NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050706

Metagenome / Metatranscriptome Family F050706

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050706
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 39 residues
Representative Sequence LVGMSRVEHVKANARLVGVPPATVEEFSKLFSRGEGA
Number of Associated Samples 128
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.62 %
% of genes from short scaffolds (< 2000 bps) 90.34 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.862 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(20.690 % of family members)
Environment Ontology (ENVO) Unclassified
(27.586 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.655 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.31%    β-sheet: 0.00%    Coil/Unstructured: 67.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF12146Hydrolase_4 17.24
PF07238PilZ 14.48
PF12695Abhydrolase_5 10.34
PF00571CBS 3.45
PF10142PhoPQ_related 1.38
PF00581Rhodanese 0.69
PF13485Peptidase_MA_2 0.69
PF01546Peptidase_M20 0.69
PF03544TonB_C 0.69
PF06127Mpo1-like 0.69
PF06925MGDG_synth 0.69
PF13419HAD_2 0.69
PF01565FAD_binding_4 0.69
PF00990GGDEF 0.69
PF13751DDE_Tnp_1_6 0.69
PF03602Cons_hypoth95 0.69
PF01139RtcB 0.69
PF02558ApbA 0.69
PF13534Fer4_17 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG0707UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferaseCell wall/membrane/envelope biogenesis [M] 0.69
COG074216S rRNA G966 N2-methylase RsmDTranslation, ribosomal structure and biogenesis [J] 0.69
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.69
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 0.69
COG1690RNA-splicing ligase RtcB, repairs tRNA damageTranslation, ribosomal structure and biogenesis [J] 0.69
COG2242Precorrin-6B methylase 2Coenzyme transport and metabolism [H] 0.69
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 0.69
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.69
COG45392-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids)Lipid transport and metabolism [I] 0.69

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.86 %
UnclassifiedrootN/A4.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101515273All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105102370All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300000559|F14TC_101234391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1693Open in IMG/M
3300000734|JGI12535J11911_1004726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1347Open in IMG/M
3300002245|JGIcombinedJ26739_101079463All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300002560|JGI25383J37093_10035325All Organisms → cellular organisms → Bacteria1660Open in IMG/M
3300002906|JGI25614J43888_10168807All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300002909|JGI25388J43891_1026344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia979Open in IMG/M
3300003223|JGI26343J46809_1010120All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300003505|JGIcombinedJ51221_10359295All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300005332|Ga0066388_107981109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi529Open in IMG/M
3300005437|Ga0070710_10746456All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300005451|Ga0066681_10406964All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300005471|Ga0070698_102051920All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005537|Ga0070730_10090654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2127Open in IMG/M
3300005538|Ga0070731_10782650All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005555|Ga0066692_10071229All Organisms → cellular organisms → Bacteria → Acidobacteria1994Open in IMG/M
3300005829|Ga0074479_10037613All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300006031|Ga0066651_10420383All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300006034|Ga0066656_10991183All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300006050|Ga0075028_100910244All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300006163|Ga0070715_10643953All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300006175|Ga0070712_100469073All Organisms → cellular organisms → Bacteria → Acidobacteria1051Open in IMG/M
3300006176|Ga0070765_101604194All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300006871|Ga0075434_102147636Not Available563Open in IMG/M
3300006893|Ga0073928_11082879All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300007255|Ga0099791_10620157All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300009038|Ga0099829_10068641All Organisms → cellular organisms → Bacteria → Acidobacteria2682Open in IMG/M
