NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F050875

Metatranscriptome Family F050875

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050875
Family Type Metatranscriptome
Number of Sequences 144
Average Sequence Length 121 residues
Representative Sequence VSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGA
Number of Associated Samples 79
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 90.97 %
% of genes from short scaffolds (< 2000 bps) 90.97 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (90.972 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater
(64.583 % of family members)
Environment Ontology (ENVO) Unclassified
(97.917 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(73.611 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.70%    β-sheet: 2.46%    Coil/Unstructured: 59.84%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.97 %
UnclassifiedrootN/A9.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008928|Ga0103711_10045759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata627Open in IMG/M
3300009006|Ga0103710_10109999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata693Open in IMG/M
3300009608|Ga0115100_10381823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300018636|Ga0193377_1012491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata709Open in IMG/M
3300018636|Ga0193377_1023486All Organisms → cellular organisms → Eukaryota → Sar533Open in IMG/M
3300018661|Ga0193122_1060723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300018676|Ga0193137_1045207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata630Open in IMG/M
3300018684|Ga0192983_1024706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata812Open in IMG/M
3300018723|Ga0193038_1065294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300018747|Ga0193147_1080802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300018764|Ga0192924_1030838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata652Open in IMG/M
3300018780|Ga0193472_1025647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata648Open in IMG/M
3300018780|Ga0193472_1039916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300018850|Ga0193273_1067206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300018858|Ga0193413_1085186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300018873|Ga0193553_1130108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata601Open in IMG/M
3300018885|Ga0193311_10061603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300018885|Ga0193311_10063378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300018927|Ga0193083_10048416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata621Open in IMG/M
3300018942|Ga0193426_10118210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata594Open in IMG/M
3300018982|Ga0192947_10183747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata692Open in IMG/M
3300019010|Ga0193044_10245382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300019017|Ga0193569_10280923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata699Open in IMG/M
3300019035|Ga0192875_10091746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata832Open in IMG/M
3300019035|Ga0192875_10114539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata719Open in IMG/M
3300019099|Ga0193102_1019979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata627Open in IMG/M
3300019111|Ga0193541_1055627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata698Open in IMG/M
3300019112|Ga0193106_1028917All Organisms → cellular organisms → Eukaryota → Sar634Open in IMG/M
3300019136|Ga0193112_1143777All Organisms → cellular organisms → Eukaryota → Sar533Open in IMG/M
3300019136|Ga0193112_1144547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300019139|Ga0193047_1096207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata607Open in IMG/M
3300019144|Ga0193246_10168597All Organisms → cellular organisms → Eukaryota → Sar749Open in IMG/M
3300021894|Ga0063099_1020746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata619Open in IMG/M
3300030653|Ga0307402_10432186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata760Open in IMG/M
3300030801|Ga0073947_1853093All Organisms → cellular organisms → Eukaryota → Sar522Open in IMG/M
3300030953|Ga0073941_12182356All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300030958|Ga0073971_10699035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300031037|Ga0073979_12445591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata706Open in IMG/M
