


| Basic Information | |
|---|---|
| Family ID | F051136 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTDKDWLERVTIAYKAYPYPSKEIERFIKWMYEQYGIVAPKDA |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 40.97 % |
| % of genes near scaffold ends (potentially truncated) | 11.11 % |
| % of genes from short scaffolds (< 2000 bps) | 63.89 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.167 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (25.694 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.556 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.611 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF16363 | GDP_Man_Dehyd | 20.14 |
| PF01370 | Epimerase | 12.50 |
| PF01242 | PTPS | 11.81 |
| PF01266 | DAO | 6.94 |
| PF07883 | Cupin_2 | 4.17 |
| PF00574 | CLP_protease | 3.47 |
| PF00908 | dTDP_sugar_isom | 2.78 |
| PF03851 | UvdE | 2.78 |
| PF04851 | ResIII | 1.39 |
| PF02592 | Vut_1 | 1.39 |
| PF00271 | Helicase_C | 1.39 |
| PF03819 | MazG | 1.39 |
| PF01467 | CTP_transf_like | 1.39 |
| PF07484 | Collar | 0.69 |
| PF00293 | NUDIX | 0.69 |
| PF01761 | DHQ_synthase | 0.69 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.69 |
| PF02801 | Ketoacyl-synt_C | 0.69 |
| PF00117 | GATase | 0.69 |
| PF13155 | Toprim_2 | 0.69 |
| PF03237 | Terminase_6N | 0.69 |
| PF11351 | GTA_holin_3TM | 0.69 |
| PF03721 | UDPG_MGDP_dh_N | 0.69 |
| PF00154 | RecA | 0.69 |
| PF13394 | Fer4_14 | 0.69 |
| PF13884 | Peptidase_S74 | 0.69 |
| PF01503 | PRA-PH | 0.69 |
| PF05345 | He_PIG | 0.69 |
| PF10431 | ClpB_D2-small | 0.69 |
| PF09820 | AAA-ATPase_like | 0.69 |
| PF08722 | Tn7_TnsA-like_N | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 11.81 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 6.94 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 6.94 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.47 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 2.78 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 2.78 |
| COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 1.39 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.69 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.69 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.69 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.17 % |
| All Organisms | root | All Organisms | 45.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001836|RCM27_1000880 | Not Available | 6917 | Open in IMG/M |
| 3300001837|RCM39_1048370 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300001837|RCM39_1086315 | Not Available | 590 | Open in IMG/M |
| 3300001838|RCM33_1054045 | Not Available | 534 | Open in IMG/M |
| 3300001842|RCM30_1116419 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300001847|RCM41_1101408 | Not Available | 867 | Open in IMG/M |
| 3300001850|RCM37_1004556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1405 | Open in IMG/M |
| 3300001850|RCM37_1039064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2156 | Open in IMG/M |
| 3300001968|GOS2236_1058258 | All Organisms → cellular organisms → Bacteria | 4442 | Open in IMG/M |
| 3300002161|JGI24766J26685_10035189 | Not Available | 1177 | Open in IMG/M |
| 3300002161|JGI24766J26685_10036476 | Not Available | 1150 | Open in IMG/M |
| 3300002835|B570J40625_100617053 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300002835|B570J40625_101202756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300003411|JGI25911J50253_10158997 | Not Available | 644 | Open in IMG/M |
| 3300004095|Ga0007829_10023738 | Not Available | 1183 | Open in IMG/M |
| 3300004112|Ga0065166_10029155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1703 | Open in IMG/M |
| 3300004240|Ga0007787_10141537 | Not Available | 1150 | Open in IMG/M |
| 3300005527|Ga0068876_10418586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300005527|Ga0068876_10522571 | Not Available | 650 | Open in IMG/M |
