Basic Information | |
---|---|
Family ID | F051100 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 144 |
Average Sequence Length | 39 residues |
Representative Sequence | SLLFLELSGYCVNAVQLHVSAADVLVRRGIDRDGFR |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 144 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 5.56 % |
% of genes near scaffold ends (potentially truncated) | 93.06 % |
% of genes from short scaffolds (< 2000 bps) | 86.11 % |
Associated GOLD sequencing projects | 117 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (59.722 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.056 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.139 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.139 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 144 Family Scaffolds |
---|---|---|
PF00903 | Glyoxalase | 2.08 |
PF00144 | Beta-lactamase | 2.08 |
PF03704 | BTAD | 2.08 |
PF01548 | DEDD_Tnp_IS110 | 2.08 |
PF00884 | Sulfatase | 1.39 |
PF02899 | Phage_int_SAM_1 | 1.39 |
PF01906 | YbjQ_1 | 1.39 |
PF00106 | adh_short | 1.39 |
PF13561 | adh_short_C2 | 1.39 |
PF00440 | TetR_N | 1.39 |
PF13302 | Acetyltransf_3 | 1.39 |
PF02371 | Transposase_20 | 1.39 |
PF12146 | Hydrolase_4 | 1.39 |
PF00005 | ABC_tran | 1.39 |
PF04978 | DUF664 | 1.39 |
PF08448 | PAS_4 | 1.39 |
PF01757 | Acyl_transf_3 | 1.39 |
PF13191 | AAA_16 | 0.69 |
PF02627 | CMD | 0.69 |
PF00582 | Usp | 0.69 |
PF13359 | DDE_Tnp_4 | 0.69 |
PF00583 | Acetyltransf_1 | 0.69 |
PF13350 | Y_phosphatase3 | 0.69 |
PF09278 | MerR-DNA-bind | 0.69 |
PF04075 | F420H2_quin_red | 0.69 |
PF00491 | Arginase | 0.69 |
PF13493 | DUF4118 | 0.69 |
PF07859 | Abhydrolase_3 | 0.69 |
PF00578 | AhpC-TSA | 0.69 |
PF00892 | EamA | 0.69 |
PF01593 | Amino_oxidase | 0.69 |
PF13305 | TetR_C_33 | 0.69 |
PF01609 | DDE_Tnp_1 | 0.69 |
PF05199 | GMC_oxred_C | 0.69 |
PF06974 | WS_DGAT_C | 0.69 |
PF12727 | PBP_like | 0.69 |
PF03176 | MMPL | 0.69 |
PF00248 | Aldo_ket_red | 0.69 |
PF00239 | Resolvase | 0.69 |
PF13613 | HTH_Tnp_4 | 0.69 |
PF13560 | HTH_31 | 0.69 |
PF03070 | TENA_THI-4 | 0.69 |
PF11774 | Lsr2 | 0.69 |
PF13424 | TPR_12 | 0.69 |
PF06723 | MreB_Mbl | 0.69 |
PF09594 | GT87 | 0.69 |
PF00368 | HMG-CoA_red | 0.69 |
PF01544 | CorA | 0.69 |
PF04402 | SIMPL | 0.69 |
PF13577 | SnoaL_4 | 0.69 |
PF01545 | Cation_efflux | 0.69 |
PF09587 | PGA_cap | 0.69 |
PF03466 | LysR_substrate | 0.69 |
PF01039 | Carboxyl_trans | 0.69 |
COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.47 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 2.08 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.08 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 2.08 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 2.08 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 2.08 |
COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 1.39 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 1.39 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 1.39 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.69 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.69 |
COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.69 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.69 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.69 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.69 |
COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.69 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.69 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.69 |
COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.69 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.69 |
COG1257 | Hydroxymethylglutaryl-CoA reductase | Lipid transport and metabolism [I] | 0.69 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.69 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.69 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.69 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.69 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.69 |
COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.69 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.69 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.69 |
COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.69 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.69 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.69 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.69 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 59.72 % |
Unclassified | root | N/A | 40.28 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_108792696 | Not Available | 668 | Open in IMG/M |
3300005445|Ga0070708_100488207 | Not Available | 1162 | Open in IMG/M |
3300005471|Ga0070698_100265086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Glycomyces → unclassified Glycomyces → Glycomyces sp. L485 | 1650 | Open in IMG/M |
3300005518|Ga0070699_102058325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 522 | Open in IMG/M |
3300005713|Ga0066905_101615319 | Not Available | 593 | Open in IMG/M |
3300005921|Ga0070766_10609913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis acidiphila | 733 | Open in IMG/M |
3300005995|Ga0066790_10130198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1078 | Open in IMG/M |
3300006028|Ga0070717_10851140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 830 | Open in IMG/M |
3300006086|Ga0075019_11108702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
3300006605|Ga0074057_11496042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
3300006804|Ga0079221_11793469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
3300006806|Ga0079220_12154216 | Not Available | 500 | Open in IMG/M |
3300007788|Ga0099795_10281869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
3300009519|Ga0116108_1000700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 18619 | Open in IMG/M |
3300009523|Ga0116221_1130833 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300009632|Ga0116102_1108029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 794 | Open in IMG/M |
3300009672|Ga0116215_1039978 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
3300009698|Ga0116216_10040339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2890 | Open in IMG/M |
3300009824|Ga0116219_10164946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1277 | Open in IMG/M |
3300010046|Ga0126384_11703848 | Not Available | 596 | Open in IMG/M |
3300010047|Ga0126382_10099008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1878 | Open in IMG/M |
3300010048|Ga0126373_12043064 | Not Available | 635 | Open in IMG/M |
3300010343|Ga0074044_10139294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium | 1625 | Open in IMG/M |
3300010359|Ga0126376_10076192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2475 | Open in IMG/M |
3300010359|Ga0126376_10127181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2000 | Open in IMG/M |
3300010366|Ga0126379_10962512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
3300010366|Ga0126379_13828263 | Not Available | 504 | Open in IMG/M |
3300010371|Ga0134125_12479605 | Not Available | 564 | Open in IMG/M |
3300010373|Ga0134128_10623039 | Not Available | 1200 | Open in IMG/M |
3300010379|Ga0136449_100355944 | Not Available | 2627 | Open in IMG/M |
3300010379|Ga0136449_100441142 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
3300010379|Ga0136449_101630896 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300010396|Ga0134126_11418378 | Not Available | 767 | Open in IMG/M |
3300010398|Ga0126383_11114061 | Not Available | 879 | Open in IMG/M |
3300010401|Ga0134121_10560264 | Not Available | 1063 | Open in IMG/M |
3300011269|Ga0137392_10164906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1796 | Open in IMG/M |
3300011270|Ga0137391_10549449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 973 | Open in IMG/M |
3300011270|Ga0137391_11371755 | Not Available | 553 | Open in IMG/M |
