Basic Information | |
---|---|
Family ID | F051174 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 144 |
Average Sequence Length | 41 residues |
Representative Sequence | VEIVIVLTILILAGVLSVVGPDTHDYDVNDRRGWWPGRR |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 144 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 54.86 % |
% of genes near scaffold ends (potentially truncated) | 20.83 % |
% of genes from short scaffolds (< 2000 bps) | 86.81 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.972 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.806 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.111 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.833 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 0.00% Coil/Unstructured: 73.13% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 144 Family Scaffolds |
---|---|---|
PF00892 | EamA | 47.92 |
PF03466 | LysR_substrate | 24.31 |
PF00126 | HTH_1 | 16.67 |
PF01783 | Ribosomal_L32p | 2.08 |
PF02504 | FA_synthesis | 1.39 |
PF05656 | DUF805 | 1.39 |
PF00550 | PP-binding | 0.69 |
PF12850 | Metallophos_2 | 0.69 |
PF01336 | tRNA_anti-codon | 0.69 |
PF02463 | SMC_N | 0.69 |
PF02978 | SRP_SPB | 0.69 |
PF13882 | Bravo_FIGEY | 0.69 |
PF01467 | CTP_transf_like | 0.69 |
COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
---|---|---|---|
COG0333 | Ribosomal protein L32 | Translation, ribosomal structure and biogenesis [J] | 2.08 |
COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 1.39 |
COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 1.39 |
COG0541 | Signal recognition particle GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.97 % |
Unclassified | root | N/A | 34.03 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_102042402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1217 | Open in IMG/M |
3300000956|JGI10216J12902_105164008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2153 | Open in IMG/M |
3300000956|JGI10216J12902_105780533 | Not Available | 754 | Open in IMG/M |
3300000956|JGI10216J12902_108802267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1248 | Open in IMG/M |
3300000956|JGI10216J12902_114305722 | Not Available | 1112 | Open in IMG/M |
3300001538|A10PFW1_10051411 | Not Available | 1220 | Open in IMG/M |
3300003990|Ga0055455_10231478 | Not Available | 583 | Open in IMG/M |
3300004114|Ga0062593_100553054 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300004114|Ga0062593_102525184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 582 | Open in IMG/M |
3300004156|Ga0062589_101440038 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300004157|Ga0062590_100412509 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300004463|Ga0063356_100263968 | Not Available | 2099 | Open in IMG/M |
3300004479|Ga0062595_102461943 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300004480|Ga0062592_100856714 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300004643|Ga0062591_101750510 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300005093|Ga0062594_100519930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1014 | Open in IMG/M |
3300005093|Ga0062594_103237973 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300005329|Ga0070683_100013769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7061 | Open in IMG/M |
3300005329|Ga0070683_100567096 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300005332|Ga0066388_100219170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2532 | Open in IMG/M |
3300005332|Ga0066388_103363913 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300005332|Ga0066388_107938190 | Not Available | 531 | Open in IMG/M |
