga0335048_0597797_348_5123300034356FreshwaterMGVVTTQGFIFKLVANGEILDLFADEEIKLSDNVTGLFDLGVIPADFTRQISLPG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.