| 3300005585|Ga0049084_10110460 | Not Available | 981 | Open in IMG/M |
| 3300005662|Ga0078894_10088069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2717 | Open in IMG/M |
| 3300005662|Ga0078894_10132798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2224 | Open in IMG/M |
| 3300005662|Ga0078894_10257346 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300005662|Ga0078894_10494385 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300005662|Ga0078894_10501261 | All Organisms → Viruses → Predicted Viral | 1090 | Open in IMG/M |
| 3300005662|Ga0078894_10802290 | Not Available | 824 | Open in IMG/M |
| 3300005662|Ga0078894_11339289 | Not Available | 600 | Open in IMG/M |
| 3300005805|Ga0079957_1262020 | Not Available | 796 | Open in IMG/M |
| 3300006484|Ga0070744_10000345 | All Organisms → cellular organisms → Bacteria | 13302 | Open in IMG/M |
| 3300006484|Ga0070744_10029049 | All Organisms → Viruses → Predicted Viral | 1638 | Open in IMG/M |
| 3300006484|Ga0070744_10058574 | All Organisms → Viruses → Predicted Viral | 1125 | Open in IMG/M |
| 3300006641|Ga0075471_10265210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales | 880 | Open in IMG/M |
| 3300006641|Ga0075471_10681084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 501 | Open in IMG/M |
| 3300008107|Ga0114340_1000005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 185548 | Open in IMG/M |
| 3300008107|Ga0114340_1208496 | Not Available | 646 | Open in IMG/M |
| 3300008108|Ga0114341_10004476 | Not Available | 18307 | Open in IMG/M |
| 3300008116|Ga0114350_1028805 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
| 3300008116|Ga0114350_1042926 | All Organisms → Viruses → Predicted Viral | 2337 | Open in IMG/M |
| 3300009079|Ga0102814_10663102 | Not Available | 572 | Open in IMG/M |
| 3300009081|Ga0105098_10602807 | Not Available | 572 | Open in IMG/M |
| 3300009152|Ga0114980_10586933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300009154|Ga0114963_10001000 | Not Available | 19481 | Open in IMG/M |
| 3300009154|Ga0114963_10515570 | Not Available | 635 | Open in IMG/M |
| 3300009155|Ga0114968_10003202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12327 | Open in IMG/M |
| 3300009159|Ga0114978_10000005 | Not Available | 179875 | Open in IMG/M |
| 3300009159|Ga0114978_10072341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2320 | Open in IMG/M |
| 3300009159|Ga0114978_10096652 | Not Available | 1955 | Open in IMG/M |
| 3300009159|Ga0114978_10287595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1010 | Open in IMG/M |
| 3300009160|Ga0114981_10060628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2111 | Open in IMG/M |
| 3300009164|Ga0114975_10000074 | Not Available | 63555 | Open in IMG/M |
| 3300009164|Ga0114975_10219875 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300009164|Ga0114975_10696720 | Not Available | 537 | Open in IMG/M |
| 3300009180|Ga0114979_10485121 | Not Available | 715 | Open in IMG/M |
| 3300009182|Ga0114959_10129878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1356 | Open in IMG/M |
| 3300009182|Ga0114959_10183891 | Not Available | 1091 | Open in IMG/M |
| 3300009184|Ga0114976_10105704 | Not Available | 1603 | Open in IMG/M |
| 3300009184|Ga0114976_10621295 | Not Available | 547 | Open in IMG/M |
| 3300009194|Ga0114983_1000584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15269 | Open in IMG/M |
| 3300009419|Ga0114982_1170658 | Not Available | 672 | Open in IMG/M |
| 3300009419|Ga0114982_1244524 | Not Available | 558 | Open in IMG/M |
| 3300009684|Ga0114958_10498071 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009684|Ga0114958_10562670 | Not Available | 546 | Open in IMG/M |
| 3300010158|Ga0114960_10030849 | All Organisms → cellular organisms → Bacteria | 3349 | Open in IMG/M |