3300009089|Ga0099828_11970536All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300009524|Ga0116225_1008003All Organisms → cellular organisms → Bacteria5960Open in IMG/M
3300010043|Ga0126380_12196644Not Available510Open in IMG/M
3300010048|Ga0126373_12955352All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300010343|Ga0074044_10008077All Organisms → cellular organisms → Bacteria → Acidobacteria8230Open in IMG/M
3300010360|Ga0126372_11445470All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300010361|Ga0126378_11534617All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300010361|Ga0126378_12414238All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300010366|Ga0126379_10852269All Organisms → cellular organisms → Bacteria → Acidobacteria1012Open in IMG/M
3300010366|Ga0126379_11046519All Organisms → cellular organisms → Bacteria → Acidobacteria921Open in IMG/M
3300010373|Ga0134128_13022164All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300010398|Ga0126383_12719635All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300011269|Ga0137392_11007618All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300011271|Ga0137393_10480780All Organisms → cellular organisms → Bacteria → Acidobacteria1065Open in IMG/M
3300011271|Ga0137393_11182328All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300012096|Ga0137389_10768579All Organisms → cellular organisms → Bacteria → Acidobacteria827Open in IMG/M
3300012189|Ga0137388_10575244All Organisms → cellular organisms → Bacteria → Acidobacteria1047Open in IMG/M
3300012189|Ga0137388_10855193All Organisms → cellular organisms → Bacteria → Acidobacteria842Open in IMG/M
3300012189|Ga0137388_11706576All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300012198|Ga0137364_10382788All Organisms → cellular organisms → Bacteria → Acidobacteria1052Open in IMG/M
3300012198|Ga0137364_10827814All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300012202|Ga0137363_10498851All Organisms → cellular organisms → Bacteria → Acidobacteria1022Open in IMG/M
3300012202|Ga0137363_11531173All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300012203|Ga0137399_11534635All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300012205|Ga0137362_10401365All Organisms → cellular organisms → Bacteria → Acidobacteria1187Open in IMG/M
3300012211|Ga0137377_10260532All Organisms → cellular organisms → Bacteria → Acidobacteria1664Open in IMG/M
3300012211|Ga0137377_10902020All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300012212|Ga0150985_104691321All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300012351|Ga0137386_10127800All Organisms → cellular organisms → Bacteria → Acidobacteria1810Open in IMG/M
3300012361|Ga0137360_11307777All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300012362|Ga0137361_10471772All Organisms → cellular organisms → Bacteria → Acidobacteria1153Open in IMG/M
3300012922|Ga0137394_10372578All Organisms → cellular organisms → Bacteria → Acidobacteria1218Open in IMG/M
3300012924|Ga0137413_11577799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300012925|Ga0137419_11214209All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300012927|Ga0137416_11025091All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300012929|Ga0137404_10119037All Organisms → cellular organisms → Bacteria → Acidobacteria2156Open in IMG/M
3300012944|Ga0137410_11088343All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300012948|Ga0126375_10032121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2617Open in IMG/M
3300012964|Ga0153916_10115365All Organisms → cellular organisms → Bacteria → Acidobacteria2569Open in IMG/M
3300012971|Ga0126369_10535437All Organisms → cellular organisms → Bacteria → Acidobacteria1234Open in IMG/M
3300013306|Ga0163162_12561077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300014169|Ga0181531_10108449All Organisms → cellular organisms → Bacteria → Acidobacteria1662Open in IMG/M
3300014201|Ga0181537_11142868Not Available526Open in IMG/M
3300015054|Ga0137420_1115036All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300016294|Ga0182041_10851153All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300016357|Ga0182032_10090317All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2133Open in IMG/M
3300016357|Ga0182032_10968864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300016422|Ga0182039_10412883All Organisms → cellular organisms → Bacteria → Acidobacteria1148Open in IMG/M
