NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051276

Metagenome / Metatranscriptome Family F051276

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051276
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 44 residues
Representative Sequence VAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALA
Number of Associated Samples 119
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.44 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.36 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.250 % of family members)
Environment Ontology (ENVO) Unclassified
(30.556 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.139 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 40.30%    β-sheet: 0.00%    Coil/Unstructured: 59.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF01694Rhomboid 17.36
PF00368HMG-CoA_red 5.56
PF01872RibD_C 4.17
PF13193AMP-binding_C 4.17
PF00128Alpha-amylase 2.78
PF04264YceI 2.08
PF00436SSB 2.08
PF04075F420H2_quin_red 1.39
PF01425Amidase 1.39
PF13191AAA_16 0.69
PF00501AMP-binding 0.69
PF02775TPP_enzyme_C 0.69
PF09084NMT1 0.69
PF02880PGM_PMM_III 0.69
PF04069OpuAC 0.69
PF00113Enolase_C 0.69
PF11941DUF3459 0.69
PF13361UvrD_C 0.69
PF00408PGM_PMM_IV 0.69
PF04012PspA_IM30 0.69
PF12911OppC_N 0.69
PF00857Isochorismatase 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 17.36
COG1257Hydroxymethylglutaryl-CoA reductaseLipid transport and metabolism [I] 5.56
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 4.17
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 4.17
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 2.78
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 2.78
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 2.78
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 2.78
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 2.08
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 2.08
COG2965Primosomal replication protein NReplication, recombination and repair [L] 2.08
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 1.39
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.39
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 1.39
COG1842Phage shock protein ATranscription [K] 1.39
COG0148EnolaseCarbohydrate transport and metabolism [G] 0.69
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.69
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.69
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.69
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.89 %
UnclassifiedrootN/A36.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003505|JGIcombinedJ51221_10141263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia970Open in IMG/M
3300005180|Ga0066685_10816875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300005181|Ga0066678_10824138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300005436|Ga0070713_102115419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300005437|Ga0070710_10039879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2585Open in IMG/M
3300005529|Ga0070741_10442016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1187Open in IMG/M
3300005541|Ga0070733_10286189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1088Open in IMG/M
3300005564|Ga0070664_100665243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia968Open in IMG/M
3300005602|Ga0070762_10805719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia636Open in IMG/M