| 3300010354|Ga0129333_10047407 | Not Available | 4035 | Open in IMG/M |
| 3300010354|Ga0129333_10638882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300010885|Ga0133913_10047645 | Not Available | 11520 | Open in IMG/M |
| 3300010885|Ga0133913_10828149 | Not Available | 2409 | Open in IMG/M |
| 3300010885|Ga0133913_10983083 | Not Available | 2184 | Open in IMG/M |
| 3300010885|Ga0133913_13599468 | Not Available | 1006 | Open in IMG/M |
| 3300012345|Ga0157139_1005853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300012352|Ga0157138_1005978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2033 | Open in IMG/M |
| 3300012352|Ga0157138_1028927 | Not Available | 881 | Open in IMG/M |
| 3300012663|Ga0157203_1000096 | Not Available | 31220 | Open in IMG/M |
| 3300012667|Ga0157208_10048280 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012779|Ga0138284_1429321 | Not Available | 971 | Open in IMG/M |
| 3300013004|Ga0164293_10094567 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
| 3300013005|Ga0164292_10238770 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300014960|Ga0134316_1037994 | Not Available | 550 | Open in IMG/M |
| 3300014962|Ga0134315_1008028 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300014962|Ga0134315_1054889 | Not Available | 613 | Open in IMG/M |
| 3300018415|Ga0181559_10736923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300020151|Ga0211736_10309850 | Not Available | 659 | Open in IMG/M |
| 3300020160|Ga0211733_10070651 | Not Available | 580 | Open in IMG/M |
| 3300020160|Ga0211733_11051184 | Not Available | 544 | Open in IMG/M |
| 3300020161|Ga0211726_10372145 | Not Available | 35771 | Open in IMG/M |
| 3300020161|Ga0211726_10382286 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300020172|Ga0211729_10050081 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300020205|Ga0211731_10850211 | Not Available | 3721 | Open in IMG/M |
| 3300020205|Ga0211731_11430967 | Not Available | 697 | Open in IMG/M |
| 3300020482|Ga0208464_102367 | Not Available | 1416 | Open in IMG/M |
| 3300021141|Ga0214163_1066545 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales | 893 | Open in IMG/M |
| 3300021438|Ga0213920_1075533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300022591|Ga0236341_1000002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 227819 | Open in IMG/M |
| 3300022591|Ga0236341_1000030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 79770 | Open in IMG/M |
| 3300022594|Ga0236340_1008636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3349 | Open in IMG/M |
| 3300022594|Ga0236340_1103834 | Not Available | 539 | Open in IMG/M |
| 3300022752|Ga0214917_10053022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2720 | Open in IMG/M |
| 3300023311|Ga0256681_12231056 | Not Available | 702 | Open in IMG/M |
| 3300024289|Ga0255147_1000471 | Not Available | 11536 | Open in IMG/M |
| 3300024346|Ga0244775_10008096 | Not Available | 10200 | Open in IMG/M |
| 3300024346|Ga0244775_10044725 | All Organisms → Viruses → Predicted Viral | 3882 | Open in IMG/M |
| 3300024346|Ga0244775_10270933 | All Organisms → Viruses → Predicted Viral | 1412 | Open in IMG/M |
| 3300024346|Ga0244775_10346324 | Not Available | 1227 | Open in IMG/M |
| 3300024352|Ga0255142_1002540 | All Organisms → Viruses → Predicted Viral | 3328 | Open in IMG/M |
| 3300024506|Ga0255168_1009836 | Not Available | 1858 | Open in IMG/M |
| 3300024506|Ga0255168_1067573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300025723|Ga0208741_10037491 | Not Available | 1127 | Open in IMG/M |
| 3300026573|Ga0255269_1016016 | Not Available | 2032 | Open in IMG/M |
| 3300027365|Ga0209300_1004123 | Not Available | 4923 | Open in IMG/M |
| 3300027586|Ga0208966_1040142 | Not Available | 1353 | Open in IMG/M |