3300031709|Ga0307385_10302319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300031709|Ga0307385_10383755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300031710|Ga0307386_10508467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300031717|Ga0307396_10246503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata851Open in IMG/M
3300031738|Ga0307384_10320669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata710Open in IMG/M
3300031739|Ga0307383_10707383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300031743|Ga0307382_10445471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300032463|Ga0314684_10406833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata799Open in IMG/M
3300032463|Ga0314684_10500727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata713Open in IMG/M
3300032463|Ga0314684_10614397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300032463|Ga0314684_10686787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300032463|Ga0314684_10703872All Organisms → cellular organisms → Eukaryota → Sar581Open in IMG/M
3300032463|Ga0314684_10885766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300032470|Ga0314670_10326913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata800Open in IMG/M
3300032481|Ga0314668_10554839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M
3300032492|Ga0314679_10438968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300032492|Ga0314679_10488849All Organisms → cellular organisms → Eukaryota → Sar553Open in IMG/M
3300032517|Ga0314688_10264368All Organisms → cellular organisms → Eukaryota → Sar906Open in IMG/M
3300032517|Ga0314688_10408033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata736Open in IMG/M
3300032518|Ga0314689_10167315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1116Open in IMG/M
3300032518|Ga0314689_10286409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata863Open in IMG/M
3300032518|Ga0314689_10327447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata805Open in IMG/M
3300032519|Ga0314676_10466620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata751Open in IMG/M
3300032519|Ga0314676_10827315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300032521|Ga0314680_10332091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata931Open in IMG/M
3300032521|Ga0314680_10519327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata750Open in IMG/M
3300032521|Ga0314680_10850193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300032522|Ga0314677_10297189All Organisms → cellular organisms → Eukaryota → Sar852Open in IMG/M
3300032522|Ga0314677_10371142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata763Open in IMG/M
3300032522|Ga0314677_10566870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata601Open in IMG/M
3300032522|Ga0314677_10729519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300032540|Ga0314682_10294479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata887Open in IMG/M
3300032540|Ga0314682_10587346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata610Open in IMG/M
3300032540|Ga0314682_10621837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata589Open in IMG/M
3300032615|Ga0314674_10667011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300032617|Ga0314683_10340884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata935Open in IMG/M
3300032650|Ga0314673_10214049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata942Open in IMG/M
3300032650|Ga0314673_10271823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata850Open in IMG/M
3300032650|Ga0314673_10343063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata762Open in IMG/M
3300032650|Ga0314673_10371990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata732Open in IMG/M
3300032650|Ga0314673_10418826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata689Open in IMG/M
3300032650|Ga0314673_10576919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata580Open in IMG/M
3300032666|Ga0314678_10544245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300032707|Ga0314687_10138117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1202Open in IMG/M
3300032707|Ga0314687_10638530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata592Open in IMG/M