3300006028|Ga0070717_11889976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300006050|Ga0075028_100992012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300006057|Ga0075026_100473300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia717Open in IMG/M
3300006176|Ga0070765_102222686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300006574|Ga0074056_11674293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia806Open in IMG/M
3300006797|Ga0066659_10941639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300006806|Ga0079220_11904166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300006954|Ga0079219_10835323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300009520|Ga0116214_1382655Not Available548Open in IMG/M
3300009522|Ga0116218_1303963All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300009525|Ga0116220_10169766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces940Open in IMG/M
3300010361|Ga0126378_12828267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300010376|Ga0126381_104293148Not Available552Open in IMG/M
3300010880|Ga0126350_12368491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia639Open in IMG/M
3300011085|Ga0138581_1087536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1790Open in IMG/M
3300012357|Ga0137384_10425706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella shujinwangii1094Open in IMG/M
3300012362|Ga0137361_10458147All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1171Open in IMG/M
3300013307|Ga0157372_11862071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella shujinwangii692Open in IMG/M
3300016294|Ga0182041_12045549Not Available534Open in IMG/M
3300016341|Ga0182035_12008766All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300016422|Ga0182039_11034037Not Available738Open in IMG/M
3300017821|Ga0187812_1247112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300017823|Ga0187818_10031205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2286Open in IMG/M
3300017928|Ga0187806_1088459Not Available979Open in IMG/M
3300017928|Ga0187806_1251115Not Available612Open in IMG/M
3300017932|Ga0187814_10086931Not Available1149Open in IMG/M
3300017932|Ga0187814_10257212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300017932|Ga0187814_10303469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia611Open in IMG/M
3300017932|Ga0187814_10383569All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300017932|Ga0187814_10404570Not Available532Open in IMG/M
3300017942|Ga0187808_10003457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5824Open in IMG/M
3300017955|Ga0187817_10546090Not Available739Open in IMG/M
3300017972|Ga0187781_10314857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1111Open in IMG/M
3300017972|Ga0187781_11174566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300017973|Ga0187780_11162928Not Available565Open in IMG/M
3300018001|Ga0187815_10071709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1456Open in IMG/M
3300018001|Ga0187815_10197847All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium851Open in IMG/M
3300018001|Ga0187815_10360148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300018007|Ga0187805_10322921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300018007|Ga0187805_10485318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300018085|Ga0187772_11109389Not Available580Open in IMG/M
3300018090|Ga0187770_10108194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2083Open in IMG/M