3300012096|Ga0137389_10169735 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
3300012201|Ga0137365_10023430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4781 | Open in IMG/M |
3300012201|Ga0137365_10490706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. 852002-50816_SCH5313054-b | 903 | Open in IMG/M |
3300012203|Ga0137399_10340417 | Not Available | 1244 | Open in IMG/M |
3300012206|Ga0137380_11198678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
3300012207|Ga0137381_10550988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1005 | Open in IMG/M |
3300012209|Ga0137379_10029074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5322 | Open in IMG/M |
3300012210|Ga0137378_10236226 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
3300012210|Ga0137378_11323986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → unclassified Saccharomonospora → Saccharomonospora sp. CUA-673 | 636 | Open in IMG/M |
3300012350|Ga0137372_10013042 | All Organisms → cellular organisms → Bacteria | 7928 | Open in IMG/M |
3300012359|Ga0137385_10580434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides | 944 | Open in IMG/M |
3300012360|Ga0137375_10073855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3586 | Open in IMG/M |
3300012363|Ga0137390_10570394 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300012363|Ga0137390_10610681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1058 | Open in IMG/M |
3300012363|Ga0137390_11604111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
3300012948|Ga0126375_10232232 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300012971|Ga0126369_13611671 | Not Available | 507 | Open in IMG/M |
3300014158|Ga0181521_10022223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5209 | Open in IMG/M |
3300014162|Ga0181538_10207246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1097 | Open in IMG/M |
3300014501|Ga0182024_11751712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 697 | Open in IMG/M |
3300016357|Ga0182032_10863541 | Not Available | 767 | Open in IMG/M |
3300016371|Ga0182034_11060464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans | 702 | Open in IMG/M |
3300016387|Ga0182040_11864355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium fulvum | 515 | Open in IMG/M |
3300016445|Ga0182038_10493443 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300017821|Ga0187812_1053044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1363 | Open in IMG/M |
3300017926|Ga0187807_1005360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3923 | Open in IMG/M |
3300017926|Ga0187807_1018367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2152 | Open in IMG/M |
3300017926|Ga0187807_1159887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
3300017932|Ga0187814_10039552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1743 | Open in IMG/M |
3300017938|Ga0187854_10158083 | Not Available | 1025 | Open in IMG/M |
3300017942|Ga0187808_10117411 | Not Available | 1162 | Open in IMG/M |
3300017942|Ga0187808_10120389 | Not Available | 1147 | Open in IMG/M |
3300017973|Ga0187780_11120025 | Not Available | 576 | Open in IMG/M |
3300018001|Ga0187815_10203339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02 | 839 | Open in IMG/M |
3300018006|Ga0187804_10288619 | Not Available | 713 | Open in IMG/M |
3300018007|Ga0187805_10579397 | Not Available | 529 | Open in IMG/M |
3300018012|Ga0187810_10197587 | Not Available | 817 | Open in IMG/M |
3300018021|Ga0187882_1401882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
3300018030|Ga0187869_10225283 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300018033|Ga0187867_10032444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces lushanensis | 3248 | Open in IMG/M |
3300019887|Ga0193729_1274477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
3300020150|Ga0187768_1109548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_67_15 | 631 | Open in IMG/M |