3300032707|Ga0314687_10681279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300032707|Ga0314687_10758513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300032708|Ga0314669_10336993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata817Open in IMG/M
3300032708|Ga0314669_10494090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata674Open in IMG/M
3300032708|Ga0314669_10541990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata641Open in IMG/M
3300032708|Ga0314669_10545197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata639Open in IMG/M
3300032708|Ga0314669_10629894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300032711|Ga0314681_10501042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata681Open in IMG/M
3300032714|Ga0314686_10199906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata979Open in IMG/M
3300032723|Ga0314703_10187882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata856Open in IMG/M
3300032727|Ga0314693_10364012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata785Open in IMG/M
3300032727|Ga0314693_10483377All Organisms → cellular organisms → Eukaryota → Sar676Open in IMG/M
3300032727|Ga0314693_10599509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata598Open in IMG/M
3300032727|Ga0314693_10648419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300032728|Ga0314696_10415856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata696Open in IMG/M
3300032728|Ga0314696_10481893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata639Open in IMG/M
3300032728|Ga0314696_10703812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300032729|Ga0314697_10509002All Organisms → cellular organisms → Eukaryota → Sar530Open in IMG/M
3300032730|Ga0314699_10350895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata665Open in IMG/M
3300032730|Ga0314699_10382424All Organisms → cellular organisms → Eukaryota → Sar635Open in IMG/M
3300032730|Ga0314699_10425354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300032732|Ga0314711_10400703All Organisms → cellular organisms → Eukaryota → Sar710Open in IMG/M
3300032732|Ga0314711_10450633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata664Open in IMG/M
3300032733|Ga0314714_10359102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata821Open in IMG/M
3300032733|Ga0314714_10430277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata742Open in IMG/M
3300032733|Ga0314714_10757594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300032742|Ga0314710_10237789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata748Open in IMG/M
3300032742|Ga0314710_10276457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata694Open in IMG/M
3300032742|Ga0314710_10424131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300032743|Ga0314707_10244511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata924Open in IMG/M
3300032743|Ga0314707_10408857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata709Open in IMG/M
3300032743|Ga0314707_10409096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata708Open in IMG/M
3300032744|Ga0314705_10434895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata706Open in IMG/M
3300032745|Ga0314704_10496443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata672Open in IMG/M
3300032746|Ga0314701_10177867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata943Open in IMG/M
3300032746|Ga0314701_10503796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300032746|Ga0314701_10508910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300032749|Ga0314691_10356910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300032749|Ga0314691_10406305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300032752|Ga0314700_10292399All Organisms → cellular organisms → Eukaryota → Sar857Open in IMG/M
3300032752|Ga0314700_10382605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata747Open in IMG/M
3300032752|Ga0314700_10390444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata739Open in IMG/M
3300032754|Ga0314692_10198274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1067Open in IMG/M
3300032754|Ga0314692_10521531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata637Open in IMG/M
3300032754|Ga0314692_10719308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300032755|Ga0314709_10391561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata856Open in IMG/M