3300018090|Ga0187770_10251867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1368Open in IMG/M
3300020582|Ga0210395_10055131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2912Open in IMG/M
3300020583|Ga0210401_10085403All Organisms → cellular organisms → Bacteria2970Open in IMG/M
3300021403|Ga0210397_10650496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia808Open in IMG/M
3300021404|Ga0210389_10262905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1350Open in IMG/M
3300021405|Ga0210387_11335888Not Available618Open in IMG/M
3300021407|Ga0210383_10574305Not Available972Open in IMG/M
3300021407|Ga0210383_11663966Not Available523Open in IMG/M
3300021474|Ga0210390_11162618Not Available624Open in IMG/M
3300024225|Ga0224572_1041618Not Available864Open in IMG/M
3300025906|Ga0207699_10334261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1066Open in IMG/M
3300025945|Ga0207679_11843151All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300026078|Ga0207702_10760584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia957Open in IMG/M
3300026318|Ga0209471_1148206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella shujinwangii972Open in IMG/M
3300027047|Ga0208730_1011118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia968Open in IMG/M
3300027297|Ga0208241_1010605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1292Open in IMG/M
3300027505|Ga0209218_1060011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300027568|Ga0208042_1005079Not Available3720Open in IMG/M
3300027767|Ga0209655_10261374All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda563Open in IMG/M
3300027775|Ga0209177_10460954All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300027826|Ga0209060_10062089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1782Open in IMG/M
3300027867|Ga0209167_10118916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1366Open in IMG/M
3300027894|Ga0209068_10670057Not Available607Open in IMG/M
3300027895|Ga0209624_10577027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia747Open in IMG/M
3300027908|Ga0209006_11485343Not Available514Open in IMG/M
3300027911|Ga0209698_11432166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → unclassified Mycolicibacterium → Mycolicibacterium sp. CBMA 361502Open in IMG/M
3300028047|Ga0209526_10360738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella shujinwangii972Open in IMG/M
3300028047|Ga0209526_10823070Not Available573Open in IMG/M
3300028720|Ga0307317_10157898All Organisms → cellular organisms → Bacteria → Terrabacteria group762Open in IMG/M
3300028801|Ga0302226_10365057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300028877|Ga0302235_10006020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8001Open in IMG/M
3300028906|Ga0308309_10208932Not Available1613Open in IMG/M
3300028906|Ga0308309_11242722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300029882|Ga0311368_10578818Not Available794Open in IMG/M
3300029882|Ga0311368_10683411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia712Open in IMG/M
3300029910|Ga0311369_10885062Not Available714Open in IMG/M
3300029993|Ga0302304_10211708Not Available718Open in IMG/M
3300029997|Ga0302302_1223764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia701Open in IMG/M
3300030007|Ga0311338_10594703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1139Open in IMG/M
3300030053|Ga0302177_10593127Not Available566Open in IMG/M
3300030494|Ga0310037_10066448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces olivochromogenes1700Open in IMG/M