3300005353|Ga0070669_100938993 | Not Available | 740 | Open in IMG/M |
3300005365|Ga0070688_101715330 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300005441|Ga0070700_101907646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
3300005445|Ga0070708_100819000 | Not Available | 875 | Open in IMG/M |
3300005459|Ga0068867_101073449 | Not Available | 734 | Open in IMG/M |
3300005529|Ga0070741_10007956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 21565 | Open in IMG/M |
3300005529|Ga0070741_10016894 | All Organisms → cellular organisms → Bacteria | 12078 | Open in IMG/M |
3300005529|Ga0070741_10041004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5972 | Open in IMG/M |
3300005529|Ga0070741_10052259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4931 | Open in IMG/M |
3300005529|Ga0070741_10063531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4260 | Open in IMG/M |
3300005535|Ga0070684_100449449 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300005564|Ga0070664_100653855 | Not Available | 977 | Open in IMG/M |
3300005718|Ga0068866_11434641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
3300005764|Ga0066903_100138350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3453 | Open in IMG/M |
3300005764|Ga0066903_100937590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1573 | Open in IMG/M |
3300005764|Ga0066903_101857162 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
3300005764|Ga0066903_103662986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 827 | Open in IMG/M |
3300005841|Ga0068863_102755266 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005874|Ga0075288_1034631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300005884|Ga0075291_1004374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1515 | Open in IMG/M |
3300005937|Ga0081455_10064721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3060 | Open in IMG/M |
3300006038|Ga0075365_11058691 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300006046|Ga0066652_101194375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 720 | Open in IMG/M |
3300006358|Ga0068871_100352177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1303 | Open in IMG/M |
3300006603|Ga0074064_11741883 | Not Available | 787 | Open in IMG/M |
3300006755|Ga0079222_10251933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1111 | Open in IMG/M |
3300006854|Ga0075425_100364514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1664 | Open in IMG/M |
3300006854|Ga0075425_101427452 | Not Available | 783 | Open in IMG/M |
3300006904|Ga0075424_100622273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1153 | Open in IMG/M |
3300007076|Ga0075435_100562911 | Not Available | 988 | Open in IMG/M |
3300009012|Ga0066710_102413711 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300009088|Ga0099830_11714115 | Not Available | 524 | Open in IMG/M |
3300009090|Ga0099827_10594392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
3300009098|Ga0105245_10148254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2216 | Open in IMG/M |
3300009098|Ga0105245_10160262 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
3300009137|Ga0066709_100085679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3784 | Open in IMG/M |
3300009148|Ga0105243_10196433 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
3300009148|Ga0105243_10415888 | Not Available | 1253 | Open in IMG/M |
3300009176|Ga0105242_11125188 | Not Available | 800 | Open in IMG/M |