3300016445|Ga0182038_11402654All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300017933|Ga0187801_10162938All Organisms → cellular organisms → Bacteria → Acidobacteria873Open in IMG/M
3300017943|Ga0187819_10710038All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300017955|Ga0187817_10548574All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300017994|Ga0187822_10357580All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300018008|Ga0187888_1253300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300018034|Ga0187863_10850699All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300018085|Ga0187772_10834301All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300018088|Ga0187771_11703560All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300018482|Ga0066669_11398937All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300019890|Ga0193728_1221432All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300020034|Ga0193753_10366124All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium592Open in IMG/M
3300020061|Ga0193716_1286939All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300020579|Ga0210407_10583530All Organisms → cellular organisms → Bacteria → Acidobacteria872Open in IMG/M
3300020581|Ga0210399_10728494All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300020581|Ga0210399_11065080All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300020583|Ga0210401_10959192All Organisms → cellular organisms → Bacteria → Acidobacteria714Open in IMG/M
3300021168|Ga0210406_10234071All Organisms → cellular organisms → Bacteria → Acidobacteria1513Open in IMG/M
3300021168|Ga0210406_10279220All Organisms → cellular organisms → Bacteria → Acidobacteria1363Open in IMG/M
3300021171|Ga0210405_10188003All Organisms → cellular organisms → Bacteria → Acidobacteria1637Open in IMG/M
3300021171|Ga0210405_10748955All Organisms → cellular organisms → Bacteria → Acidobacteria752Open in IMG/M
3300021171|Ga0210405_11287022All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300021181|Ga0210388_10037576All Organisms → cellular organisms → Bacteria4008Open in IMG/M
3300021384|Ga0213876_10495057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300021401|Ga0210393_10150257All Organisms → cellular organisms → Bacteria → Acidobacteria1871Open in IMG/M
3300021406|Ga0210386_10310733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1352Open in IMG/M
3300021407|Ga0210383_11782125All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300021420|Ga0210394_11147166All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300021444|Ga0213878_10355109All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300021475|Ga0210392_10008845All Organisms → cellular organisms → Bacteria5300Open in IMG/M
3300021477|Ga0210398_10707731All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300021559|Ga0210409_10029943All Organisms → cellular organisms → Bacteria → Acidobacteria5243Open in IMG/M
3300024251|Ga0247679_1021597All Organisms → cellular organisms → Bacteria → Acidobacteria1092Open in IMG/M
3300024251|Ga0247679_1066781All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300024288|Ga0179589_10455357All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300026281|Ga0209863_10150602All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300026524|Ga0209690_1133837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium949Open in IMG/M
3300027105|Ga0207944_1001785All Organisms → cellular organisms → Bacteria → Acidobacteria1784Open in IMG/M
3300027383|Ga0209213_1013838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1485Open in IMG/M
3300027575|Ga0209525_1083139All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300027674|Ga0209118_1145805All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300027680|Ga0207826_1073446Not Available943Open in IMG/M
3300027846|Ga0209180_10094153All Organisms → cellular organisms → Bacteria → Acidobacteria1702Open in IMG/M
3300027857|Ga0209166_10226549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia998Open in IMG/M
3300027869|Ga0209579_10540243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300027911|Ga0209698_11302138All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300028792|Ga0307504_10210835All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300029636|Ga0222749_10095811All Organisms → cellular organisms → Bacteria1387Open in IMG/M