3300030509|Ga0302183_10037941All Organisms → cellular organisms → Bacteria1937Open in IMG/M
3300030520|Ga0311372_10141886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4192Open in IMG/M
3300030707|Ga0310038_10176713All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300031236|Ga0302324_102375185All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300031544|Ga0318534_10524495Not Available676Open in IMG/M
3300031546|Ga0318538_10668208Not Available564Open in IMG/M
3300031682|Ga0318560_10329672Not Available824Open in IMG/M
3300031713|Ga0318496_10193648Not Available1116Open in IMG/M
3300031720|Ga0307469_10548649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1023Open in IMG/M
3300031747|Ga0318502_10102994Not Available1585Open in IMG/M
3300031747|Ga0318502_10129955Not Available1422Open in IMG/M
3300031748|Ga0318492_10403795Not Available719Open in IMG/M
3300031751|Ga0318494_10734084Not Available578Open in IMG/M
3300031764|Ga0318535_10224979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia840Open in IMG/M
3300031764|Ga0318535_10558186Not Available508Open in IMG/M
3300031765|Ga0318554_10300455All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300031768|Ga0318509_10253433Not Available983Open in IMG/M
3300031769|Ga0318526_10438080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia534Open in IMG/M
3300031779|Ga0318566_10435027Not Available644Open in IMG/M
3300031779|Ga0318566_10469043Not Available618Open in IMG/M
3300031782|Ga0318552_10705889Not Available514Open in IMG/M
3300031819|Ga0318568_10936752Not Available535Open in IMG/M
3300031831|Ga0318564_10083469Not Available1413Open in IMG/M
3300031846|Ga0318512_10130451All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300031860|Ga0318495_10124289Not Available1163Open in IMG/M
3300031860|Ga0318495_10310795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia701Open in IMG/M
3300031910|Ga0306923_10677834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1150Open in IMG/M
3300031941|Ga0310912_10837074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia710Open in IMG/M
3300031945|Ga0310913_10127812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1740Open in IMG/M
3300031954|Ga0306926_12357500Not Available588Open in IMG/M
3300031962|Ga0307479_11191175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia726Open in IMG/M
3300032001|Ga0306922_10884043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia929Open in IMG/M
3300032001|Ga0306922_12229694Not Available527Open in IMG/M
3300032009|Ga0318563_10448813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca697Open in IMG/M
3300032010|Ga0318569_10068812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941563Open in IMG/M
3300032025|Ga0318507_10159344Not Available967Open in IMG/M
3300032043|Ga0318556_10109971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1401Open in IMG/M
3300032043|Ga0318556_10186549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1077Open in IMG/M
3300032043|Ga0318556_10723938Not Available517Open in IMG/M
3300032044|Ga0318558_10150366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1120Open in IMG/M
3300032054|Ga0318570_10449294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M
3300032068|Ga0318553_10134122Not Available1277Open in IMG/M
3300032068|Ga0318553_10450181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia674Open in IMG/M
3300032068|Ga0318553_10604866Not Available574Open in IMG/M