3300020581|Ga0210399_10591366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 918 | Open in IMG/M |
3300020581|Ga0210399_10899690 | Not Available | 718 | Open in IMG/M |
3300020581|Ga0210399_11354665 | Not Available | 558 | Open in IMG/M |
3300021171|Ga0210405_11079567 | Not Available | 601 | Open in IMG/M |
3300021181|Ga0210388_10094303 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
3300021404|Ga0210389_11095052 | Not Available | 616 | Open in IMG/M |
3300021433|Ga0210391_10575213 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300025910|Ga0207684_10178612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Glycomyces → unclassified Glycomyces → Glycomyces sp. L485 | 1830 | Open in IMG/M |
3300025910|Ga0207684_11036062 | Not Available | 685 | Open in IMG/M |
3300025915|Ga0207693_10127215 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
3300025915|Ga0207693_10966051 | Not Available | 652 | Open in IMG/M |
3300025922|Ga0207646_10437339 | Not Available | 1180 | Open in IMG/M |
3300025939|Ga0207665_10124662 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
3300026217|Ga0209871_1033124 | Not Available | 970 | Open in IMG/M |
3300026294|Ga0209839_10039808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1742 | Open in IMG/M |
3300026304|Ga0209240_1069834 | Not Available | 1308 | Open in IMG/M |
3300026330|Ga0209473_1043415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1986 | Open in IMG/M |
3300027568|Ga0208042_1089089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
3300027641|Ga0208827_1217386 | Not Available | 502 | Open in IMG/M |
3300027662|Ga0208565_1129866 | Not Available | 743 | Open in IMG/M |
3300027662|Ga0208565_1182829 | Not Available | 602 | Open in IMG/M |
3300027696|Ga0208696_1134828 | Not Available | 805 | Open in IMG/M |
3300028718|Ga0307307_10019454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1869 | Open in IMG/M |
3300028742|Ga0302220_10323376 | Not Available | 559 | Open in IMG/M |
3300028787|Ga0307323_10248093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 642 | Open in IMG/M |
3300028819|Ga0307296_10090612 | Not Available | 1635 | Open in IMG/M |
3300028828|Ga0307312_10541364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 769 | Open in IMG/M |
3300029915|Ga0311358_10101941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2934 | Open in IMG/M |
3300029956|Ga0302150_10384214 | Not Available | 519 | Open in IMG/M |
3300031028|Ga0302180_10035144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3110 | Open in IMG/M |
3300031236|Ga0302324_103088392 | Not Available | 551 | Open in IMG/M |
3300031544|Ga0318534_10395489 | Not Available | 794 | Open in IMG/M |
3300031572|Ga0318515_10507209 | Not Available | 644 | Open in IMG/M |
3300031679|Ga0318561_10504223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
3300031681|Ga0318572_10631531 | Not Available | 638 | Open in IMG/M |
3300031713|Ga0318496_10695611 | Not Available | 561 | Open in IMG/M |
3300031719|Ga0306917_10571750 | Not Available | 888 | Open in IMG/M |
3300031744|Ga0306918_11338076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
3300031747|Ga0318502_10861496 | Not Available | 550 | Open in IMG/M |
3300031751|Ga0318494_10429203 | Not Available | 768 | Open in IMG/M |
3300031764|Ga0318535_10343076 | Not Available | 668 | Open in IMG/M |
3300031796|Ga0318576_10044497 | Not Available | 1902 | Open in IMG/M |
3300031893|Ga0318536_10328216 | Not Available | 775 | Open in IMG/M |
3300031893|Ga0318536_10350454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
3300031912|Ga0306921_10345890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1739 | Open in IMG/M |
3300031912|Ga0306921_10692283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1172 | Open in IMG/M |
3300031946|Ga0310910_10465294 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300031946|Ga0310910_11256657 | Not Available | 573 | Open in IMG/M |