3300031057|Ga0170834_106359031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300031128|Ga0170823_10925312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1151Open in IMG/M
3300031231|Ga0170824_118285362All Organisms → cellular organisms → Bacteria → Acidobacteria1007Open in IMG/M
3300031231|Ga0170824_120633166All Organisms → cellular organisms → Bacteria → Acidobacteria926Open in IMG/M
3300031446|Ga0170820_15737123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300031469|Ga0170819_12907555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300031546|Ga0318538_10363957All Organisms → cellular organisms → Bacteria → Acidobacteria781Open in IMG/M
3300031573|Ga0310915_10130477All Organisms → cellular organisms → Bacteria → Acidobacteria1724Open in IMG/M
3300031680|Ga0318574_10184833All Organisms → cellular organisms → Bacteria → Acidobacteria1194Open in IMG/M
3300031718|Ga0307474_10585005All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300031769|Ga0318526_10297102All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300031771|Ga0318546_10540130All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300031910|Ga0306923_10459277All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1444Open in IMG/M
3300031959|Ga0318530_10424177All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300032059|Ga0318533_10816503All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300032180|Ga0307471_100753421All Organisms → cellular organisms → Bacteria → Acidobacteria1140Open in IMG/M
3300032782|Ga0335082_11098120All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300032783|Ga0335079_10039884All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5390Open in IMG/M
3300033004|Ga0335084_10292412All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1684Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil20.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.83%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.14%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.07%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.07%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.38%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.38%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.38%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.38%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.38%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.38%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.69%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.69%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.69%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.69%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.69%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.69%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.69%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.69%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.69%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000734Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300002909Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cmEnvironmentalOpen in IMG/M
3300003223Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022733Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027105Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10151527323300000364SoilTTALVGMSREQHVIANTTLIAVPPATIDQFSRLFSRGQSG*
INPhiseqgaiiFebDRAFT_10510237013300000364SoilVXXALVGMSRVDHVEENLELVGIAPATEAQFMELFQ*
F14TC_10123439143300000559SoilMSREEHVRANSRLVDVPPATIDQFSKLFSRGQPSA*
JGI12535J11911_100472613300000734Tropical Forest SoilMSRTAHVDANAKLVTVPPASLEQLGKLFSRGESV*
JGIcombinedJ26739_10107946313300002245Forest SoilALVGMSHVEHVRENAKLVGVAPATVDQFSKLFTRGEGA*
JGI25383J37093_1003532513300002560Grasslands SoilGITTALVGMSRIEHVRANTRLAEVPPGTMEEFRKLFERGKGA*
JGI25614J43888_1016880723300002906Grasslands SoilPGITTALVGMSRAAHVEANAKLVGVKPAGIDEFSKLFERGNSA*
JGI25388J43891_102634413300002909Grasslands SoilPGITAALVGMSRVEHVKANARMVNVAPATVEDFGKLFARGESA*
JGI26343J46809_101012013300003223Bog Forest SoilSPGITTALVGMSRVEHVHANAKLVSVAPATVDQFTQLFTRGEGA*
JGIcombinedJ51221_1035929523300003505Forest SoilITTALVGMSHPEHVRTNAHLVGVPPATVDEFSKLFSRGESA*
Ga0066388_10798110923300005332Tropical Forest SoilPGITTALVGMSRVEHAKGNARLVSVPPATVDEFSKLFSKGESA*
Ga0070710_1074645623300005437Corn, Switchgrass And Miscanthus RhizosphereGITTALVGMSRTTHVEENSNVVAAAPAGLEQFSQLFQRGENA*
Ga0066681_1040696423300005451SoilSPGITTALVGMSREEHVRANARLVNVPPATIDQFSKLFSRGQSS*
Ga0070698_10205192023300005471Corn, Switchgrass And Miscanthus RhizospherePGITTALVGMSREEHVLANTRLVSVPPATIDQFSKLFSRGQST*