3300032755|Ga0314709_10693764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300032755|Ga0314709_10697413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata607Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater64.58%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine22.92%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.42%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.39%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008928Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E3EnvironmentalOpen in IMG/M
3300009006Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2EnvironmentalOpen in IMG/M
3300009023Planktonic microbial communities from coastal waters of California, USA - Canon-29EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018636Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782245-ERR1711897)EnvironmentalOpen in IMG/M
3300018661Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782311-ERR1712063)EnvironmentalOpen in IMG/M
3300018676Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018780Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002187 (ERX1789624-ERR1719497)EnvironmentalOpen in IMG/M
3300018850Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941)EnvironmentalOpen in IMG/M
3300018858Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789628-ERR1719293)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019035Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789492-ERR1719296)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019112Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019136Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019144Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001503 (ERX1789695-ERR1719376)EnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030801Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_X_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030953Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030958Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103711_1004575913300008928Ocean WaterNIDACKASLPWKTGVKGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFEACYDATVAAFGA*
Ga0103710_1010999913300009006Ocean WaterTLVANVDTCKASVPWKVGVKGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGACEADRPEGEKKNKKYRPDCGTVSTPQMHPFYTPDVFEACYDATVAAFGV*
Ga0103928_1019019513300009023Coastal WaterKLDADAVFVPSRLRPILAGQMVPATGIYLENCKYVDNGFFGNLEIFSLAAFETLAANIDACKATLPWKIGLKGGKLGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFEACYDATVAAFGA*
Ga0115100_1038182323300009608MarineGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS*
Ga0193377_101249113300018636MarineKPILAKQMVPASGIYLENCQHVSYGYFGNLEIFSLAAFESLVANIDACKASLPWKTGVKGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPKGEKKNKKYVPDCATASTPQIHPLHFPDAFGACYDATVAAFGA
Ga0193377_102348613300018636MarineTGVKGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPAGEKKNKKYVPDCATASTPQIHPLHTPDVFEACYDATVAAFGA
Ga0193122_106072313300018661MarineNLEIFSLAAFETLVANVDSCKASLPWQIGVKNGIYGPMGEDLFAQQCLDSVGVPRIEAYDISTDGACEADRPEGEKENKKFVPDCSTASTPQMHPYMTPKAMGACYDATIAAFGA
Ga0193137_104520713300018676MarineTWAKTGVYLENCKYVSYGYFGNLEIFSLAAFETLVANVDSCKASLPWQIGVKNGIYGPMGEDLFAQQCLDSVGVPRIEAYDISTDGACEADRPEGEKKNKKFVPDCSTASTPQMHPYMTPKAMGACYDATIAAFGA
Ga0192983_102470613300018684MarineVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGA
Ga0193038_106529413300018723MarineEIFSLAAFETLVANVDSCKASLPWQIGVKNGIYGPMGEDLFAQQCLDSVGVPRVEAYDISTDGACEADRPEGEKENKKFVPDCSTASTPQMHPYMTPKAMGACYDATIAAFGA
Ga0193147_108080213300018747MarineFSLAAFETLVANVDSCKASLPWQIGVKNGIYGTMGEDLFAQQCLDSVGVPRIEAYDISTDGACEADRPEGEKENKKFVPDCSTASTPQMHPYMTPKAMGACYDATIAAFGA
Ga0192924_103083813300018764MarineVPILASKRVPKTGVYLENCKYVSYGYFGNLEVFSLAAFETLVANVDSCKASLPWQIGVKNGIYGPMGEDLFAQQCLDSVGVPRIEAYDISTDGACEADRPEGEKKNKKFVPDCSTASTPQMHPYMTPKAMGACYDATIAAFGA
Ga0193472_102564713300018780MarineRLVPILEKQMVPAEGVYLENCQYVSYGYFGNLEVFSLAAFETLAANVDTCKASVPWKVGVKGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGACEADRPEGEKKNKKYKPDCATVSTPQMHPFYTPDVFEACYDATVAAFGV
Ga0193472_103991613300018780MarineATQLVPAEGVYLENCKFVSYGYFGNLEVFSRAAFETLVANTDACKASLPWKTGVKGGKFGPMGEDLFAQQCLDSMGVPRVEQYDISTDGQCEADRPLGEKKNKKYVPDCATASTPQIHPLFTPDVFGPCYDATVAAFGV
Ga0193273_106720613300018850MarineSLAAFETLVANVDSCKASLPWQIGVKNGIYGPMGEDLFAQQCLDSVGVPRIEAYDISTDGACEADRPEGEKDNKKFVPDCSTASTPQMHPYKTPKAMGACYDATIAAFGA
Ga0193413_108518613300018858MarineLAVQMVPATGIYLENCKYVDNGFFGNLEIFSLAAFETLAANIDACKATLPWKIGVKGGKLGPMGEDLFAQQCLDSLGVPRVEQYDISTDGACPGDRPKGEKKNKKYVPDCKYAATPQIHPLKTTEAFEACYDATVAAFGA