3300032008|Ga0318562_10361990 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300032009|Ga0318563_10258111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides gansuensis | 942 | Open in IMG/M |
3300032051|Ga0318532_10325232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
3300032065|Ga0318513_10511996 | Not Available | 587 | Open in IMG/M |
3300032067|Ga0318524_10492356 | Not Available | 643 | Open in IMG/M |
3300032076|Ga0306924_11271542 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300032076|Ga0306924_12218124 | Not Available | 559 | Open in IMG/M |
3300032160|Ga0311301_10584686 | Not Available | 1617 | Open in IMG/M |
3300032828|Ga0335080_10941934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 883 | Open in IMG/M |
3300032892|Ga0335081_10698784 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300032892|Ga0335081_11498100 | Not Available | 747 | Open in IMG/M |
3300032896|Ga0335075_10583946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1111 | Open in IMG/M |
3300032955|Ga0335076_10148645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2259 | Open in IMG/M |
3300033004|Ga0335084_10383413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1449 | Open in IMG/M |
3300033158|Ga0335077_10604351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium attenuatum | 1144 | Open in IMG/M |
3300033290|Ga0318519_10715859 | Not Available | 613 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.06% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.19% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.03% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.47% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.78% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.78% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.08% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.39% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.39% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.39% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.39% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.39% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.39% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.69% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.69% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.69% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1087926962 | 3300000955 | Soil | LLFLELSSYYLNVVRRHVYAEDVLVRCGVDRDDSR* |
Ga0070708_1004882073 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VQIPLSLMLFELSGYYVNTVQLHIHAADVLVRRGMHREGSR* |
Ga0070698_1002650861 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VQIPSSLMLFELSGYYVNTVQLHVHAADVLVRRGIDREDSR* |
Ga0070699_1020583252 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VQIPLSLLFLELSGYYMKAIQLHVHAADVLVRCGVHKEGSR* |
Ga0066905_1016153191 | 3300005713 | Tropical Forest Soil | LSLPFFEFSSYRVSAVRLHVYAADVLVRYGVDREGFR* |
Ga0070766_106099132 | 3300005921 | Soil | LSLLFLELSGYGVKAVQLHVNAADALVRRGVDRHDSR* |
Ga0066790_101301981 | 3300005995 | Soil | LFLELSGYYVNAVQLHVHAADVLVRCGIHREGFR* |
Ga0070717_108511401 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PLSLLFLELSGYYVNAVQLHVIAAGVLVRPGVHEEDFR* |
Ga0075019_111087021 | 3300006086 | Watersheds | PLSLLFLELSGHCVNAVRRHVIAADVLVRRGVDRGGFR* |
Ga0074057_114960422 | 3300006605 | Soil | LSLLFLELSGYCLNVVQRHVYAADVLVRCGVDRDDFR* |
Ga0079221_117934692 | 3300006804 | Agricultural Soil | LSLLLLELSDYYVSAVRLHVNAANALVRCGVDKDDS |
Ga0079220_121542162 | 3300006806 | Agricultural Soil | PLSLLFLEQSDYCVSAVRLHVYAADVPVRHGVDMEGFR* |
Ga0099795_102818691 | 3300007788 | Vadose Zone Soil | TAARLVQVPLSLLFLELSGYCVNAVQRHVNAADILVRGGIDRDGSR* |
Ga0116108_100070011 | 3300009519 | Peatland | LSLLFLELGGYYVNAVQLRVHAADVLVRCGIHREGFR* |
Ga0116221_11308331 | 3300009523 | Peatlands Soil | DLVQTPLSLLFLELSGYCVSAVQLHVNAADVLVRRGVDRGGFR* |
Ga0116102_11080292 | 3300009632 | Peatland | VQIPLSLLFLELSGYYVNAVQLHVHAADVLVRCGIYREGFR* |