| 3300027631|Ga0208133_1031980 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300027708|Ga0209188_1005372 | Not Available | 8241 | Open in IMG/M |
| 3300027708|Ga0209188_1006852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6989 | Open in IMG/M |
| 3300027708|Ga0209188_1137925 | Not Available | 934 | Open in IMG/M |
| 3300027710|Ga0209599_10001073 | Not Available | 14154 | Open in IMG/M |
| 3300027710|Ga0209599_10127976 | Not Available | 672 | Open in IMG/M |
| 3300027710|Ga0209599_10186505 | Not Available | 558 | Open in IMG/M |
| 3300027734|Ga0209087_1045388 | Not Available | 2031 | Open in IMG/M |
| 3300027741|Ga0209085_1000464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29816 | Open in IMG/M |
| 3300027741|Ga0209085_1291396 | Not Available | 625 | Open in IMG/M |
| 3300027747|Ga0209189_1001221 | Not Available | 19641 | Open in IMG/M |
| 3300027782|Ga0209500_10000063 | Not Available | 99149 | Open in IMG/M |
| 3300027782|Ga0209500_10258169 | Not Available | 756 | Open in IMG/M |
| 3300027805|Ga0209229_10004332 | Not Available | 5920 | Open in IMG/M |
| 3300027805|Ga0209229_10080194 | Not Available | 1466 | Open in IMG/M |
| 3300027805|Ga0209229_10092964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1357 | Open in IMG/M |
| 3300027963|Ga0209400_1005505 | All Organisms → cellular organisms → Bacteria | 8678 | Open in IMG/M |
| 3300027969|Ga0209191_1000007 | Not Available | 201439 | Open in IMG/M |
| 3300027969|Ga0209191_1125424 | Not Available | 1069 | Open in IMG/M |
| 3300031758|Ga0315907_10002359 | Not Available | 23893 | Open in IMG/M |
| 3300031758|Ga0315907_10134789 | Not Available | 2100 | Open in IMG/M |
| 3300031758|Ga0315907_10142124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2038 | Open in IMG/M |
| 3300033992|Ga0334992_0092733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1628 | Open in IMG/M |
| 3300033992|Ga0334992_0180985 | Not Available | 1061 | Open in IMG/M |
| 3300034066|Ga0335019_0003716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10228 | Open in IMG/M |
| 3300034066|Ga0335019_0618403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300034071|Ga0335028_0126931 | All Organisms → Viruses → Predicted Viral | 1645 | Open in IMG/M |
| 3300034082|Ga0335020_0259836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300034082|Ga0335020_0298843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300034093|Ga0335012_0179073 | Not Available | 1136 | Open in IMG/M |
| 3300034093|Ga0335012_0435786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300034102|Ga0335029_0205484 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300034102|Ga0335029_0390029 | Not Available | 844 | Open in IMG/M |
| 3300034105|Ga0335035_0632289 | Not Available | 561 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 25.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.03% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.33% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 5.56% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.56% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.86% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 3.47% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.47% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.78% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 2.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.39% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.39% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.39% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.69% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.69% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.69% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.69% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001837 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a | Environmental | Open in IMG/M |