Ga0193553_113010813300018873MarineHGQMVPAEGVYLENCQHVSYGYFGNLEVFSLAAFETLVTNIDTCKASLPWKTGVKGGKFGPMGEDLFAQQCLDSVGVPRVEQYDISTDGQCEADRPLGEKKNKKYVPDCATVSTPQIHPLKTPDVFEKCYDATVAAFGV
Ga0193311_1006160313300018885MarineIDACKASLPWKTGVKGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLHFPDAFGACYDATVAAFGA
Ga0193311_1006337813300018885MarineIDACKASLPWKTGVKGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPAGEKKNKKYVPDCATASTPQIHPLHTPDVFEACYDATVAAFGA
Ga0193083_1004841613300018927MarineSKRVPKTGVYLENCKYVSYGYFGNLEVFSLAAFETLVANVDSCKASLPWQIGVKNGIYGPMGEDLFAQQCLDSVGVPRIEAYDISTDGACEADRPEGEKKNKKFVPDCSTASTPQMHPYMTPKAMGACYDATIAAFGA
Ga0193552_1015073113300018934MarineFVPSRLVPILASKRVPKTGVYVENCKYVSYGYFGNLEIFSLAAFETLVANVDSCKASLPWQIGVKNGIYGPMGEDLFAQQCLDSVGVPRIEAYDISTDGACEADRPEGEKKNKKFVPDCSTASTPQMHPYMTPKAMGACYDATIAAFGA
Ga0193426_1011821013300018942MarineYGYFGNLEVFSLAAFETLVANVDSCKASLPWQIGVKNGIYGPMGEDLFAQQCLDSVGVPRIEAHDISTDGACEADRPEGEKKNKKFVPDCSTASTPQMHPYMTPEAMGACYDATIAAFGA
Ga0192947_1018374713300018982MarineSLAAFETLVANIDACKASLPWKTGIKGGKWGPMGEDLFAQQCLDALDVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTAQIHPFFTPDVFEACYDATVAAFPLE
Ga0192880_1009357313300019009MarineVMKLDADAVFVPSRLKPILAKQMVPATGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGA
Ga0193044_1024538213300019010MarineLENCKYVSYGYFGNLEIFSLAAFKTLVANVDSCKASLPWKIGVKNGKFGPMGEDLFAQQCLDSVGVPRIEAHDISTDGACEADRPEGEKKNKKFVPDCSTASTPQMHPYMTPKAMGACYDATIAAFGA
Ga0193569_1028092313300019017MarineYGYFGNLEVFSTKAFETLVTNIDTCKASLPWKTGVKGGKFGPMGEDLFAQQCLDSVGVPRVEQYDISTDGQCEADRPLGEKKNKKYVPDCATVSTPQIHPLKTPDVFEKCYDATVAAFGV
Ga0192875_1009174623300019035MarineTVAFQTLVANIDSCKASLPWQIGVKDGKWGPMGEDLFAQQCLDSLGVRRVEKYDVATDGACEYYRPEDQKKNKSWIPDCSTASTAQMHPFFTPDVFEACYDTTIAAFGY
Ga0192875_1011453913300019035MarineTVAFQTLVANIDSCKASLPWQVGVKGGKYGPMGEDLFAQQCLDSLDVRRVEKYDVSTDGACEYYRPEGQEKNKSFVPDCSQTKTAQMHPFFTPDVFEACYDATIAAFGY
Ga0193102_101997913300019099MarineNLEIFSLAAFESLVANIDACKASLPWKTGVKGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPAGEKKNKKYVPDCATASTPQIHPLHFPDAFGACYDATVAAFGA
Ga0193541_105562713300019111MarineVPATGIYLENCKYVDNGFFGNLEIFSLAAFETLAANIDACKTTLPWKIGVKGGKLGPMGEDLFAQQCLDKLGVPRVEQYDISTDGACPADRPKGEKKNKKYVPDCKYAATPQIHPLKTTEAFEACYDATVAAFGA
Ga0193106_102891713300019112MarineCKYVDNGFFGNLEIFSLAAFETLAANIGACKATLPWKLGVKGGKLGPMGEDLFAQQCLDSLGVPRVEQYDISTDGACPADRPKGEKKNKKYVPDCKYAATPQIHPLKTTEAFEACYDATVAAFGA
Ga0193104_102731613300019125MarineFVPSRLRPILAGQMVPATGIYLENCKYVDNGFFGNLEIFSLAAFETLAANIDACKATLPWKIGVKGGKLGPMGEDLFAQQCLDSLGVPRVEQYDISTDGACPGDRPKGEKKNKKYVPDCKYAATPQIHPLKTTEAFEACYDATVAAFGA
Ga0193112_114377723300019136MarineVKGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPASEKKNKKYVPDCATASTPQIHPLHTPDVFEACYDATVAAFGA
Ga0193112_114454713300019136MarineNLEIFSLAAFESLVANIDACKASLPWKTGVKGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPKGEKKNKKYVPDCATASTPQIHPLHFPDAFGACYDATVAAFGA
Ga0193047_109620713300019139MarineCKASLPWKTGVKGGKFGPMGEDLFAQQCLDSVGVPRVEQYDISTDGQCEADRPLGEKKNKKYVPDCATVSTPQIHPLKTPDVFEKCYDATVAAFGV
Ga0193246_1016859713300019144MarineWKIGVKGGKWGPMGEDLFAQQCLDSLNVRRAERYDISTDGACEYYRPEDQKKNKAWIPDCSKTSTAQMHPFFTPDVFEPCYDATIAAFGY
Ga0063099_102074613300021894MarinePILAKQMVPATGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGA
Ga0063144_108144013300021899MarineMKLDADAVFVPSRLRPILAKQMVPAEGVYLENCQHVSYGYFGNLEVFSLAAFETLVTNIDTCKASLPWKTGVKGGKFGPMGEDLFAQQCLDSVGVPRVEQYDISTDGQCEADRPLGEKKNKKYVPDCATVSTPQIHPLKTPDVFEKCYDATVAAFGV
Ga0307402_1043218623300030653MarineYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCLDDLGVPRVEQYDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFFTPDAFEACYDATVAAFGL
Ga0073947_185309313300030801MarineCKYVDNGFFGNLEIFSLAAFETLAANIGACKATLPWKLGVKGGKLGPMGEDLFAQQCLDSLGVPRVEQYDISTDGACPGDRPKGEKKNKKYVPDCKYAATPQIHPLKTTEAFEACYDATVAAFGA
Ga0073941_1218235623300030953MarineASLDWVVGVKGGKYGPMGEDLFAQQCLDSLGVPRASNYDISTDGACPADRPKGEKKNKKYVPECKYAATPQIHPLKTVEAFAACYDATVAAFGA
Ga0073941_1219099013300030953MarineWVMKLDADAVFVPSRLRPILAKQMVPAEGVYLENCQHVSYGYFGNLEVFSLAAFETLVTNIDTCKASLPWKTGVKGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFEACYDATVAAFGA
Ga0073971_1069903513300030958MarineFPYKLARVLQDTSVPQEGLYMENCKFVDWGYFGNLEVFSKQAFQTLVDNVDTCYDEIDWKIGVHGGKYGPMGEDLFAQKCMDSMGVSRQENFMLTTDGACEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFEACYDATVAAFGA
Ga0073979_1244559113300031037MarineANVDTCKASLPWKIGVKDGKYGPMGEDLFAQQCLDSLGVPRVEAFDISTDGACPSDRPEGQKKNKKFVPDCATASTPQMHPFYTPDVFGSCYDATIAAFGY