3300009177|Ga0105248_11243330 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300010373|Ga0134128_11726975 | Not Available | 689 | Open in IMG/M |
3300010400|Ga0134122_11450924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 703 | Open in IMG/M |
3300011119|Ga0105246_11473113 | Not Available | 638 | Open in IMG/M |
3300012008|Ga0120174_1128123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
3300012010|Ga0120118_1175609 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300012204|Ga0137374_10353101 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
3300012204|Ga0137374_10353839 | Not Available | 1183 | Open in IMG/M |
3300012204|Ga0137374_11272929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300012211|Ga0137377_11649906 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300012350|Ga0137372_10980843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
3300012354|Ga0137366_10819645 | Not Available | 660 | Open in IMG/M |
3300012356|Ga0137371_10877994 | Not Available | 682 | Open in IMG/M |
3300012532|Ga0137373_10500883 | Not Available | 928 | Open in IMG/M |
3300012911|Ga0157301_10198229 | Not Available | 674 | Open in IMG/M |
3300012913|Ga0157298_10084869 | Not Available | 822 | Open in IMG/M |
3300012957|Ga0164303_10121371 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
3300012958|Ga0164299_10082997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1614 | Open in IMG/M |
3300012961|Ga0164302_10053186 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
3300012971|Ga0126369_13548574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
3300012977|Ga0134087_10215831 | Not Available | 865 | Open in IMG/M |
3300012984|Ga0164309_10149449 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
3300012985|Ga0164308_11820881 | Not Available | 567 | Open in IMG/M |
3300012988|Ga0164306_10932933 | Not Available | 710 | Open in IMG/M |
3300012989|Ga0164305_10231966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1321 | Open in IMG/M |
3300013307|Ga0157372_11857130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300013501|Ga0120154_1125557 | Not Available | 583 | Open in IMG/M |
3300013770|Ga0120123_1141668 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300014314|Ga0075316_1198478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 528 | Open in IMG/M |
3300014326|Ga0157380_12847907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
3300015371|Ga0132258_10038721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10782 | Open in IMG/M |
3300015371|Ga0132258_10059456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8794 | Open in IMG/M |
3300015371|Ga0132258_10370788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3547 | Open in IMG/M |
3300015371|Ga0132258_12552256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1277 | Open in IMG/M |
3300015371|Ga0132258_13478289 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300015373|Ga0132257_100799963 | Not Available | 1177 | Open in IMG/M |
3300015373|Ga0132257_102905306 | Not Available | 624 | Open in IMG/M |
3300015374|Ga0132255_103649103 | Not Available | 654 | Open in IMG/M |
3300017792|Ga0163161_10994865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
3300017944|Ga0187786_10237825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
3300017947|Ga0187785_10439355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 637 | Open in IMG/M |
3300018029|Ga0187787_10239210 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300018032|Ga0187788_10328353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 627 | Open in IMG/M |
3300018433|Ga0066667_11441246 | Not Available | 606 | Open in IMG/M |