3300032089|Ga0318525_10246888Not Available917Open in IMG/M
3300032089|Ga0318525_10260551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia891Open in IMG/M
3300032160|Ga0311301_10124834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4823Open in IMG/M
3300032160|Ga0311301_12643469Not Available555Open in IMG/M
3300032782|Ga0335082_10544858Not Available1022Open in IMG/M
3300032897|Ga0335071_11489779Not Available621Open in IMG/M
3300033134|Ga0335073_10036158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6732Open in IMG/M
3300033290|Ga0318519_11000947Not Available519Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.25%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment11.11%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.33%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.25%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.17%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.08%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.08%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.39%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.39%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.39%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.69%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.69%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.69%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011085Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ51221_1014126323300003505Forest SoilVAAVVFGPDAARRGPRGPRGSRGRTALVLGAGGVLGAAWMTGALA
Ga0066685_1081687523300005180SoilVPAVVFGPDRVIGRGRPRTGLVLGAGGVLGAAWMTGALVRLHERLP
Ga0066678_1082413813300005181SoilVPAVVFGPDRVIGRGRPRTGLVLGAGGVLGAAWMTGALVRLH
Ga0070713_10211541923300005436Corn, Switchgrass And Miscanthus RhizosphereVPTVVFGPDRVIGRRRPRTALVLGAGGVLGAAWMTGALVRLHERLPAADVDL
Ga0070710_1003987933300005437Corn, Switchgrass And Miscanthus RhizosphereVPAVVFAADRAVRSSHRKIGLVLGAGGVLGAAWMTGALVRLQELL
Ga0070741_1044201633300005529Surface SoilVSAVVFGDERPRRGSHPRTALVLGAGGVLGAAWMTG
Ga0070733_1028618913300005541Surface SoilVAAVAFGPDLERHRSRSRTGLILGAGGVLGAAWMTGALACLQDRL
Ga0070664_10066524313300005564Corn RhizosphereVPAVVFAPDRAVHRSHRTIGLVLGAGGVLGAAWMTGALVRLQERLPG
Ga0070762_1080571923300005602SoilVAAVVFGPGRADRGSSGRTALVLGAGGVLGAAWMTGALTCLHDRLPC
Ga0070717_1188997623300006028Corn, Switchgrass And Miscanthus RhizosphereVPAVVFGPDRAVRRFRPRVGLVLGAGGVLGAAWMTGAL
Ga0075028_10099201223300006050WatershedsVPAVVFGPDRVIGRGRPRTALVLGAGGVLGAAWMT
Ga0075026_10047330023300006057WatershedsVPTVVFGPDRVIGHRRPRTALVLGAGGVLGAAWMTGA
Ga0070765_10222268613300006176SoilVAAVVFGPDRVPHRSHRSSRTTALVLGAGGVLGAAWMTGALVRLGE
Ga0074056_1167429313300006574SoilLVAEANVPAVVFGPDRVIGHGRPRTALVLGAGGVLGAAWMTG
Ga0066659_1094163923300006797SoilVPTVVFGLDRVIGRRRPRTALVLGAGGVLGAAWMTGALVRLHERLPA
Ga0079220_1190416613300006806Agricultural SoilVPTVVFGPDRVTGRRRPRTALVLGAGGVLGAAWMTGALVRLHERLPAA
Ga0079219_1083532313300006954Agricultural SoilVPAVVFAPDRAVHRSQRTIGLVLGAGGVLGAAWMTGA
Ga0116214_138265523300009520Peatlands SoilMVTEVVVGVVVFSPDRATRGSRRRTALVLGAGGVLGAAWMTGALACL
Ga0116218_130396313300009522Peatlands SoilVVFDPDLAIRLSRPRIGLVLGAGGVLGAAWMTGAVARLQDRLP
Ga0116220_1016976613300009525Peatlands SoilMVTEVVVGVVVFSPDRATRGSRRRTALVLGAGGVLGAAWMTGALACLQDRLPCAAGDV
Ga0126378_1282826713300010361Tropical Forest SoilVVVAVVVFGPDRGRHQTRPRTGLVLGVGGVLGAAWMTGALAYLQDR
Ga0126381_10429314823300010376Tropical Forest SoilVVFGPDRVIRRERSRVGLVLGAGGVLGAAWMTGALTCLQERFPV
Ga0126350_1236849113300010880Boreal Forest SoilMVAEVPVAAVVFGADRVPRPSRRSAGGTALVLGAGGVLGAAWMTGALARLAERLPGPVS