Ga0307385_1030231913300031709MarineYFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0307385_1038375513300031709MarineSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDARGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFG
Ga0307386_1050846723300031710MarineLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDARGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0307396_1024650313300031717MarineSRLKPILAKQMVPATGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGA
Ga0307384_1032066913300031738MarineLAKQMVPATGIYLENCEHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0307383_1070738313300031739MarineAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDARGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0307382_1044547113300031743MarineDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGACEADRPEGEKKNKKYKPDCGTVSTPQMHPFYTPDVFEACYDATVAAFGV
Ga0314684_1040683313300032463SeawaterLENCEHVSYGYFGNLEVFSLAAFETLVDNIDACKASLPWKTGVHGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314684_1050072713300032463SeawaterCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGIKGGKWGPMGEDLFAQQCLDALDVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTAQIHPFFTPDVFEACYDATVAAFPLE
Ga0314684_1061439713300032463SeawaterYLENCQHVSYGYFGNLEVFSLAAFETLAANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314684_1068678713300032463SeawaterPATGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKVSLPWKTGVHGGKFGPMGEDLFAQQCLDTLGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0314684_1070387213300032463SeawaterASLPWKTGVQGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPFYTPDVFEACYDATVAAFGLE
Ga0314684_1088576613300032463SeawaterDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314670_1032691313300032470SeawaterVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314668_1016049213300032481SeawaterKLDADAVFVPSRLKPILAKQMVPATGIYLENCEHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314668_1055483913300032481SeawaterFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314679_1043896813300032492SeawaterLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPMFTPDVFEACYDATVAAFGS
Ga0314679_1048884913300032492SeawaterANIDASKASQPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314688_1026436813300032517SeawaterGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314688_1040803313300032517SeawaterLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGIKGGKWGPMGEDLFAQQCLDALDVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTAQIHPFFTPDVFEACYDATVAAFPLE
Ga0314689_1016731513300032518SeawaterLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0314689_1028640913300032518SeawaterTLAANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFQACYDATVAAFGA
Ga0314689_1032744713300032518SeawaterLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314676_1046662013300032519SeawaterLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCLDALDVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTAQIHPFFTPDVFEACYDATVAAFPLE
Ga0314676_1082731513300032519SeawaterSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFEACYDATVAAFG
Ga0314680_1033209113300032521SeawaterFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDANGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314680_1051932713300032521SeawaterFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314680_1085019313300032521SeawaterLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0314677_1029718923300032522SeawaterWKTGVHGGKFGPMGEDLFAQQCLDANGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314677_1037114213300032522SeawaterSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFG
Ga0314677_1056687013300032522SeawaterEVFSLAAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCLDELGVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDVFGACYDATVAAFGLE
Ga0314677_1072951913300032522SeawaterFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDTLGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0314682_1029447913300032540SeawaterLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314682_1058734613300032540SeawaterQMVPATGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKVSLPWKTGVHGGKFGPMGEDLFAQQCLDTLGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0314682_1062183713300032540SeawaterLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCLDELGVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDVFEACYDATVAAFGLE
Ga0314674_1066701113300032615SeawaterFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDALDVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTAQIHPFFTPDVFEACYDATVAAFPLE
Ga0314683_1034088413300032617SeawaterEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGA
Ga0314683_1056123413300032617SeawaterVMKLDADAVFVPSRLKPILAKQMVPATGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGIKGGKWGPMGEDLFAQQCLDALDVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTAQIHPFFTPDVFEACYDATVAAFPLE
Ga0314673_1021404913300032650SeawaterFSLAAFETLAANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDANGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGA
Ga0314673_1027182313300032650SeawaterGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314673_1034306313300032650SeawaterLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314673_1037199013300032650SeawaterGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314673_1041882613300032650SeawaterFLAKQMVPVTGIYLENCKHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCMDDLGVPRVEQYDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDAFEACYDATVAAFGLE
Ga0314673_1057691913300032650SeawaterLENCQHVSYGYFGNLEVFSLAAFETLVANIDACTVSLPWKTGVHGGKFGPMGEDLFAQQCLDTLGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0314678_1054424513300032666SeawaterYFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314687_1013811723300032707SeawaterAKQMVPATGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGTFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFEVCYDATVAAFGA
Ga0314687_1018732813300032707SeawaterWVMKLDADAVFVPSRLKPILAKQMVPATGIYLENCEHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314687_1063853023300032707SeawaterVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCLDELGVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDAFEACYDATVAAFGLE
Ga0314687_1068127913300032707SeawaterCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314687_1075851313300032707SeawaterSYGYFGNLEVFSLAAFETLVANIDACKVSLPWKTGVHGGKFGPMGEDLFAQQCLDTLGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFG
Ga0314669_1033699313300032708SeawaterLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314669_1049409013300032708SeawaterLAAFETLVANIDACKASLPWKTGIKGGKWGPMGEDLFAQQCLDALDVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTAQIHPFFTPDVFEACYDATVAAFPLE
Ga0314669_1054199013300032708SeawaterLAAFETLVANIDACKASLPWKTGIKGGKWGPMGEDLFAQQCMDDLGVPRVEQYDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDAFEACYDATVAAFGLE
Ga0314669_1054519713300032708SeawaterFGNLEVFSLAAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCLDELGVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDAFEACYDATVAAFGLE
Ga0314669_1062989413300032708SeawaterPATGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKVSLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0314681_1050104213300032711SeawaterENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCLDELGVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDVFEACYDATVAAFGLE
Ga0314690_1023753123300032713SeawaterVMKLDADAVFVPSRLKPILAKQMVPATGIYLENCEHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314690_1039195713300032713SeawaterVMKLDADAVFVPSRLKPILAKQMVPATGIYLENCEHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCLDELGVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDVFEACYDATVAAFGLE
Ga0314686_1019990613300032714SeawaterVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314703_1018788213300032723SeawaterNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVLGACYDATVAAFGA
Ga0314693_1036401213300032727SeawaterGIYLENCEHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314693_1048337713300032727SeawaterGVHGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314693_1059950913300032727SeawaterFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCLDELGVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDVFEACYDATVAAFGLE
Ga0314693_1064841913300032727SeawaterAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCMDDLGVPRVEQYDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDAFEACYDATVAAFGLE
Ga0314696_1041585613300032728SeawaterVPSRLKPFLAKQMVPVTGIYLENCKHVSYGYFGTLEVFSLAAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCMDDLGVPRVEQYDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDAFEACYDATVAAFGLE
Ga0314696_1048189313300032728SeawaterDAVFVPSRLKPILAKQMVPATGIYLENCEHVSYGYFGNLEVFSLAAFETLVANIDACKVSLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0314696_1070381213300032728SeawaterVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFEACYDATVAAFGA
Ga0314697_1050900213300032729SeawaterTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314699_1035089513300032730SeawaterTGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCLDELGVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDVFEACYDATVAAFGLE
Ga0314699_1038242413300032730SeawaterWKTGVQGGKWGPMGEDIFAQQCLDSLGAPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314699_1042535413300032730SeawaterANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCMDDLGVPRVEQYDISTDGCCEADRPEGEKKNKKYVPDCATTSTAQIHPFFTPDVFEACYDATVAAFPLE
Ga0314711_1040070313300032732SeawaterSLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314711_1045063313300032732SeawaterYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314714_1035910213300032733SeawaterFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314714_1043027713300032733SeawaterPATGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGIKGGKWGPMGEDLFAQQCLDALDVPRVEQFDISTDGCCEADRPEGEKKNNKYVPDCATTSTAQIHPFFTPDVFEACYDATVAAFPLE
Ga0314714_1075759413300032733SeawaterETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314710_1023778913300032742SeawaterGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314710_1027645723300032742SeawaterYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVKGGKWGPMGEDLFAQQCMDDLGVPRVEQYDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDAFEACYDATVAAFGL
Ga0314710_1042413113300032742SeawaterQHVSYGYFGNLEVFSLAAFETLVANIDACKVSLPWKTGVHGGKFGPMGEDLFAQQCLDTLGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0314707_1024451113300032743SeawaterQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKWGPMGEDLFAQQCLDELGVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314707_1040885713300032743SeawaterSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGIKGGKWGPMGEDLFAQQCLDALDVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTAQIHPFFTPDVFEACYDATVAAFPLE
Ga0314707_1040909613300032743SeawaterQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314705_1043489513300032744SeawaterYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314704_1049644313300032745SeawaterFSLTAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314701_1017786713300032746SeawaterAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314701_1050379623300032746SeawaterEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314701_1050891013300032746SeawaterVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0314691_1035691013300032749SeawaterSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFG
Ga0314691_1040630513300032749SeawaterSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFG
Ga0314700_1029239913300032752SeawaterKTGVHGGKFGPMGEDLFAQQCLDAIGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314700_1038260513300032752SeawaterAAFETLVANIDACKASLPWKTGVHGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314700_1039044413300032752SeawaterCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGIKGGKWGPMGEDLFAQQCLDALDVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTAQIHPFFTPDVFGACYDATVAAFPLE
Ga0314692_1019827423300032754SeawaterSRLKPILAKQMVPATGIYLENCEHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314692_1052153113300032754SeawaterNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGTCYDATVAAFGA
Ga0314692_1071930813300032754SeawaterFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDTLGVPRVEQFDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFGACYDATVAAFGA
Ga0314709_1020857513300032755SeawaterMKLDADAVFVPSRLKPILAKQMVPATGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDALGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLYTPDVFGACYDATVSAFGA
Ga0314709_1039156113300032755SeawaterILATQMVPATGIYLENCQHVSYGFFGNLEVFSLTAFETLVANIDACKASLPWKTGVQGGKWGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGDKNNKKYVPDCATASTPQIHPLYTPDVFGACYDATVAAFGV
Ga0314709_1057957313300032755SeawaterPSRLKPILAKQMVPATGIYLENCEHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGVHGGKFGPMGEDLFAQQCLDSLGVPRVEQYDISTDGQCEADRPEGEKKNKKYVPDCATASTPQIHPLFTPDVFEACYDATVAAFGS
Ga0314709_1069376413300032755SeawaterTGIYLENCQHVSYGYFGNLEVFSLAAFETLVANIDACKASLPWKTGIKGGKWGPMGEDLFAQQCLDALDVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTAQIHPFFTPDVFEACYDATVAAFPLE
Ga0314709_1069741313300032755SeawaterLVANIDACKASLPWKTGVQGGKFGPMGEDLFAQQCLDSLGVPRVEQFDISTDGCCEADRPEGEKKNKKYVPDCATTSTPQIHPFYTPDVFEACYDATVAAFGLE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.