| 3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012345 | Freshwater microbial communities from Burnt River, Ontario, Canada - S22 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020482 | Freshwater microbial communities from Lake Mendota, WI - 13SEPL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022594 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1 | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM27_10008809 | 3300001836 | Marine Plankton | MNKIIDKDWLERVTIAYQAYPHPSKEIKAFISWVYKQYGIVERKQDK* |
| RCM39_10483702 | 3300001837 | Marine Plankton | MNIFNDKDWLERVTTAYRVYPYPNKEIEAFIRWLYKEYGIVPPEERNK* |
| RCM39_10863152 | 3300001837 | Marine Plankton | MTDKDWLSRVTIAYRAYPYPSKEIEAFISWMYKQYGIVEKKEDK* |
| RCM33_10540452 | 3300001838 | Marine Plankton | MNMTDKDWLERVSVAYKAYLFPNKEIEAFIKWMYEQYGIVQPKEEEK* |
| RCM30_11164193 | 3300001842 | Marine Plankton | EWLEKIGVAYRAYPYPSKDIEKFISWLYNQYGIVEKKDNK* |
| RCM41_11014081 | 3300001847 | Marine Plankton | MIDKEWLERIEIAYRVYPFPNKDIEKFISWLYNQYGIVKNERK* |
| RCM37_10045562 | 3300001850 | Marine Plankton | MNKIIDKDWLERVTIAYQAYPHPSKEIKAFISWVYKQYGIVEKKQDK* |
| RCM37_10390644 | 3300001850 | Marine Plankton | MNMTDKDWLSRVTIAYRAYPYPSKEIEAFISWMYKQYGIVEKKEDK* |
| GOS2236_10582588 | 3300001968 | Marine | MNHNIIQDKDWLQKVSTAYKAFPYPNKEIESFISWLYKQYGIVEKKEEK* |
| JGI24766J26685_100351892 | 3300002161 | Freshwater And Sediment | MNMTDKDWLERIQIAYKAYPYLSKDIEAFISWVYKQYGIVEPKDQK* |
| JGI24766J26685_100364765 | 3300002161 | Freshwater And Sediment | DWLKRVSTAYQAYPYPSKDIERFIKWLYEQYGIVEPGKKSD* |
| B570J40625_1006170532 | 3300002835 | Freshwater | MTDKDWLKKVSIAYKAYPCPSKEIESFIKWIYNQYGIVPPKGKE* |
| B570J40625_1012027562 | 3300002835 | Freshwater | MKMTDKDWLKRVTTAYQAYPYPSKEIERFVKWMYEQYGIVEPVKDKHD* |
| JGI25911J50253_101589972 | 3300003411 | Freshwater Lake | MIDKDWLERVITAYKAYPYPNVEIEHFLNWLYSQYGIVPPKGKE* |
| Ga0007829_100237383 | 3300004095 | Freshwater | MKDKNWLEKITVAYKVYPYPSKEIENFISWLYKQYGIIEKEKGKNDTNNKRHN* |
| Ga0065166_100291552 | 3300004112 | Freshwater Lake | MNMIDKDWLDRIKIAYKAYPFPNKDIEAFISWIYKQYGILEKKDKE* |
| Ga0007787_101415372 | 3300004240 | Freshwater Lake | MIDKDWLERIVIAYRAYPYPSVEIEKFIHWIYKQYGIVQEKKDGKS* |
| Ga0068876_104185862 | 3300005527 | Freshwater Lake | MIDKDWLSRIEIAYKAYPYPNKEIERFIQWIYKQYGIVQPEKKDGNS* |
| Ga0068876_105225712 | 3300005527 | Freshwater Lake | MNDKDWLEKISIAYKAYPYPSKEIESFINWMYKQYGILQPEKIDGQS* |
| Ga0049084_101104603 | 3300005585 | Freshwater Lentic | MDMTDKDWLDRISIAYKVYPYPNKEIEGFIKWMYDQYGIVIPEDRK* |
| Ga0078894_100880694 | 3300005662 | Freshwater Lake | MKLTDKDWLKKVTTAYQAYPYPSKDIERFVKWMYEQYGIVEPTKDKK* |
| Ga0078894_101327983 | 3300005662 | Freshwater Lake | MNMTDKDWLERVSIAYRAYTYPSKEIESFIKWMYEQYGIIPPKGKE* |
| Ga0078894_102573463 | 3300005662 | Freshwater Lake | MTDKDWLERVTIAYKAYPYPSKEIERYIKWLYEQYGIVQHKEKNNDK* |
| Ga0078894_104943852 | 3300005662 | Freshwater Lake | MKMTDKDWLARITIAYKAYPYPSKEIERFVKWLYEQYGIVQPRDKKDD* |
| Ga0078894_105012612 | 3300005662 | Freshwater Lake | MAQQLNDKDWLEKVTIAYKVYPYPNYQISEFISWLYKQYGIVQPKEKNEDRI* |
| Ga0078894_108022902 | 3300005662 | Freshwater Lake | MKLTDKDWLKKVTTAYQAYPYPSKDIERFVKWMYEQYGIVE |
| Ga0078894_113392894 | 3300005662 | Freshwater Lake | MKLTDKDWLKKVTTAYQAYPYPSKDIERFVKWMYEQYGIVEPTK |
| Ga0079957_12620202 | 3300005805 | Lake | MNMIDKDWLERIIIAYKAYPYPNKDIESFINWLYKQYGIIQPK* |
| Ga0070744_1000034518 | 3300006484 | Estuarine | MIDKNWLERITVAYRVYPYPSKEVERFIKWLYEQYGIVEPNKDKE* |
| Ga0070744_100290493 | 3300006484 | Estuarine | MIDKNWLERITVAYRVYPYPNKEVERFIKWLYEQYGIVEPTKDKK* |
| Ga0070744_100585742 | 3300006484 | Estuarine | MQMTDKDWLKRVSTAYQAYPYPSKDIERFIKWLYEQYGIVEPGKKSD* |
| Ga0075471_102652102 | 3300006641 | Aqueous | MIDKDWLERIVIAYRVYPFPNKEIESFINWLYKQYGIVQDDKK* |
| Ga0075471_106810843 | 3300006641 | Aqueous | MIDKDWLERIIIAYKVYPYPSNDIEQFINWLYKQYGIVQNDKK* |
| Ga0114340_1000005163 | 3300008107 | Freshwater, Plankton | LQALYGIGNIMNMTDKDWLERVSIAYRAYTYPSKEIESFIKWMYEQYGIIPPKGKE* |