Ga0138581_108753613300011085Peatlands SoilVVFGPDLAIRPSHPRIGLVLGVGGVLGAAWITGAMA
Ga0137384_1042570633300012357Vadose Zone SoilVPAVVFGPDRVIGRGRPRTALVLSAGGVLGAAWMTGALVRLHERL
Ga0137361_1045814713300012362Vadose Zone SoilVVFGPDRAILRSGPGNTANPANPRIGLVLGAGGVLGA
Ga0157372_1186207113300013307Corn RhizosphereVVFGPDRVIGRRRPRTALVLGAGGVLGAAWMTGAL
Ga0182041_1204554923300016294SoilVIAEVAVAAVVFGPDRVGHGSSRRTALVLGAGGVLGAAWMTGALARLQDRLPCAAGDV
Ga0182035_1200876623300016341SoilMAAVVFGPDRAGRDSGCRTALVLGAGGVLGVAWMTGALACLQARLPGPAG
Ga0182039_1103403723300016422SoilVPAVVFGPDRVIRRERAKTGLVLGAGGVLGAAWMTGALACL
Ga0187812_124711213300017821Freshwater SedimentVAAVAFGPGRGRHRSRPRTGLVLGAGGVLGAAWMTGALA
Ga0187818_1003120513300017823Freshwater SedimentVSAVVFGPDLAIRPSHPRIGLVLGAGGVLGAAWMTGALACLQ
Ga0187806_108845913300017928Freshwater SedimentVAVVVFSPDRATHGSRRRTGLVLGAGGVLGAAWMTGALACL
Ga0187806_125111513300017928Freshwater SedimentMVAEVAVAAVVFGPDRARHGSRRRTALVLGAGGVLGAAWMTGALAALADRLP
Ga0187814_1008693123300017932Freshwater SedimentMVTEVVVGVVVFSPDRATRGSRRRTALVLGAGGVLGA
Ga0187814_1025721223300017932Freshwater SedimentVAAVVFGADVAHRWPRRRTALVLGAGGVVGAAWMTGALASLADRLPCAP
Ga0187814_1030346913300017932Freshwater SedimentVAAVVFGPQRAERQLSPRIGLVLGAGGVLGAAWMTAALACLQDRLPV
Ga0187814_1038356913300017932Freshwater SedimentVSAVVFGPDLAIRPSRPRIGLVLGAGGVLGAAWMTGAL
Ga0187814_1040457013300017932Freshwater SedimentVAAVVFGPDRAGHGAHRRTALVLGAGGVLGAAWMTGALARLQDRLPCP
Ga0187808_1000345773300017942Freshwater SedimentVAVVVFNPDRAIHSSRRRTGLVLGAGGVLGAAWMTGALA
Ga0187817_1054609013300017955Freshwater SedimentMVTEVVVGVVVFSPDRATHSSRRRTALVLGAGGVLGAAWMTGALACLQDRLPCA
Ga0187781_1031485733300017972Tropical PeatlandVAAVVFGPDRGRHLPRARTGLVLGAGGVLGAAWMTGAL
Ga0187781_1117456613300017972Tropical PeatlandVAAVVFGPDRAGHGPGRRTALVLGAGGVLGAAWMTGAL
Ga0187780_1116292813300017973Tropical PeatlandVAAVVFSPDRASRRSRRRTGLVLGAGGVLGAAWMTGALA
Ga0187815_1007170933300018001Freshwater SedimentMVAEVAVAAVVFGPDRARHGSRRRTALVLGAGGVLG
Ga0187815_1019784713300018001Freshwater SedimentVAVVVFNPDRAIHSSRRRTGLVLGAGGVLGAAWMTGALACLQDRLPCAAGDV
Ga0187815_1036014823300018001Freshwater SedimentVAAVVFGADVAHHWSRRRTALVLGAGGVVGAAWMTGALAS
Ga0187805_1032292113300018007Freshwater SedimentVSAVVFGPDLAIRPSRPRIGLVLGAGGVLGAAWMTGALACLQDR
Ga0187805_1048531823300018007Freshwater SedimentVAAVVFGADVAHHWSRRRTALVLGAGGVVGAAWMTGALASLADRLPCA
Ga0187772_1110938913300018085Tropical PeatlandVAAVVFSPDRASRRSRRRTGLVLGAGGLLGAAWMT
Ga0187770_1010819413300018090Tropical PeatlandVAAVVFGLDRADHGAHRRTALVLGAGGVLGAAWMTGALARLQDRLP
Ga0187770_1025186713300018090Tropical PeatlandVAAVVFGPDRARHGFRHGASGPMALVLGAGGVLGAAWMTGALAC
Ga0210395_1005513113300020582SoilMVAEVAVAAVVFGPDRVPGRSHRSSRTTALVLGAGGGL
Ga0210401_1008540313300020583SoilMVAEVAVAAVVFGPDRAPRRSRRSSGTTALVLGAGGVLGAAWMTGALVRLAERLPGPVSDVD
Ga0210397_1065049623300021403SoilMVAEVAVAAVVFGPDRARPGSGGSSRRTALVLGAGGVLGAA
Ga0210389_1026290513300021404SoilMVAEVAVAAVVFGPDRARRGGTGLVLGAGGVLGAAWMTGALAGLSDRLPCAAADV
Ga0210387_1133588813300021405SoilMRGWVAEADVSAVVFGPDQAIRHSNPRIGLVLGAGGVLGAAW
Ga0210383_1057430513300021407SoilVSAVVFGPDLPARRFHPSPRIGLVLGAGGVLGAPWMTGALARLQDRLPGT
Ga0210383_1166396613300021407SoilVAAVVFGPEWTGHGFRRRTGLVLGAGGVLGAAWMTGALA
Ga0210390_1116261813300021474SoilVSAVVFGPDLPARRFHPSPRIGLVLGAGGVLGAAWMTGALARLQDRLPGTAA
Ga0224572_104161813300024225RhizosphereVSAVVFGPDLPARRSHPSPRIGLVFGAGGVLGAAWMTGALARLQDRLPGTAADV
Ga0207699_1033426113300025906Corn, Switchgrass And Miscanthus RhizosphereVPAVVFAPDRARRSPRPRVALVLGAGGVLGAAWMTGALVRLQELL