3300019356|Ga0173481_10420089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
3300019361|Ga0173482_10395656 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300020002|Ga0193730_1030433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1565 | Open in IMG/M |
3300024254|Ga0247661_1040557 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300024254|Ga0247661_1057486 | Not Available | 716 | Open in IMG/M |
3300024283|Ga0247670_1102169 | Not Available | 530 | Open in IMG/M |
3300025167|Ga0209642_10195720 | Not Available | 1165 | Open in IMG/M |
3300025322|Ga0209641_10749102 | Not Available | 662 | Open in IMG/M |
3300025907|Ga0207645_10992711 | Not Available | 569 | Open in IMG/M |
3300025914|Ga0207671_11133752 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300025919|Ga0207657_10323037 | Not Available | 1220 | Open in IMG/M |
3300025926|Ga0207659_11250746 | Not Available | 638 | Open in IMG/M |
3300025926|Ga0207659_11645103 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300025927|Ga0207687_10426105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1096 | Open in IMG/M |
3300025932|Ga0207690_11542197 | Not Available | 555 | Open in IMG/M |
3300025935|Ga0207709_10120663 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
3300025935|Ga0207709_11023674 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300025941|Ga0207711_10953526 | Not Available | 797 | Open in IMG/M |
3300025944|Ga0207661_11443379 | Not Available | 631 | Open in IMG/M |
3300025960|Ga0207651_11580150 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300026035|Ga0207703_10657456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
3300026035|Ga0207703_11923726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
3300026142|Ga0207698_10399735 | Not Available | 1313 | Open in IMG/M |
3300027787|Ga0209074_10564353 | Not Available | 503 | Open in IMG/M |
3300027821|Ga0209811_10037010 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
3300027915|Ga0209069_10894770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
3300028592|Ga0247822_10695016 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300028828|Ga0307312_10231650 | Not Available | 1192 | Open in IMG/M |
3300028880|Ga0307300_10091971 | Not Available | 907 | Open in IMG/M |
3300028884|Ga0307308_10109646 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
3300028885|Ga0307304_10028586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1946 | Open in IMG/M |
3300031226|Ga0307497_10143655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 983 | Open in IMG/M |
3300031547|Ga0310887_11112166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
3300032075|Ga0310890_10753787 | Not Available | 767 | Open in IMG/M |
3300032205|Ga0307472_102767012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
3300032256|Ga0315271_11865870 | Not Available | 515 | Open in IMG/M |
3300032782|Ga0335082_10974350 | Not Available | 712 | Open in IMG/M |
3300033550|Ga0247829_10075036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2471 | Open in IMG/M |
3300033550|Ga0247829_10292973 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.81% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.25% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.86% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.17% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.47% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.78% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.78% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.08% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.08% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.08% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.08% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.39% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.39% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.39% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.39% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.39% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.69% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1020424022 | 3300000956 | Soil | MEMIVVLTVLLLAGVLSVVARDSRDYDDRDRRGWWPGRR* |
JGI10216J12902_1051640082 | 3300000956 | Soil | MLVILTLLLLAGVVSVMGRDTRDYDYTDRRRWWPGRR* |
JGI10216J12902_1057805331 | 3300000956 | Soil | MPGRQAWGMAFAIVFAVLILACVLSILGPDGRDYDVNDRRGWWP |
JGI10216J12902_1088022672 | 3300000956 | Soil | MAMLVVLTILILAGVLSVVARDVHDLDDRDRRGWWPGRR* |
JGI10216J12902_1143057222 | 3300000956 | Soil | MLVVLTILILAGVLSVVAGDSRDLDDRDRRGWWPGRK* |
A10PFW1_100514113 | 3300001538 | Permafrost | VEIIIVLTIVLLAGVVSVMGPDSHDYDDTDQRGWWPGRPR* |
Ga0055455_102314782 | 3300003990 | Natural And Restored Wetlands | MEMIVLLALLLLAGLFSVLGPDARDYDDTDRRGWWPGRR* |
Ga0062593_1005530542 | 3300004114 | Soil | MEMLVVLTIVILAGVLSVVARDSHDYDDSDRRGWWPGHR* |
Ga0062593_1025251842 | 3300004114 | Soil | VVVEIVIVLTILILAGVVSALGPDSRDYDVNDRRGWWPGRR* |
Ga0062589_1014400382 | 3300004156 | Soil | MGQMTDNVLMTAIILFSLLLLAGVFSVMGPDTRDYDVNDRRGWWPGKR* |
Ga0062590_1004125092 | 3300004157 | Soil | MEIVVILALLLLAGVVSVLGPDAHDLDVNDRRGWWPGRR* |
Ga0063356_1002639682 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAFAVVFAILILVGVLSIVVPERRDYDVNDRRGWWPGHSR* |
Ga0062595_1024619431 | 3300004479 | Soil | SSQIIRFVVMGQMTDNVLMTAIILFSLLLLAGVFSVMGPDTRDYDVNDRRGWWPGKR* |
Ga0062592_1008567142 | 3300004480 | Soil | MEMIVVLTVLLLAGVLSVVARDSRDYDDHDRRGWWPGRR* |
Ga0062591_1017505102 | 3300004643 | Soil | MRQFDDAMSMTALIVLSFVILAGVLSVMGPDSRDYDVNDRRGWWPGRR* |
Ga0062594_1005199301 | 3300005093 | Soil | VVMTQIDDALCVEALILFCFVILAGVFSVMGPDSRDYRVNDRRGWWPGRR* |
Ga0062594_1032379732 | 3300005093 | Soil | MSMTALIILSFVILAGVLSVMGPDSRDYDVNDRRGWWPGRR* |
Ga0070683_10001376910 | 3300005329 | Corn Rhizosphere | VEIVIVLTILILAGVLSVVGPDTHDYDVNDRRGWWPGSR* |
Ga0070683_1005670962 | 3300005329 | Corn Rhizosphere | MTQIDDALCVEALILFCFVILAGVFSVMGPDSRDYRVNDRRGWWPGRR* |
Ga0066388_1002191702 | 3300005332 | Tropical Forest Soil | MEIVILLTILILAGVVSVLGPDSRDYDVNDRRGWWPGSR* |
Ga0066388_1033639132 | 3300005332 | Tropical Forest Soil | MAFVVVFAIVILVCVLSVLGPDRRDYDVNDRRGWWPGHRS* |
Ga0066388_1079381902 | 3300005332 | Tropical Forest Soil | MAFVVVFAILILACVLSVLGPDSRDYDVNDRRGWWPGHSR* |
Ga0070669_1009389931 | 3300005353 | Switchgrass Rhizosphere | NRQASVVEIVIVLTILILAGVLSVVGPDTHDYDVNDRRGWWPGRR* |
Ga0070688_1017153301 | 3300005365 | Switchgrass Rhizosphere | IGDALCVEALILLCFVILAGVFSVMGPDSRDYRVNDRRAWWPGRR* |
Ga0070700_1019076462 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFVVVFAILILVCVLSVLGRDGRDYDVNDRRGWWPGHHR* |
Ga0070708_1008190002 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIAIVLTILILAGVLSVIVPDRRDYDVNDRRGWWPGHRN* |
Ga0068867_1010734492 | 3300005459 | Miscanthus Rhizosphere | VEIVIVLTILILAGVLSVVGPDTHEYDVNDRRGWWPGSR* |
Ga0070741_100079562 | 3300005529 | Surface Soil | MSMGLHATPMEIIVVLALLLLAGVASILGPDPRDLDDRDRRGWWPGHSR* |
Ga0070741_100168944 | 3300005529 | Surface Soil | MAMLVVLTFLLLAGVLSVVARDSHDLDDHDRRGWWPGRR* |
Ga0070741_100410042 | 3300005529 | Surface Soil | VLIIIDGHPMRMAIVLVLTILFLAGVLSVMGPDTRDWDVNDRRGWWPGSR* |
Ga0070741_100522595 | 3300005529 | Surface Soil | MEAMVVLMILLLASVLSVVRTDRRDYDDRDRRGWWPGHR* |
Ga0070741_100635317 | 3300005529 | Surface Soil | MAMLVVLTFLILAGVLSVVARDSHDFDDHDRRGWWPGRR* |