Ga0116215_10399783 | 3300009672 | Peatlands Soil | LLFLELSGYCVSAVQLHVNAADVLVRRGVDRGGFR* |
Ga0116216_100403394 | 3300009698 | Peatlands Soil | LLLELGGYYVDAVRLHVTAADVLVRPGVDGDGFR* |
Ga0116219_101649461 | 3300009824 | Peatlands Soil | MFFELSGYYVKTVQLHINAADVLVKRGVHREGSR* |
Ga0126384_117038481 | 3300010046 | Tropical Forest Soil | SRLSLLFLELISDCVNAVRLHVYAADVLVRRGVDGEGFR* |
Ga0126382_100990084 | 3300010047 | Tropical Forest Soil | LLSLPFFEFSSYRVSAVRLHVYAADVLVRYGVDREGFR* |
Ga0126373_120430641 | 3300010048 | Tropical Forest Soil | VQILLSLLFLELSGYYVNAVRLHVYAADVLVRCGVDREG |
Ga0074044_101392944 | 3300010343 | Bog Forest Soil | SLSLPFLELSGYCVNAVRRHVYAADALVRHGVDGDDFR* |
Ga0126376_100761922 | 3300010359 | Tropical Forest Soil | MLFELRGYYMNAVRLHVHAADVLLRHGIDRDASR* |
Ga0126376_101271811 | 3300010359 | Tropical Forest Soil | PLSLLFLELNSYCVSAVRRHVYAADVLVRHGVDREGFR* |
Ga0126379_109625122 | 3300010366 | Tropical Forest Soil | LSLLFLELNSYCVSAVRRHVYAADVLVRHGVDREGFR* |
Ga0126379_138282631 | 3300010366 | Tropical Forest Soil | IPLSLLFLELNSYCVSAVRRHVYAADVLVRHGVDREGFR* |
Ga0134125_124796052 | 3300010371 | Terrestrial Soil | SLLFLELSGYCVNAVRLHVYAADVLVRLGVDRDDSR* |
Ga0134128_106230391 | 3300010373 | Terrestrial Soil | NPAHTSVSFSLLFLELSDCCINAVRLHVYAADVLVRCGVDKDDFR* |
Ga0136449_1003559441 | 3300010379 | Peatlands Soil | RRRPVHTPLSLLSLELNGYFVNAVQLHVNAADLLVRRGMDSDGSR* |
Ga0136449_1004411421 | 3300010379 | Peatlands Soil | PLSLMFFELSGYYVKTVQLHINAADVLVKRGVHREGSR* |
Ga0136449_1016308963 | 3300010379 | Peatlands Soil | QIPLSLMFFELSGYYVKTVQLHINAADVLVKRGVHREGSR* |
Ga0134126_114183782 | 3300010396 | Terrestrial Soil | LPFLELSGYGVNAVQRHVNAADVLVRRGVDRDGSR* |
Ga0126383_111140612 | 3300010398 | Tropical Forest Soil | LFFEFSGYCVNAVKLHVSAADVLVRPGVDGEGFR* |
Ga0134121_105602642 | 3300010401 | Terrestrial Soil | SLLFLELSDCCINAVRLHVYAADVLVRCGVDKDDFR* |
Ga0137392_101649062 | 3300011269 | Vadose Zone Soil | LSPLFLELSGYYVNAVQLHVHAADVLVRCGIHREGFR* |
Ga0137391_105494491 | 3300011270 | Vadose Zone Soil | QILLSLLFLELSSYYVNAVQLHVHAADVLVRSGIHKEGSR* |
Ga0137391_113717551 | 3300011270 | Vadose Zone Soil | LSPLFLELSGYYVNAVQLHVHAADVLVRCGIHREGFR |
Ga0137389_101697352 | 3300012096 | Vadose Zone Soil | LSLLFLELSGYYVNAVQLHVHAADVLVRCGIHREGFR* |
Ga0137365_100234301 | 3300012201 | Vadose Zone Soil | LIPLSLLFLELSGHYVNTVQLHVNAADVLVRRGIDRDGSR* |
Ga0137365_104907062 | 3300012201 | Vadose Zone Soil | AGPVQIPLSLLFLELSGYYVNAVQLHVNAADVLVRRGIHGEGFR* |
Ga0137399_103404171 | 3300012203 | Vadose Zone Soil | QIPLSLLFLELSGYGVNAVQRHVNTADVLVRRGVDRDGSR* |
Ga0137380_111986781 | 3300012206 | Vadose Zone Soil | LSLLFLELSGHYVNTVQLHVNAADVLVRRGIDRDGSR* |
Ga0137381_105509881 | 3300012207 | Vadose Zone Soil | SLLFLELSGHYVNTVQLHVNAADVLVRRGIDRDGSR* |
Ga0137379_100290741 | 3300012209 | Vadose Zone Soil | LLFLELSGYYVNAVQLHVHAADVLVRCGIHREGFR* |
Ga0137378_102362263 | 3300012210 | Vadose Zone Soil | ANPLSLMLFELSGYYVNTVQLHVHAADVLVRRGIDRDGSR* |
Ga0137378_113239863 | 3300012210 | Vadose Zone Soil | MLFELSGYYVNTVQLHVHAADVLVRRGIDRDGSR* |
Ga0137372_100130421 | 3300012350 | Vadose Zone Soil | PLSLLFLELSGYYVNAVQLHVHAADVLVRCGIHREGFR* |
Ga0137385_105804342 | 3300012359 | Vadose Zone Soil | AQIPLSLLFLELSGYGVNAVQRHVNAADVLVRRGVDRDGSR* |
Ga0137375_100738551 | 3300012360 | Vadose Zone Soil | LSLLFLELSGYYVNAVQLHVHAADVLVRCGIHREG |
Ga0137390_105703941 | 3300012363 | Vadose Zone Soil | IPLSPLFLELSGYYVNAVQLHVHAADVLVGCGIHREGFR* |
Ga0137390_106106812 | 3300012363 | Vadose Zone Soil | LFLKLSGYYVNAVQLHVHAADVLVRRGIHREGFR* |
Ga0137390_116041111 | 3300012363 | Vadose Zone Soil | QIPLSLLFLELSGYCVNAVKLHVYAADVLVRRGVDGDGFR* |
Ga0126375_102322321 | 3300012948 | Tropical Forest Soil | QIPLSLLFLELISYYLDPMRLHVTAADALVRHGVDRDDFR* |
Ga0126369_136116711 | 3300012971 | Tropical Forest Soil | LSLLFLELISDYVNAIWLHVYAADVLVRRGVDREGFR |
Ga0181521_100222236 | 3300014158 | Bog | LSLLFLELGGYYVNAVQLRVHATDVLVRCGIHREGFR* |
Ga0181538_102072462 | 3300014162 | Bog | LSLLFLELSGYYVNAVQLHVHAADVLVRCGIYREGFR* |