Ga0207679_1184315113300025945Corn RhizosphereVPAVVFAADRAARSSHRKIGLVLGAGGVLGAAWMTGALVRLQERLPGPAA
Ga0207702_1076058423300026078Corn RhizosphereVPAVVFAPDRAVHRSHRTIGLVLGAGGVLGAAWMTGALVRLQERLPGPV
Ga0209471_114820613300026318SoilVPTVVFGLDRVIGRRRPRTALVLGAGGVLGAAWMTGALVRLHER
Ga0208730_101111813300027047Forest SoilMVAEVAVAAVVFGPDRARRGRTGLVLGAGGVLGAAWMTGALAGLSDRL
Ga0208241_101060533300027297Forest SoilMVAEVSVAAVVFGPDRARRGGTGLVLGAGGVLGAAWMTGVLAG
Ga0209218_106001123300027505Forest SoilMVAEVPVAAVVFGPDRTRHRSAGRTALVLGAGGVLGAAWMTGTLARL
Ga0208042_100507913300027568Peatlands SoilVAAVVFGADVAHRWSRRRTALVLGAGGVVGAAWMTGALASLADRLPCALGDVD
Ga0209655_1026137423300027767Bog Forest SoilMVAEVPVAAVVFGSDRTRHRSAGRTALVLGAGGVLGAA
Ga0209177_1046095423300027775Agricultural SoilVPAVVFAADRAARSSHRKIGLVLGAGGVLGAAWMT
Ga0209060_1006208933300027826Surface SoilMVAEVAVAAVVFGPDRVHSRGPVALVLGAGGVLGAAWMT
Ga0209167_1011891613300027867Surface SoilLAAVVFGPDRAGHGSGRRTGLVLGAGGVLGAAWMTGAL
Ga0209068_1067005723300027894WatershedsVSAVVFGPDRAIRHHLNPRIGLVLGAGGVLGAAWM
Ga0209624_1057702713300027895Forest SoilMVAEVPVAAVVFGPDRTRHRSAGRTALVLGAGGVLGAAWMTGAL
Ga0209006_1148534313300027908Forest SoilMVAEVPVAAVVFGPDRTRHRSAGRTALVLGAGGVLGAAWMT
Ga0209698_1143216613300027911WatershedsVSAVVFGPDQVLRRSNPGNPRIGLVLGAGGVLGAAWTTGA
Ga0209526_1036073813300028047Forest SoilVPTVVFGPDRVIGRRRPRTALVLGAGGVLGAAWMTGALVRLHERLPAAD
Ga0209526_1082307023300028047Forest SoilMVAEVPVAAVVFGPDRRRHRSAGRTALVLGAGGVLGAAWMTGAL
Ga0307317_1015789823300028720SoilVPAVVFGPDRVIGRGRPRTALVLGAGGVLGAAWMTGALVRLHER
Ga0302226_1036505723300028801PalsaMAVAAVVFSPDRATRSSRRRTGLVLGAGGLLGAAWMTGALACLQG
Ga0302235_1000602013300028877PalsaMAVAAVVFSPDRAIHSSRRRTGLVLGAGGLLGAAWMTGALACLQ
Ga0308309_1020893213300028906SoilVSAVVFGPDPAKRLSRPAGPHPRIGLVLGAGGVLGAAWMTG
Ga0308309_1124272223300028906SoilMVAEVAVAAVVFGPDRVPRSSRRSAGGTALVLGAGGVLGAAWMTGALARLAE
Ga0311368_1057881823300029882PalsaMAVAAVVFSPDRATRSSRRRTGLVLGAGGLLGAAWMTGALACL
Ga0311368_1068341123300029882PalsaMVAEVAVAAVVFGPDRARHRSRRIALVLGAGGVLGAAWMTGALA
Ga0311369_1088506223300029910PalsaVAAVVFSPGRATHSSRRRTGLVLGAGGLLGAAWMTGALACLQDRLPC
Ga0302304_1021170823300029993PalsaVAAVVFSPGRATHSSRRRTGLVLGAGGLLGAAWMTGALACLQGRLPCA
Ga0302302_122376413300029997PalsaMVAEVAVAAVVFGPDRARHRSRRIALVLGAGGVLGAAWMT
Ga0311338_1059470313300030007PalsaMAVAAVVFSPDRGTHSSRRRTGLVLGAGGLLGAAWMTGALACLQ
Ga0302177_1059312713300030053PalsaVAAVVFSPGRATHSSRRRTGLVLGAGGLLGAAWMTGAL
Ga0310037_1006644843300030494Peatlands SoilMVTEVVVGVVVFSPDRATRGSRRRTALVLGAGGVLGAAWMTG
Ga0302183_1003794143300030509PalsaVAAVVFSPDRAIHSSRRRTGLVLGAGGLLGAAWMTGTLACLQG
Ga0311372_1014188653300030520PalsaVAAVVFSPDRATHTSRRRTGLVLGAGGLLGAAWMTGALACLQGRLPC
Ga0310038_1017671313300030707Peatlands SoilVSAVVFGPDLAIRPSHPRIGLVLGAGGVLGAAWITGALARLQDRLPEAAAD
Ga0302324_10237518513300031236PalsaVAAVVFSPDRATRSSRRRTGLVLGAGGLLGAAWMTGALASLQGRLPCGA
Ga0318534_1052449523300031544SoilVPAVVFGPDRVIRHECAKIGLVLGAGGVLGAAWMT
Ga0318538_1066820823300031546SoilVPAVVFGPDRVIRRERPQVGLVLGAGGVLGAAWMTGALACLQERFPVADDE
Ga0318560_1032967213300031682SoilVPAVVFGPDRVIRHERSKVGLVLGAGGVLGAAWMTG
Ga0318496_1019364813300031713SoilVAVAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALACL
Ga0307469_1054864913300031720Hardwood Forest SoilMVAEVAVAAVVFGPDRVPRRSHRSAGTTALVLGAGGVLGAAWMTGALARLSERLPGPLSDVDL
Ga0318502_1010299423300031747SoilVPAVVFGPDRVIRHERAKVGLVLGAGGVLGAAWMTGAL
Ga0318502_1012995513300031747SoilVPAVVFGPDRVIRHERSKVGLVLGAGGVLGAAWMTGALACLQERLPVAD
Ga0318492_1040379523300031748SoilVPAVVFGPDLAAQRSRVGLVLGAGGVLGAAWMTGALAHLADRLP