| Ga0114340_12084962 | 3300008107 | Freshwater, Plankton | MIDKEWLTKIEIAYKAYPYPSKEIESFIQWIYKQYGIVQEKKDGQS* |
| Ga0114341_100044769 | 3300008108 | Freshwater, Plankton | MIDKEWLTKIEIAYKAYPYPSKDVERFIQWIYKQYGIVQEKKDGKS* |
| Ga0114350_10288052 | 3300008116 | Freshwater, Plankton | MQLTDKDWLEKVTIAYRAYPYPNKDIEAYIHWLYKQYGIVVPEDKQ* |
| Ga0114350_10429262 | 3300008116 | Freshwater, Plankton | MIDKDWLSRIEIAYKAYPYPNKEIERFIQWIYKQYGIVQEKKDGNS* |
| Ga0102814_106631022 | 3300009079 | Estuarine | MTDKDWLKRVTVAYQAYPYPSKEIERYIKWLYEQYGIVEPGKKSD* |
| Ga0105098_106028072 | 3300009081 | Freshwater Sediment | MNITDKDWLEKVTIAYRAYPFPNKDIEVFISWIYKQYGILEKKDKN* |
| Ga0114980_105869332 | 3300009152 | Freshwater Lake | MKDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK* |
| Ga0114963_100010003 | 3300009154 | Freshwater Lake | MNMTDKDWLERISIAYKAYPYPSKDIESFIKWIYEQYGIVQAK* |
| Ga0114963_105155703 | 3300009154 | Freshwater Lake | MILNDKDWLEKIDIAYKVYPYPSKDIEQYIEWLYKQYGIVQPKERKQ* |
| Ga0114968_1000320222 | 3300009155 | Freshwater Lake | MTDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK* |
| Ga0114978_1000000551 | 3300009159 | Freshwater Lake | MNMTDKDWLERVTIAYRAYPYPSKDLETFIHWLYNQYGIVEPKKENDD* |
| Ga0114978_100723413 | 3300009159 | Freshwater Lake | MTDKDWLERISIAYKAYPCPSKEIEAFIKWIYEQYGIVIPKEGYR* |
| Ga0114978_100966522 | 3300009159 | Freshwater Lake | MKDKDWLERISIAYKVYPFPSKEIEAFITWLYNQYGIVKPESKDGKS* |
| Ga0114978_102875952 | 3300009159 | Freshwater Lake | MKLNDKSWLEKVTTAYRAYPYPSKEIERFINWLYKQYGIVEPTERNK* |
| Ga0114981_100606282 | 3300009160 | Freshwater Lake | MNMKDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK* |
| Ga0114975_1000007447 | 3300009164 | Freshwater Lake | MKNKMIDKDWLERVTIAYQAYPYPSKEVERFIQWLYKQYGIVEPVKDKNENRF* |
| Ga0114975_102198752 | 3300009164 | Freshwater Lake | MDMTDKDWLERVMIAYKAYPYPNKEIEAFIKWMYEQYGIVMPEDKK* |
| Ga0114975_106967202 | 3300009164 | Freshwater Lake | MEMTDKDWLERVLIAYKAYPYPSKEIERFTVWLYKQYGIVHPKEEKNEV* |
| Ga0114979_104851213 | 3300009180 | Freshwater Lake | MTDKDWLERISIAYKAYPYPSKEIEAFIKWIYEQYGIVIPKEGYR* |
| Ga0114959_101298782 | 3300009182 | Freshwater Lake | MIDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK* |
| Ga0114959_101838912 | 3300009182 | Freshwater Lake | MNMTDKDWLNRVTIAYREYSYPNKEIEAFITWLYEQYGIVPPNEGKK* |
| Ga0114976_101057041 | 3300009184 | Freshwater Lake | MNMKDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYG |
| Ga0114976_106212951 | 3300009184 | Freshwater Lake | NMKDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK* |
| Ga0114983_10005844 | 3300009194 | Deep Subsurface | MTDKDWLKRVSVAYQAYPYPSKEIERYIKWLYEQYGIVEPGKKSD* |
| Ga0114982_11706582 | 3300009419 | Deep Subsurface | VYYGIGINMNMTDKDWLERVTIAYKAYQYPSKDLEAFIKWMYQQYGIVHPKDKE* |
| Ga0114982_12445242 | 3300009419 | Deep Subsurface | MNMIDKDWLERVTIAYRAYPYPSKDIETFIHWLYNQYGIVEPKKENND* |
| Ga0114958_104980712 | 3300009684 | Freshwater Lake | MNMTDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK* |
| Ga0114958_105626702 | 3300009684 | Freshwater Lake | MLINDKDWLEKIIVAYRAYPYPSKEIERLTAWLYKQYGVVQPEEGKK* |
| Ga0114960_100308495 | 3300010158 | Freshwater Lake | MNMADKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK* |
| Ga0129333_100474073 | 3300010354 | Freshwater To Marine Saline Gradient | MIDKQWLEKIITAYAAYPHPSLDIENFIKWIYKQYGIVPPNKDKQ* |
| Ga0129333_106388822 | 3300010354 | Freshwater To Marine Saline Gradient | MNMNDQDWLHRVSIAYKVYPYPNKDIETFVSWLYKQYGIIEKKDKE* |
| Ga0133913_1004764510 | 3300010885 | Freshwater Lake | MIDRDWLERISIAYRAYPFPNKNIEAFIEWLYKQYGIVKSESNDGNT* |
| Ga0133913_108281492 | 3300010885 | Freshwater Lake | MIDKDWLERVTTAYKAYPYPNVEIERFLNWLYSQYGIVPPKGKE* |
| Ga0133913_109830831 | 3300010885 | Freshwater Lake | MNLTDKDWLEKIIIAYNVYPYPSKEIERFTAWLYKQYGVVQPEDGKK* |
| Ga0133913_135994682 | 3300010885 | Freshwater Lake | MLINDKDWLEKIIVAYRAYPYPSKEIERFTAWLYKQYGVVQPEEGKK* |