Ga0182024_117517121 | 3300014501 | Permafrost | PLSLELSGYCVNAVQLHVNAVDVVVRCGIHGEGSR* |
Ga0182032_108635411 | 3300016357 | Soil | LSLLFLELNGYCVNAVRLHVYAADVLVRLGVDRDDFRY |
Ga0182034_110604641 | 3300016371 | Soil | VPLSLLFLELIGYCVNAARLHVYAADVLVRLGVHRDDLR |
Ga0182040_118643551 | 3300016387 | Soil | LVQVPLSLLFLELNGYRVNAVRRHVYAVDVLVRLGVDRDDFR |
Ga0182038_104934431 | 3300016445 | Soil | MQTSLSLLLLELSGYFVSAVRLHVYAVDALVRCGVDRDDSR |
Ga0187812_10530441 | 3300017821 | Freshwater Sediment | RLAQIRLSLLFFELSGYCVNAVQLHVSAADVLVRRGIARDGFR |
Ga0187807_10053601 | 3300017926 | Freshwater Sediment | ATRLAQIRLSLLFFELSGYCVNAVQLHVSAADVLVRRGIARDGFR |
Ga0187807_10183673 | 3300017926 | Freshwater Sediment | SLLFLELSGYCVNAVQLHVSAADVLVRRGIDRDGFR |
Ga0187807_11598871 | 3300017926 | Freshwater Sediment | PLSLLFLELNGYCLNVVQRHVYAADVLVRCGVDRDDFR |
Ga0187814_100395521 | 3300017932 | Freshwater Sediment | RLAQIRLSLLFFELSGYCVNAVQLHVSAADVLVRRGIDRDGFR |
Ga0187854_101580831 | 3300017938 | Peatland | LSLLFLELGGYYVNAVQLRVHAADVLVRCGIHREGFR |
Ga0187808_101174111 | 3300017942 | Freshwater Sediment | LSLLFLELNGYCLNVVQRHVYAADVLVRCGVDRDDFR |
Ga0187808_101203892 | 3300017942 | Freshwater Sediment | SLLLLELSGYCVNTVQLHVHAADVLVRRGTDRDGFR |
Ga0187780_111200251 | 3300017973 | Tropical Peatland | LLFLELNGYYSNTVRLHVYAADVLVRLGVDRDDSR |
Ga0187815_102033391 | 3300018001 | Freshwater Sediment | TRLAQIRLSLLFFELSGYCVNAVQLHVSAADVLVRRGIARDGFR |
Ga0187804_102886191 | 3300018006 | Freshwater Sediment | AARLAQIPFSLLFFEFSGYRVNAVQLHVYAADVLVRRGVDRDGFR |
Ga0187805_105793971 | 3300018007 | Freshwater Sediment | RPVQTSLSLLFLEPNGYYVNAVRGHVNAADVLVSRGMDRDDSR |
Ga0187810_101975871 | 3300018012 | Freshwater Sediment | AAGPVRIPLSLLFLELSGYCVNAVRLHVNAGDVLVRPGVDGDGSR |
Ga0187882_14018821 | 3300018021 | Peatland | IPLSLLFLELGGYYVNAVQLRVHAADVLVRCGIHREGFR |
Ga0187869_102252832 | 3300018030 | Peatland | SAAAPVQIPLSLLFLELSGYYVNAVQLHVHAADVLVRCGIYREGFR |
Ga0187867_100324446 | 3300018033 | Peatland | SPVQISLSLLFLELSGHYVNAVQLHVHAADVLVRCGIHREDLR |
Ga0193729_12744772 | 3300019887 | Soil | IPLSLLFLELSGYYVNAVQQHVLAADVLVRCGIYREGFR |
Ga0187768_11095482 | 3300020150 | Tropical Peatland | AADPAQATLSLLFLELNGYYSNTVRLHVYAADVLVRLGVDRDDSR |
Ga0210399_105913662 | 3300020581 | Soil | LLLMFFELSGYCVNAARLHVYAADVLVRYGVDREGFR |
Ga0210399_108996903 | 3300020581 | Soil | PLLLMFFELSGYCVNAARLHVYAADVLVRCGVDREGFR |
Ga0210399_113546651 | 3300020581 | Soil | LSLLFLELSGYCAKTIQLHVNAADALVRRGIDRDSSRQPP |
Ga0210405_110795671 | 3300021171 | Soil | AGPVRIPLSMLLLELSGYCVNPIQLHINAADVLVRPGIDIDREDFR |
Ga0210388_100943034 | 3300021181 | Soil | NPLFAAVLELSGYGVNAVQRHVNAADVLVRRGVDRDGSK |
Ga0210389_110950521 | 3300021404 | Soil | PLSLLFLELSGYHVNAVQLHVTAAGALVRRGVDRDDSR |
Ga0210391_105752132 | 3300021433 | Soil | SSLMLFELNDYDVNAVQLHVSAADVLVRCGIDRKGFR |
Ga0207684_101786123 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LLFFEPSGAHVNAVQLHVHAADVLVRRGIDREDSR |
Ga0207684_110360622 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LLFLELTGYCVNTVQRHVNAADVLVRHGMDRDGSR |
Ga0207693_101272151 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LLFLELIGDCVNAIRLHVYAAEVLVRRGVDREGFR |
Ga0207693_109660511 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEPEQRPLSLLFLELISDCVDAIRLHVYAADVLVRRGVDREGSR |
Ga0207646_104373393 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LSLLLLELNGYCVNAIQLHVNAADVLVRPGIDRDGSR |
Ga0207665_101246621 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AARLTQIPLSLLFLELIGYGVNAVQRHVNAADFLVRPGVDRDGSR |
Ga0209871_10331241 | 3300026217 | Permafrost Soil | PLLLLFLELGGYYVNAVQLHVHAADVLVRCGIHREGFR |
Ga0209839_100398082 | 3300026294 | Soil | LLFLELSGYYVNAVQLHVHAADVLVRCGIHREGFR |
Ga0209240_10698341 | 3300026304 | Grasslands Soil | QISLSLLFFEFSGYSVNAVQLHVYAADVLVRRGVDREGFR |
Ga0209473_10434151 | 3300026330 | Soil | AGLARIPLSLLSLELSGYGVNAVRLHVNAADVLVRLGIDRDGSR |
Ga0208042_10890891 | 3300027568 | Peatlands Soil | LLLLELSGYYVNTVQLHVNAADVLVRRGIDRDGSR |