Ga0070684_1004494492 | 3300005535 | Corn Rhizosphere | MAMLVVLTILILAGVLSVVARDSRDYDDHDRRGWWPGRR* |
Ga0070664_1006538552 | 3300005564 | Corn Rhizosphere | VEIVIVLTILILAGVLSVVGPDTHDYDVNDRRGWWPGRR* |
Ga0068866_114346411 | 3300005718 | Miscanthus Rhizosphere | IVILTIVLLAGVLSVVVRDSRDYDDHDRRGWWPGRR* |
Ga0066903_1001383502 | 3300005764 | Tropical Forest Soil | MTFVVVFSILILVGVLSIVVPERRDYDVNDRRGWWPGHSK* |
Ga0066903_1009375902 | 3300005764 | Tropical Forest Soil | MAPLIVLAILLLACVFSVVGTDSHDYDVNDRRGWWPGHK* |
Ga0066903_1018571622 | 3300005764 | Tropical Forest Soil | VEIVIVLTILILAGVVSVLGPDSRDYDVNDRRGWWPGSR* |
Ga0066903_1036629862 | 3300005764 | Tropical Forest Soil | MLVVLVILILAGVLSVASRDTRDYDYRDRRGWWPGRR* |
Ga0068863_1027552662 | 3300005841 | Switchgrass Rhizosphere | VLTILILAGVLSVVARDSRDYDDHDRRGWWPGRR* |
Ga0075288_10346312 | 3300005874 | Rice Paddy Soil | VEIIVLLTLLLLAGVVSIMGPDSHDYDDRDRRGWWPGHTR* |
Ga0075291_10043741 | 3300005884 | Rice Paddy Soil | HPEGVEIIVLLTLLLLAGVVSIMGPDSHDYDDRDRRGWWPGHTR* |
Ga0081455_100647213 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTFVVVFSILILVGVLSVVVPERRDYDVNDRRGWWPGHSR* |
Ga0075365_110586912 | 3300006038 | Populus Endosphere | MEVVILFVILLLAGVASVLGPDSHDYDANDRRGWWPGHR* |
Ga0066652_1011943752 | 3300006046 | Soil | MEMIVVLTILILAGVLSVVAGDSRDYDDHDRRGWWPGRR* |
Ga0068871_1003521773 | 3300006358 | Miscanthus Rhizosphere | VEIVIVLTILILAGVLSVVGPDTHDYDVNDRRGWWPGS |
Ga0074064_117418831 | 3300006603 | Soil | IGQIDDAMSMTAPIILFSLLLLAGVLSVLGPDTRDYDVNDRRGWWPGRR* |
Ga0079222_102519332 | 3300006755 | Agricultural Soil | MAMIFVLGFVLLAGVASVISRDTHDFNDTDRRGWWPGRR* |
Ga0075425_1003645143 | 3300006854 | Populus Rhizosphere | MAFAVVFAVLILACVLSVLGPDGRDYDVNDRRGWWPGHRR* |
Ga0075425_1014274522 | 3300006854 | Populus Rhizosphere | AFAVVFAILILACVLSVLGPDGRDYDVNDRRGWWPGHRR* |
Ga0075424_1006222732 | 3300006904 | Populus Rhizosphere | VVVEIVIVLTILILAGVVSALGPDSRDYDVNDRRGWWPGKR* |
Ga0075435_1005629112 | 3300007076 | Populus Rhizosphere | VVVEIVVVLTILILAGVVSALGPDSRDYDVNDRRGWWPGKR* |
Ga0066710_1024137112 | 3300009012 | Grasslands Soil | VEIIVLLALLLLAGVFSVMGPDQRDYDDTDRRGWWPGRR |
Ga0099830_117141152 | 3300009088 | Vadose Zone Soil | VSVEIIVLLTLLLLACVVSVMGPDSHDYDDTDRRGWWPGR |
Ga0099827_105943922 | 3300009090 | Vadose Zone Soil | VSVEIIVLLTLLLLAGVVSVMGPDSHDYDDTDRRGWWPGRSR* |
Ga0105245_101482542 | 3300009098 | Miscanthus Rhizosphere | MSMTALIVLSFVILAGVLSVMGPDSRDYDVNDRRGWWPGRR* |
Ga0105245_101602625 | 3300009098 | Miscanthus Rhizosphere | MEMIVILTIVLLAGVLSVVVRDSRDYDDHDRRGWWPGRR* |
Ga0066709_1000856794 | 3300009137 | Grasslands Soil | VEIIVLLALLLLAGVFSVMGPDQRDYDDTDRRGWWPGRR* |
Ga0105243_101964331 | 3300009148 | Miscanthus Rhizosphere | HPASVEIVIVLTILILAGVLSVVGPDTHDYDVNDRRGWWPGSR* |
Ga0105243_104158882 | 3300009148 | Miscanthus Rhizosphere | MTQIGDALCVEALILLCFVILAGVFSVMGPDSRDYRVNDRRGWWPGRR* |
Ga0105242_111251882 | 3300009176 | Miscanthus Rhizosphere | MIVILTVVLLAGVLSVVVRDSRDYDDHDRRGWWPGRR* |
Ga0105248_112433302 | 3300009177 | Switchgrass Rhizosphere | MSMTALIVLSFVILAGVLSVMGPDSRDYDVNDRRGWWPGKK* |
Ga0134128_117269751 | 3300010373 | Terrestrial Soil | MEMIVILTIVLLAGVLSVVVRDSRDYDDRDRRGWWPGRR* |
Ga0134122_114509241 | 3300010400 | Terrestrial Soil | MAIVIVLTILILAGVLSVLGPDTHDYDVNDRRGWWPGSR* |
Ga0105246_114731132 | 3300011119 | Miscanthus Rhizosphere | MEMIVILTVVLLAGVLSVVVRDSRDYDDHDRRGWWPGRR* |
Ga0120174_11281232 | 3300012008 | Permafrost | SVEIIIVLTIVLLAGVVSVMGPDSHDYDDTDQRGWWPGRPR* |
Ga0120118_11756091 | 3300012010 | Permafrost | ELIIVLTIVLLAGVVSVMGPDSHDYDDTDQRGWWPGRPR* |
Ga0137374_103531012 | 3300012204 | Vadose Zone Soil | VFVEIIVLLTLLLLAGVVSVMGPDSHDYDDTDRRGWWPGRSR* |