| Ga0157139_10058532 | 3300012345 | Freshwater | MIDKQWLERINIAYKAYPFPSKEIEAFVDWLYKQYGILNPENKDGKS* |
| Ga0157138_10059782 | 3300012352 | Freshwater | MTDKDWLERITIAYRAYPYPNKDIESFISWIYKQYGIVQPKDKE* |
| Ga0157138_10289272 | 3300012352 | Freshwater | MAQQLNDKDWLEKVTIAYRAYPYPNKDIESFITWIYKQYGIVQPKGKE* |
| Ga0157203_100009618 | 3300012663 | Freshwater | MTDKDWLERITIAYKAYPYPNKEIENFVKWIYEQYGIVMTKND* |
| Ga0157208_100482802 | 3300012667 | Freshwater | MTDKDWLERVTIAYRVYSYPNKDIENFIHWLYKQYGIVEPTKDKE* |
| Ga0138284_14293211 | 3300012779 | Freshwater Lake | MKLNDKGWLEKVTTAYRAYPYPSKEIERFINWLYKQYGIVEPTERN* |
| Ga0164293_100945672 | 3300013004 | Freshwater | MAQQLNDKDWLEKVSIAHRAYPYPSKDIERFINWLYKQYGIVQPKEGKQ* |
| Ga0164292_102387702 | 3300013005 | Freshwater | MAQQLNDKDWLEKVSVAHRAYPYPNKDIERFISWLYKQYGIVQPKEGKQ* |
| Ga0134316_10379941 | 3300014960 | Surface Water | MTDKDWLERVKIAYKAYPYPSKEIEAFISWVYKQYGIVEKKDKDESQHK* |
| Ga0134315_10080283 | 3300014962 | Surface Water | MIDKEWLERISIAYKVYPYPNYQVSEFISWLYKQYGIVPPTEKK* |
| Ga0134315_10548891 | 3300014962 | Surface Water | MNMNDKDWLQRVSIAYRAYPYPNLDIEKFIAWLYNQYGIVQPKEDNK* |
| Ga0181559_107369232 | 3300018415 | Salt Marsh | MIEKDWLERILVAYKVYPFPNKDIEAFISWLYQQYGIVKPDDKK |
| Ga0211736_103098502 | 3300020151 | Freshwater | MKDKDWLERVTIAYKAYPYPNIEIDRFLNWLYSQYGIVQPKKDNK |
| Ga0211733_100706512 | 3300020160 | Freshwater | MNMTDKDWLERVTIAYRAYPYPSKDVETFIHWLYNQYGIVEPKKENDD |
| Ga0211733_110511842 | 3300020160 | Freshwater | MKLTDKDWLEKVTVAYRAYPYPSKEIERFVKWLYEQYGIVEPGKKSD |
| Ga0211726_103721454 | 3300020161 | Freshwater | MNMTDKDWLERVTIAYRAYPYPSKDLETFIHWLYNQYGIVEPKKENND |
| Ga0211726_103822862 | 3300020161 | Freshwater | MQMTDKDWLERVSVAYRAYPYPSKDIERFVQWMYKQYGIIQPTEGNK |
| Ga0211729_100500812 | 3300020172 | Freshwater | MAQQLNDKDWLEKISVAYRAYPYPNKDIERFISWLYKQYGIVQPKEGKQ |
| Ga0211731_108502111 | 3300020205 | Freshwater | MKLTDKDWLQKVTTAYKEYPYPNKEIERFINWLYRQYGIVEPTKDKK |
| Ga0211731_114309671 | 3300020205 | Freshwater | MTDKDWLERVSVAYRAYPYPSKDIERFVQWMYKQYGIIQPT |
| Ga0208464_1023672 | 3300020482 | Freshwater | MNMMDKDWLERIIIAYKAYPYPNKDIESFINWLYKQYGIVQPK |
| Ga0214163_10665451 | 3300021141 | Freshwater | MNMTDKDWLKKVSIAYKAYPCPSKEIESFIKWIYNQYGIVPPKGKE |
| Ga0213920_10755332 | 3300021438 | Freshwater | MIDKDWLERIGIAYKVYPYPSTDIEAFIAWLYKQYGVVPPNDKK |
| Ga0236341_10000022 | 3300022591 | Freshwater | MNDKQWLERVSLAYKAYPYPNKDIEAFVTWIYKQYGVIPPNDKK |
| Ga0236341_10000309 | 3300022591 | Freshwater | MIDKDWLERIVIAYKVYPYPSKEIEAFITWLYKQYGIVQNDKE |
| Ga0236340_10086363 | 3300022594 | Freshwater | MIDKDWLERISIAYRVYPFPNKEIEAFIDWLYKQYGVVPPNDKN |
| Ga0236340_11038341 | 3300022594 | Freshwater | MIDKDWLDRISIAYRVYPFPNKEIEAFIDCLYKQYGVVPPNDK |
| Ga0214917_100530223 | 3300022752 | Freshwater | MILTDKDWLEKVTTAYKVYPYPSKDIEAFIKWLYQQYGIVEPIKK |
| Ga0256681_122310562 | 3300023311 | Freshwater | MIDKDWLERINIAYRVYPFPSKEIEAFIEWLYKQYGIVKPENKDGKS |
| Ga0255147_10004713 | 3300024289 | Freshwater | MIDKDWLERITIAYKAYPYPNKDIEQFIQWIYDQYGIVKPEKRDGKS |
| Ga0244775_1000809612 | 3300024346 | Estuarine | MDMTDKDWLDRISIAYKVYPYPNKEIEGFIKWMYDQYGIVIPEDRK |
| Ga0244775_100447252 | 3300024346 | Estuarine | MIDKNWLERITVAYRVYPYPSKEVERFIKWLYEQYGIVEPNKDKE |
| Ga0244775_102709332 | 3300024346 | Estuarine | MQMTDKDWLKRVSTAYQAYPYPSKDIERFIKWLYEQYGIVEPGKKSD |
| Ga0244775_103463243 | 3300024346 | Estuarine | MIDKNWLERITVAYRVYPYPNKEVERFIKWLYEQYGIVEPTKDKK |
| Ga0255142_10025406 | 3300024352 | Freshwater | MIDKDWLERITIAYKAYPYPNKDIEQFIQWIYDQYGIVKPEKQDGKS |
| Ga0255168_10098363 | 3300024506 | Freshwater | MIDKDWLERITIAYKAYPYPNKDIEQFIQWIYDQYGIVKPEKRDG |
| Ga0255168_10675731 | 3300024506 | Freshwater | TIRQDTMIDKDWLERITIAYKAYPYPNKDIEQFIQWIYDQYGFVKPEKRDGKS |
| Ga0208741_100374913 | 3300025723 | Freshwater | MKDKNWLEKITVAYKVYPYPSKEIENFISWLYKQYGIIEKEKGKNDTNNKRHN |
| Ga0255269_10160163 | 3300026573 | Freshwater | MIDKDWLERIIIAYKAYPYPNKDIEQFIQWIYDQYGIVKPEKRDGKS |