Ga0208827_12173861 | 3300027641 | Peatlands Soil | LSLLFLELIGYCANAVQLHVYAADVLVRCGVDREGFR |
Ga0208565_11298661 | 3300027662 | Peatlands Soil | SFFAARLAQIPLSLLFFELSGYCVNTVQLHVNAADVLVRRGIDRDGSR |
Ga0208565_11828292 | 3300027662 | Peatlands Soil | LLFLELSGYCVSAVQLHVNAADVLVRRGVDRGGFR |
Ga0208696_11348282 | 3300027696 | Peatlands Soil | LLFLELSGYCVNAVQLHVNAADVMVRRGIDRNDSR |
Ga0307307_100194541 | 3300028718 | Soil | HRPGTFPLSLLFLELSGYWLNVVQRHVYAADVLVICGVDRDGFR |
Ga0302220_103233761 | 3300028742 | Palsa | ADSVQIPLLLMFLELGDYYVNAVQLHVHAADVLVRRGVHREGFR |
Ga0307323_102480931 | 3300028787 | Soil | LSLLFLELSGYGVNAVQRHVNAADVLVRRGVDRDGSR |
Ga0307296_100906122 | 3300028819 | Soil | HRPGTFPLSLLFLELSGYWLNVVQRHVYAADVLVICGVDRDDFR |
Ga0307312_105413642 | 3300028828 | Soil | GTFPLSLLFLELSGYWLNVVQRHVYAADVLVICGVDRDDFR |
Ga0311358_101019415 | 3300029915 | Bog | NFGLELSGHYVNAVQLHVHAADVLVRCGIHREDLR |
Ga0302150_103842142 | 3300029956 | Bog | LSLLFLELSGYCVNAARLHVNAADVLVRRGIDETASD |
Ga0302180_100351444 | 3300031028 | Palsa | QAGCEPSASLLFSELSGYYVNAVRLHVNAADVLVRRSTDGDGSR |
Ga0302324_1030883922 | 3300031236 | Palsa | FSLLFLELSDYYANTVRLHVNAADVLVRHGIDRDGSR |
Ga0318534_103954891 | 3300031544 | Soil | AIPAHTSLSLLFLELIGYCINAVQLHVYAADVLVRCGVDRDDFR |
Ga0318515_105072091 | 3300031572 | Soil | VKVPFSLLFLELSGYFVNAVQLHVNAADVLVRLGV |
Ga0318561_105042231 | 3300031679 | Soil | VPFSLLFLELSGYFVNAVQLHVNAADVLVRLGVDRDGSR |
Ga0318572_106315311 | 3300031681 | Soil | TSLSLLFLELTGYHVNVVRLHVYAADVLVRHGVDRDDFR |
Ga0318496_106956111 | 3300031713 | Soil | TSLSLLFLELIGYCINAVQLHVYAADVLVRCGVDRDDFR |
Ga0306917_105717501 | 3300031719 | Soil | RTSLSLLFLELSGYGVSAVRLHVYAADVLVRLGVDREDSR |
Ga0306918_113380761 | 3300031744 | Soil | PLSLLFLELNSYYVNAVQLHVYAADVLVSHGVDRDDFR |
Ga0318502_108614962 | 3300031747 | Soil | SSSLLLLELTGYFVSAVRLHVYAADAQVRRGVDRDDFR |
Ga0318494_104292032 | 3300031751 | Soil | PVQVPLSLLFLELNGCRVNAVRLHVYAADVLVRLGVNRDVSR |
Ga0318535_103430762 | 3300031764 | Soil | AAEPVQIPLSLLFLELSSYCMNAVRLHVYAADVLVRLGVDRDDFR |
Ga0318576_100444971 | 3300031796 | Soil | AAEPVPIPLPLLFSEPSSYYMNAVQLHVHAADALVRRGKHREGFRSA |
Ga0318536_103282161 | 3300031893 | Soil | LSLPFFEFICSCVNAVQLHVYDADALVRHGVDREGFR |
Ga0318536_103504542 | 3300031893 | Soil | SLVRIPLSLLSLELSGYCANVVRLHVNAAEVLVRRGIDREDSR |
Ga0306921_103458903 | 3300031912 | Soil | ISFSLLFLELSDYGVNAVRLHVYAADALVRLGVDKDDFR |
Ga0306921_106922831 | 3300031912 | Soil | PLSLLFLELSGHYVNAVQLHVNAADVLVRCGMDRDGSR |
Ga0310910_104652942 | 3300031946 | Soil | RRRLVQVPLSLLFLELNGYRVNAVRRHVYAVDVLVRLGVDRDDFR |
Ga0310910_112566571 | 3300031946 | Soil | SSSLLLLELTGYFVSAVRLHVYAADALVRHGVDRDDFR |
Ga0318562_103619902 | 3300032008 | Soil | LSLLFLELSGYCVNAVRLHFYAADVLVRLGVDRDGSR |
Ga0318563_102581111 | 3300032009 | Soil | AQIPLSPLFLELTGYYVNAVQLHVYAVDVRVRRGVDRGDFR |
Ga0318532_103252321 | 3300032051 | Soil | LSLLFLELNSYYVNAVQLHVYAADVLVSHGVDRDDFR |
Ga0318513_105119962 | 3300032065 | Soil | IRSSLLMLFLELSGYCVNAMQRNVYAADVVVRWGVDRDDFR |
Ga0318524_104923561 | 3300032067 | Soil | SFSLLFLELSDYGVNAVRLHVYAADALVRLGVDKDDFR |
Ga0306924_112715421 | 3300032076 | Soil | SLSLLFLELSGYCVYAVRLHVYAADVLVRLGVDRDGFR |
Ga0306924_122181243 | 3300032076 | Soil | SLLFLELSGYCVNVVLLHVYAADVLVRCGVDRDGSR |
Ga0311301_105846861 | 3300032160 | Peatlands Soil | PLSLMFFELSGYYVKTVQLHINAADVLVKRGVHREGSR |
Ga0335080_109419341 | 3300032828 | Soil | VRPSLSLLFLELTGYCVNAVQLHVYAADVLVRHGVDRDDFR |
Ga0335081_106987842 | 3300032892 | Soil | SLLFLELTGYCVNAVQLHVYAADVLVRHGVDRDDFR |
Ga0335081_114981001 | 3300032892 | Soil | SSLSLLFLELSDYGVNAIQLHVNAADVQVRPGIDRDDSR |
Ga0335075_105839462 | 3300032896 | Soil | GPLSMLFLESTGYGVNAVRLHVYAADALVRLRVGGDDLR |
Ga0335076_101486451 | 3300032955 | Soil | AADPVRTSLSLLFLELSGYAVDAVRLHVYAADALVGLGVDRDGSR |
Ga0335084_103834131 | 3300033004 | Soil | SFSLLFLELISYYVNAVRPHVYAADALLRCGVDGDDFR |
Ga0335077_106043511 | 3300033158 | Soil | LSLLFLELSRYYVNAVRRHVTAADVLVRRGVDRDDF |
Ga0318519_107158591 | 3300033290 | Soil | HTSLSLLFLELIGYCINAVQLHVYAADVLVRCGVDRDDFR |
⦗Top⦘ |