Ga0137374_103538392 | 3300012204 | Vadose Zone Soil | MEIIILLTVLLLAGVVSIMGPESHDYDDTDRRGWWPGRAR* |
Ga0137374_112729292 | 3300012204 | Vadose Zone Soil | MEMLVLLTLVLLAGVFSVIGTDSRDFDDTDRRGWWPGHK* |
Ga0137377_116499062 | 3300012211 | Vadose Zone Soil | VSVEIILLLTILLLAGVVSVMGPDSHDYDDTDRRGWWPGRSR* |
Ga0137372_109808432 | 3300012350 | Vadose Zone Soil | MEMLVVLTFLILAGVLSVLSHDSRDFDDTDRRGWWPGRR* |
Ga0137366_108196452 | 3300012354 | Vadose Zone Soil | MEMIVLLTFLLLAGVVSVMGPDSHDYDDTDRRGWWPGRSR* |
Ga0137371_108779942 | 3300012356 | Vadose Zone Soil | MEIIILLTILFLAGVVSVMGPDPHDLDDTDRRGWWPGRSR* |
Ga0137373_105008832 | 3300012532 | Vadose Zone Soil | MEIIVLLTVLILAGVVSVMGPDTHDYDDHDRRGWWPGRAR* |
Ga0157301_101982291 | 3300012911 | Soil | IDDAMSMAAPIIIFSLLILAGVLSVLGPDTRDYDVNDRRGWWPGHK* |
Ga0157298_100848692 | 3300012913 | Soil | MTDTVLMTAIILFSLLLLAGVFSVMGPDTRDYDVNDRRGWWPGKR* |
Ga0164303_101213712 | 3300012957 | Soil | MIVILTVVLLAGVLSVVVRDSRDYDDRDRRGWWPGRR* |
Ga0164299_100829973 | 3300012958 | Soil | VEIVIVLTILILAGVLSVVGPDTRDYDVNDRRGWWPGSR* |
Ga0164302_100531862 | 3300012961 | Soil | MPMAALISLVSLLLLAGVLSVMGPDTRDYDVNDRRGWWPGNR* |
Ga0126369_135485742 | 3300012971 | Tropical Forest Soil | MAPLIVLAILLLACVFSVVGADSHDYDVNDRRGWWPGHK* |
Ga0134087_102158312 | 3300012977 | Grasslands Soil | VEIIVLLTLLLLAGVFSVMGPDQRDYDDTDRRGWWPGRR* |
Ga0164309_101494492 | 3300012984 | Soil | MIVILTVVLLAGVLSVVVRDTRDYDDHDRRGWWPGRR* |
Ga0164308_118208811 | 3300012985 | Soil | MGQIDDAMSMAAPIILFSLLLLAGVLSVLGPDTRDYDVNDRRGWGPGRR* |
Ga0164306_109329332 | 3300012988 | Soil | MIVILTVVLPAGVLSVVVRDSRDYDDRDRRGWWPG |
Ga0164305_102319662 | 3300012989 | Soil | MSMAALIILFSLLLLAGVLSVMGPDTRDYDVNDRRGWWPGKR* |
Ga0157372_118571302 | 3300013307 | Corn Rhizosphere | VEIVIVLTILILAGVLSVVGAAIKKNNVNDRRGWWPGSR* |
Ga0120154_11255572 | 3300013501 | Permafrost | VEIIIVLTIVLLAGVVSVMRPDSRDYDDTDQRGWWPGRPR* |
Ga0120123_11416681 | 3300013770 | Permafrost | MEIIILLTILFLAGVVSIMGPDSHDLDDRDRRGWWPGRAR* |
Ga0075316_11984782 | 3300014314 | Natural And Restored Wetlands | MMIFLTLLLLAGVFSAVGPARHDLDDRDERGWWPGHSRR* |
Ga0157380_128479071 | 3300014326 | Switchgrass Rhizosphere | MEMIVVLAVVLLAGVLSVVVRDSRDYDDHDRRGWWPGRR* |
Ga0132258_1003872112 | 3300015371 | Arabidopsis Rhizosphere | VVVEIVVVLTILILAGVVSALGPDSRDCDVNDRRGWWPGKR* |
Ga0132258_100594567 | 3300015371 | Arabidopsis Rhizosphere | MAFVVVFAILILVCVLSVLGRDGRDYDVNDRRGWWPGHRR* |
Ga0132258_103707882 | 3300015371 | Arabidopsis Rhizosphere | MAMIVVLSFLVLAGVLSVVSRDSHDFDDTDRRGWWPGRR* |
Ga0132258_125522562 | 3300015371 | Arabidopsis Rhizosphere | MEMIVVLTILILAGVLSVVARDSHDYDDHDRRGWWPGRR* |
Ga0132258_134782892 | 3300015371 | Arabidopsis Rhizosphere | MCMTAPIILFSLLLLAGVLSVLGPDTRDYDVNDRRGWWPGKR* |
Ga0132257_1007999632 | 3300015373 | Arabidopsis Rhizosphere | MAMLVVLTILILAGVLSVVARDSRDYDDQDRRGWWPGRR* |
Ga0132257_1029053062 | 3300015373 | Arabidopsis Rhizosphere | VEIVIVLTILILAGVLSVVGPDTHDYDVNDRRGWWPG |
Ga0132255_1036491032 | 3300015374 | Arabidopsis Rhizosphere | MTAPIILFSLLLLAGVLSVLGPDTRDYDVNDRRGWWPGKR* |
Ga0163161_109948652 | 3300017792 | Switchgrass Rhizosphere | MSMTALIVPSFVILAGVLSVMGPDSRDYDVNDRRGWWPGRR |
Ga0187786_102378252 | 3300017944 | Tropical Peatland | MEIIVILTIVLLAGVVSVMGPDTHDYDDTDRRGWWPGRAR |
Ga0187785_104393552 | 3300017947 | Tropical Peatland | VVFAIVILAGVLSVLGPDGRDYDVNDRRGWWPGHHR |
Ga0187787_102392102 | 3300018029 | Tropical Peatland | MEIIVILTIVLLAGVVSVMGPDTHDYDDSDRRGWWPGRAR |
Ga0187788_103283532 | 3300018032 | Tropical Peatland | MSMEIAIVLTILVLAGVLSVMGPDTRDWSVNDRRGWWPGKR |
Ga0066667_114412462 | 3300018433 | Grasslands Soil | MEILVLLTVLLLAGVFSVMGPDSHDFDDTDRRGWWPGRSR |