Ga0318494_1073408423300031751SoilVPAVIFGPDRVIRRERAKTGLVLGAGGVLGAAWMTGALACLDER
Ga0318535_1022497923300031764SoilMVAEVAVAAVVFGPDRAGRDSGRRTALVLGAGGVLGVA
Ga0318535_1055818613300031764SoilVPAVVFGPDRVIRHERAKVGLVLGAGGVLGAAWMT
Ga0318554_1030045523300031765SoilVAAVVFGPDRAGRDSGRRTALVLGAGGVLGVAWMTG
Ga0318509_1025343323300031768SoilVPAVVFGPDRVIGPGRHRVGLVLGAGGILGAAWMTGALVRL
Ga0318526_1043808013300031769SoilVPAVVFRPDRPTRAPHPRIGLVLGAGGVLGAAWMTGALA
Ga0318566_1043502723300031779SoilVPAVVFGPDRVIRRGRAKTGLVLGAGGVLGAAWMTGALACLH
Ga0318566_1046904323300031779SoilVIAEVAVAAVVFGPDRVGHGSSRRTALVLGAGGVLGAAWMTGALARLQDWLPCAAGDVD
Ga0318552_1070588923300031782SoilVPAVVFGPDRVIRHERAKVGLVLGAGGVLGAAWMTGALACLQERL
Ga0318568_1093675213300031819SoilMAAEVAVAAVVFGPDRARYGSRRRTALVLGAGGVLGAAWMTGALAALADRLPC
Ga0318564_1008346913300031831SoilVPAVVFGPDRVIRHERAKVGLVLGAGGVLGAAWMTGALAC
Ga0318512_1013045123300031846SoilMAAVVFGPDRAGRDSGCRTALVLGAGGVLGAAWMTGALACLQ
Ga0318495_1012428913300031860SoilVPAVVFGPDRVIRRERAKTGLVLGAGGVLGAAWMTGALACLHERFPVADAD
Ga0318495_1031079513300031860SoilMVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVLGAAWMTGALASLADRLPCAAGRPGW
Ga0306923_1067783423300031910SoilVAAVVFGPDRVGHGSSRRTALVLGAGGVLGAAWMTGALARLQDWLPCAAGDVD
Ga0310912_1083707423300031941SoilMVAEVAVAAVVFGPDRARHSSGRRAGLVLGAGGVLGAAWMTGAL
Ga0310913_1012781233300031945SoilVAAVVFGPERARHSSRRRTGLVLGAGGVLGAAWMTGALASLADLLP
Ga0306926_1235750023300031954SoilMVAEVAVAAVVFGPDRARHSSRRAALVLGAGGVLGAA
Ga0307479_1119117513300031962Hardwood Forest SoilMVAEVAVAAVVFGPDRARPGSGGSSRRTALVLGAGGVLGAAWMTGAL
Ga0306922_1088404313300032001SoilMVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVL
Ga0306922_1222969413300032001SoilVPAVVFGPDRVIRHERSKVGLVLGAGGVLGAAWMTGALACLQERLP
Ga0318563_1044881323300032009SoilVAAVVFGPDGTGRAGRGSRTALVLGAGGVLGASWMTGALASLQDRLP
Ga0318569_1006881213300032010SoilVAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALA
Ga0318507_1015934413300032025SoilVAVAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALAC
Ga0318556_1010997133300032043SoilVAAVVFGPERARHGSRRRTGLVLGAGGVLGAAWMTGALASLADRLPCAAGDV
Ga0318556_1018654913300032043SoilMVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVLGAAWMTGALA
Ga0318556_1072393813300032043SoilVAAVVFGPERARHSSRRRTGLVLGAGGVLGAAWMTGALASLADLLPCAAS
Ga0318558_1015036613300032044SoilVAAVVFGPERARHSSRRRTGLVLGAGGVLGAAWMTGALA
Ga0318570_1044929413300032054SoilMVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVLGAAWMTGALASLADRL
Ga0318553_1013412213300032068SoilVAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALACLQDRLPSAAGDV
Ga0318553_1045018123300032068SoilMVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVLGAAWM
Ga0318553_1060486613300032068SoilVPAVVFGPDRVIRHERAKVGLVLGAGGVLGAAWMTG
Ga0318525_1024688813300032089SoilVAVAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALACLQDRLPCA
Ga0318525_1026055113300032089SoilMVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVLGAAWMTGALAS
Ga0311301_1012483413300032160Peatlands SoilVAAVVFGPQRAGRQLSPRIGLVLGAGGVLGAAWMTGA
Ga0311301_1264346923300032160Peatlands SoilVAAVTFTPDRARRRSDHRTGLVLGAGGVLGAAWMTGALACLQNRLPH
Ga0335082_1054485833300032782SoilVGRIAEADVPAVVFGPDRAIHRSKPRVGLVLGAGGFLGAAWTTGA
Ga0335071_1148977923300032897SoilVPAVVFGPDRVIRRERAKVGLVLGAGGVLGAAWMTGALVRLQERLPVADA
Ga0335073_1003615813300033134SoilVPAVVFTPDRAVRPSRRKIGLVLGAGGVLGAAWMTGALVRLEERL
Ga0318519_1100094723300033290SoilVPAVVFGPDRVIGPGRHRVGLVLGAGGILGAAWMTGALVRLQERLPAADAD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.