| Ga0209300_10041234 | 3300027365 | Deep Subsurface | MQMTDKDWLKRVSVAYQAYPYPSKEIERYIKWLYEQYGIVEPGKKSD |
| Ga0208966_10401422 | 3300027586 | Freshwater Lentic | MIDKDWLERVITAYKAYPYPNVEIEHFLNWLYSQYGIVPPKGKE |
| Ga0208133_10319802 | 3300027631 | Estuarine | MTDKDWLKRVSTAYQAYPYPSKDIERFIKWLYEQYGIVEPGKKSD |
| Ga0209188_10053722 | 3300027708 | Freshwater Lake | MTDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK |
| Ga0209188_100685217 | 3300027708 | Freshwater Lake | MNMIDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK |
| Ga0209188_11379251 | 3300027708 | Freshwater Lake | MNMTDKDWLNRVTIAYREYSYPNKEIEAFITWLYEQYGIVPPNEGKK |
| Ga0209599_1000107313 | 3300027710 | Deep Subsurface | MTDKDWLKRVSVAYQAYPYPSKEIERYIKWLYEQYGIVEPGKKSD |
| Ga0209599_101279762 | 3300027710 | Deep Subsurface | VYYGIGINMNMTDKDWLERVTIAYKAYQYPSKDLEAFIKWMYQQYGIVHPKDKE |
| Ga0209599_101865052 | 3300027710 | Deep Subsurface | MNMIDKDWLERVTIAYRAYPYPSKDIETFIHWLYNQYGIVEPKKENND |
| Ga0209087_10453884 | 3300027734 | Freshwater Lake | MKDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK |
| Ga0209085_100046432 | 3300027741 | Freshwater Lake | MTDKDWLERISIAYKAYPYPSKDIESFIKWIYEQYGIVQAK |
| Ga0209085_12913963 | 3300027741 | Freshwater Lake | MILNDKDWLEKIDIAYKVYPYPSKDIEQYIEWLYKQYGIVQPKERKQ |
| Ga0209189_10012211 | 3300027747 | Freshwater Lake | MNMTDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK |
| Ga0209500_1000006387 | 3300027782 | Freshwater Lake | MNMTDKDWLERVTIAYRAYPYPSKDLETFIHWLYNQYGIVEPKKENDD |
| Ga0209500_102581691 | 3300027782 | Freshwater Lake | MKLNDKSWLEKVTTAYRAYPYPSKEIERFINWLYKQYGIVEPTERNK |
| Ga0209229_100043326 | 3300027805 | Freshwater And Sediment | MNMTDKDWLERIQIAYKAYPYLSKDIEAFISWVYKQYGIVEPKDQK |
| Ga0209229_100801941 | 3300027805 | Freshwater And Sediment | MNMTDKDWLERVKIAYKAYPFPSKDIEHFISWLYKQYGIIETKDKK |
| Ga0209229_100929643 | 3300027805 | Freshwater And Sediment | MNMTDKDWLERVQIAYKAYPYPSKDIETFISWLYKQYGIVEPNSKLTSNN |
| Ga0209400_10055059 | 3300027963 | Freshwater Lake | DIGDIMNMTDKDWLERISIAYKAYPYPSKDVESFIKWIYEQYGIVQAK |
| Ga0209191_1000007200 | 3300027969 | Freshwater Lake | MIDKDWLERVTIAYQAYPYPSKEVERFIQWLYKQYGIVEPVKDKNENRF |
| Ga0209191_11254242 | 3300027969 | Freshwater Lake | MDMTDKDWLERVMIAYKAYPYPNKEIEAFIKWMYEQYGIVMPEDKK |
| Ga0315907_100023593 | 3300031758 | Freshwater | MNDKDWLEKISIAYKAYPYPSKEIESFINWMYKQYGILQPEKIDGQS |
| Ga0315907_101347894 | 3300031758 | Freshwater | MIDKDWLSRIEIAYKAYPYPNKEIERFIQWIYKQYGIVQEKKDGNS |
| Ga0315907_101421244 | 3300031758 | Freshwater | MQLTDKDWLEKVTIAYRAYPYPNKDIEAYIHWLYKQYGIVVPEDKQ |
| Ga0334992_0092733_524_667 | 3300033992 | Freshwater | MQMTDKDWLKRVSTAYQVYPYPSKDIERFIKWLYEQYGIIEPGKKSD |
| Ga0334992_0180985_568_702 | 3300033992 | Freshwater | MTDKDWLERVTIAYKAYPYPSKEIERFIKWMYEQYGIVAPKDAE |
| Ga0335019_0003716_7862_7999 | 3300034066 | Freshwater | MTDKDWLERVTIAYRAYPYPNKEIERFVKWLYEQYGIVAPKEKDE |
| Ga0335019_0618403_426_569 | 3300034066 | Freshwater | MKMTDKDWLERVTIAYKAYPYPSKEIERYIKWLYEQYGIVQHKENQE |
| Ga0335028_0126931_604_750 | 3300034071 | Freshwater | MKMTDKDWLKRVTTAYQAYPYPSKEIERFVKWMYEQYGIVEPVKDKHD |
| Ga0335020_0259836_224_373 | 3300034082 | Freshwater | MAQQLNDKDWLEKVSVAHRAYPYPNKDIERFISWLYKQYGIVQPKEGKQ |
| Ga0335020_0298843_399_536 | 3300034082 | Freshwater | MTDKDWLERVTIAYQAYPYPNKNIELFVNWLYKQYGIVQPNKKSD |
| Ga0335012_0179073_2_121 | 3300034093 | Freshwater | LEKVSIAHRAYPYPSKDIERFINWLYKQYGIVQPKEGKQ |
| Ga0335012_0435786_359_490 | 3300034093 | Freshwater | MNMTDKDWLERVTIAYRAYPYPNKDIKTFIKWVYEQYGIVHPD |
| Ga0335029_0205484_178_324 | 3300034102 | Freshwater | MNMTDKDWLERVTIAYRAYPYPSKDIETFIHWMYNQYGIVEPKKENDD |
| Ga0335029_0390029_356_502 | 3300034102 | Freshwater | MNMTDKDWLERVTIAYRAYPYPSKEIEEFIHWLYNQYGIVEPKKDNND |
| Ga0335035_0632289_2_130 | 3300034105 | Freshwater | MTDKDWLERVTIAYKAYPYPSKEIERFIKWMYEQYGIVAPKDA |
| ⦗Top⦘ |