Ga0173481_104200892 | 3300019356 | Soil | MEMIVILTIVLLAGVLSVVVRDSRDYDDHDRRGWWPGRR |
Ga0173482_103956562 | 3300019361 | Soil | MSMAAPIIIFSLLILAGVLSVLGPDTRDYDVNDRRGWWPGKR |
Ga0193730_10304332 | 3300020002 | Soil | MAIIILLTIVLLAGVVSIMGPESHDYDDTDRRGWWPGRPR |
Ga0247661_10405572 | 3300024254 | Soil | MGQIDDATPMAAPIIIFSLLILAGVLSVLGPDTRDYDVNDRRGWWPGRR |
Ga0247661_10574862 | 3300024254 | Soil | MAILVVLTILVLAGVFSVMGSDSHDWDVNDRRGWWPGHK |
Ga0247670_11021692 | 3300024283 | Soil | MGQIDDAMCMTAPIILFSLLILAGVLSVLGPDTRDYDVNDRRGWWPGKR |
Ga0209642_101957202 | 3300025167 | Soil | MLVILTVLLLAGVYSVVRPDHRDYDDRDRRGWWPGTR |
Ga0209641_107491022 | 3300025322 | Soil | MEILAILTILLLAGVYSVVRPDHRDYDDRDRRGWWPGTP |
Ga0207645_109927112 | 3300025907 | Miscanthus Rhizosphere | VIVLTILILAGVLSVVGPDTHDYDVNDRRGWWPGRR |
Ga0207671_111337522 | 3300025914 | Corn Rhizosphere | ASVEIVIVLTILILAGVLSVVGPDTHDYDVNDRRGWWPGSR |
Ga0207657_103230371 | 3300025919 | Corn Rhizosphere | VEIVIVLTILILAGVLSVVGPDTHDYDVNDRRGWWPGRCR |
Ga0207659_112507462 | 3300025926 | Miscanthus Rhizosphere | VVVEIVIVLTILILAGVVSALGPDSRDYDVNDRRGWWPGRR |
Ga0207659_116451032 | 3300025926 | Miscanthus Rhizosphere | MTQIDDALCVEALILFCFVILAGVFSVMGPDSRDYRVNDRRGWWPGRR |
Ga0207687_104261052 | 3300025927 | Miscanthus Rhizosphere | DDAMSMTALIVLSFVILAGVLSVMGPDSRDYDVNDRRGWWPGRR |
Ga0207690_115421971 | 3300025932 | Corn Rhizosphere | VEIVIVLTILILAGVLSVVGPDTHDYDVNDRRGWWP |
Ga0207709_101206631 | 3300025935 | Miscanthus Rhizosphere | RHPASVEIVIVLTILILAGVLSVVGPDTHDYDVNDRRGWWPGSR |
Ga0207709_110236742 | 3300025935 | Miscanthus Rhizosphere | MTQIGDALCVEALILLCFVILAGVFSVMGPDSRDYRVNDRRGWWPGRR |
Ga0207711_109535262 | 3300025941 | Switchgrass Rhizosphere | MSMTALIILSFVILAGVLSVMGPDSRDYDVNDRRGWWPGKK |
Ga0207661_114433792 | 3300025944 | Corn Rhizosphere | MRRDRHTSHMEVVILFVILLLAGVASVLGPDSHDYDANDRRGWWPGHR |
Ga0207651_115801501 | 3300025960 | Switchgrass Rhizosphere | VILTIVLLAGVLSVVVRDSRDYDDHDRRGWWPGRR |
Ga0207703_106574562 | 3300026035 | Switchgrass Rhizosphere | MEMIVVLTIVLLAGVLSVVVRESRDYDDHDRRGWWPGRR |
Ga0207703_119237261 | 3300026035 | Switchgrass Rhizosphere | VVEEIVIVLMILILDGVVSALGPDSRDYDVNDRRGWWPGRR |
Ga0207698_103997352 | 3300026142 | Corn Rhizosphere | MSMTALIVLSFVILAGVLSVMGPDSRDYDVNDRRGWWPGRR |
Ga0209074_105643531 | 3300027787 | Agricultural Soil | MAMIFVLGFVLLAGVASVISRDTHDFNDTDRRGWWPGRR |
Ga0209811_100370103 | 3300027821 | Surface Soil | MEMLVILTVLLLAGVLSVVARDSRDYDDHDRRGWWPGRR |
Ga0209069_108947702 | 3300027915 | Watersheds | VEIIVLLTLLLLAGVVSVMGPDSHDYDDTDRRGWWPGNR |
Ga0247822_106950162 | 3300028592 | Soil | MEMLVVLTVLLLAGVLSVVARDSRDYDDHDRRGWWPGRK |
Ga0307312_102316503 | 3300028828 | Soil | MAMIILLTIVLLAGVVSIMGPECHDYDDTDRRGWWPGRPR |
Ga0307300_100919712 | 3300028880 | Soil | LFVLAFLLLAGVFSVISRDSHDFDDTDRRGWWPGRR |
Ga0307308_101096462 | 3300028884 | Soil | MAIIILLTILLLAGVVSIMEPECHDYDDTDRRGWWPGRPR |
Ga0307304_100285862 | 3300028885 | Soil | MLFVLAFLLLAGVFSVISRDSHDFDDTDRRGWWPGRR |
Ga0307497_101436551 | 3300031226 | Soil | MAMIVVLTVLLLAGVLSVVARDSRDYDDHDRRGWWPGRR |
Ga0310887_111121662 | 3300031547 | Soil | MAFVVVFAILILVCVLSVLGRDGRDYDVNDRRGWWPGHHR |
Ga0310890_107537872 | 3300032075 | Soil | VVVEIVVVLTILILAGVVSALGPDSRDYDVNDRRGWWPGKR |
Ga0307472_1027670121 | 3300032205 | Hardwood Forest Soil | MAATVLLTILLLACVLSAVRRDDRDLDDRDRRGWWPGRR |
Ga0315271_118658701 | 3300032256 | Sediment | LIVLTILLLAGVFSVMGPDAHDHDVNDRRGWWPGNR |
Ga0335082_109743501 | 3300032782 | Soil | MAFLVVFAIVILACVLSVLGPDGRDYDVNDRRGWWPGHRS |
Ga0247829_100750362 | 3300033550 | Soil | MLVVLTVLLLAGVLSVVARDSRDYDDHDRRGWWPGRK |
Ga0247829_102929732 | 3300033550 | Soil | MAFVVVFAILILVCVLSVLGRDRRDYDVNDRRGWWPGHHR |
⦗Top⦘ |