Ga0070730_1009065413300005537Surface SoilTSALVGMSHPEHVKANARLAGIAPATIDEFSKLFARG*
Ga0070731_1078265023300005538Surface SoilSMPGITTALVGMRHTEHVHANAKLLALPLMTEDQFARLFSRGESA*
Ga0066692_1007122913300005555SoilPGITTALVGMSRVEHVKANAGLVSVAPATADEFTKLFSRGEGA*
Ga0074479_1003761313300005829Sediment (Intertidal)ITTALVGMSRREHVEFNLRLVGIPPTPIEQFMKLFEKTGDVEE*
Ga0066651_1042038323300006031SoilPGITTALVGMSRVEHAKANARLMTITPATAEEFSKLFSRGEGA*
Ga0066656_1099118323300006034SoilGMSRVEHAKANARLMTITPATAEEFSKLFSRGEGA*
Ga0075028_10091024413300006050WatershedsGMSRVEHVKSNARLVGVAPATAEQFSKLFSRGEGA*
Ga0070715_1064395323300006163Corn, Switchgrass And Miscanthus RhizosphereGITTALVGMSRQEHVHANARLVGAPPATIDQFSKLFSRGQSSG*
Ga0070712_10046907323300006175Corn, Switchgrass And Miscanthus RhizosphereITTALVGMSHPEHVKTNAHLVGVPPATADEFSKLFSRGESA*
Ga0070765_10160419423300006176SoilTALVGMSRVEHVRANLSIVGVAPASQDQFAKLFQRGEKA*
Ga0075434_10214763613300006871Populus RhizosphereGMSKPEHVTANTRLVGIKPAGINEFSKLFTRGESA*
Ga0073928_1108287913300006893Iron-Sulfur Acid SpringMSKPEHARANTRLLSVPTATVDQFSKLFARGESA*
Ga0099791_1062015723300007255Vadose Zone SoilTTALVGMSRAEHVNANARLVGVAPATAEEFSKLFSRGEGA*
Ga0099829_1006864153300009038Vadose Zone SoilTTALVGMSRAEHVKANARLVGVAPATADEFTKLFSRGEGA*
Ga0099828_1197053623300009089Vadose Zone SoilITTALVGMSHPEHVQTNAHLVGVPPATVDEFSKLFSRGETA*
Ga0116225_100800313300009524Peatlands SoilALVGMSRVAHVEANTRLVGVAPAGTEEFNKLFAQGEGV*
Ga0126380_1219664413300010043Tropical Forest SoilTALVGMSREAHVQANAKLTRVSPATVEQFSRLFARG*
Ga0126373_1295535213300010048Tropical Forest SoilMSRVEHAKANSRLVTVPPATVEEFRRLFSQGESA*
Ga0074044_10008077113300010343Bog Forest SoilATALVGMSRVAHVEANTRLVRIAPAGIEEFNKLFSRGEGA*
Ga0126372_1144547023300010360Tropical Forest SoilGMSRAAHVEANARLVGVKPAGIEEFSRLFEKGGAV*
Ga0126378_1153461713300010361Tropical Forest SoilITTALVGMSRVEHVCANTRLVGVPPATVDEFSQLFAHGEGA*
Ga0126378_1241423823300010361Tropical Forest SoilVGMARAAHVEANARLVSVKPAGIEEFSKMFERGESA*
Ga0126379_1085226913300010366Tropical Forest SoilGMSRTTHVEANAKLVTVPPASLEQFSKLFSRGESA*
Ga0126379_1104651923300010366Tropical Forest SoilALVGMSSVEHAKANARLVNIPPGTVEQFSQLFSRGEGA*
Ga0134128_1278997523300010373Terrestrial SoilMSRVEHVRENLSIVGVPPASQEQFAKLFQRGEKA*
Ga0134128_1302216413300010373Terrestrial SoilMSRVEHVHANAKLVGVAPATVDQFTQLFTRGEGA*
Ga0126383_1271963523300010398Tropical Forest SoilVGMSRLEHAKANARLVGIAPATVDQFSRLFSQGEGA*
Ga0137392_1100761813300011269Vadose Zone SoilVGMSRAEHVKANARLVGVAPATAEQFTKLFSRGEGA*
Ga0137393_1048078013300011271Vadose Zone SoilTPGMTTALVGMRTAVHVRANARLVSVAPASVAQFGKLFERGGAA*
Ga0137393_1118232823300011271Vadose Zone SoilTTALVGMSHAEHVTTNAHLVGVPPATVDEFSKLFSRGETA*
Ga0137389_1076857913300012096Vadose Zone SoilMSRAAHVEANAKLVGVKPAGIDEFSKLFERGNSA*
Ga0137388_1057524433300012189Vadose Zone SoilSPGITTALVGMSRVEHVKANARLVGVAPATAEEFTKLFSRGEGA*
Ga0137388_1085519323300012189Vadose Zone SoilGMSRVEHVKANARLAGVAPATAEEFGKLFSRGEGA*
Ga0137388_1170657613300012189Vadose Zone SoilGITTALVGMSRAEHVKANGRLVGVAPATAGEFNKLFSRGEGA*
Ga0137364_1038278813300012198Vadose Zone SoilPGITTALVGMSRAEHAKANTKLVSVPPATLDQFSQLFSRGESA*
Ga0137364_1082781413300012198Vadose Zone SoilVGMSRVEHVKANARLVGVAPATSEEFSKLFSRGEGA*
Ga0137363_1049885113300012202Vadose Zone SoilLVGMSRVEHVKANSRLVGLPPATVDQFSKLFSRGEGA*
Ga0137363_1153117313300012202Vadose Zone SoilTALVGMSHAEHVTTNAHLVGVPPATVDEFSKLFSRGETA*
Ga0137399_1153463513300012203Vadose Zone SoilTALVGMSRVEHVKANARLVGLAPANVDQFSKLFSRGEGT*
Ga0137362_1040136513300012205Vadose Zone SoilALVGMSRVEHVKANARLVGVEPATAEEFTKLFSRGEGA*
Ga0137377_1026053233300012211Vadose Zone SoilLVGMSRVEHAKANARMVNVAPATVEEFGKLFARGESA*
Ga0137377_1090202023300012211Vadose Zone SoilALVGMSRVEHVKANARLVSVPPATVDEFTKLFASGEGA*
Ga0150985_10469132123300012212Avena Fatua RhizosphereTTALVGMSKPEHVTANTRLVGVKPAGIDEFSKLFTRGESASQ*
Ga0137386_1012780013300012351Vadose Zone SoilITTALVGMCRAEHVNANARLVGIPPATAEEFSKLFSRGEGA*
Ga0137360_1130777723300012361Vadose Zone SoilTTALVGMSRASHVEANAKLVGVKPAGIEEFSKLFERGESA*
Ga0137361_1047177213300012362Vadose Zone SoilITSALVGMSRPEHVRANTRLVGVPPATVEEFSKLFSRGETA*
Ga0137394_1037257813300012922Vadose Zone SoilTALVGMSRVEHVKANARLVGLPPANVDEFSKLFSRGEGA*
Ga0137413_1157779913300012924Vadose Zone SoilITTALVGMANPEHVLANTKLVGVPPANIDQFSKLFTRGESA*
Ga0137419_1121420923300012925Vadose Zone SoilALVGMSHPEHVTTNAHLVGVPPATVDEFSKLFSRGETA*
Ga0137416_1102509113300012927Vadose Zone SoilSPGITTALVGMSRAEHVKANARLMGVAPATAEEFSKLFSRGEGA*
Ga0137404_1011903743300012929Vadose Zone SoilMSRVEHVKANARLVGLPPANVDQFSKLFSHGEGA*
Ga0137410_1108834313300012944Vadose Zone SoilISTALVGMSRVEHVKANARLVGLPPANADEFSKLFSRGEGA*
Ga0126375_1003212113300012948Tropical Forest SoilVRSSPGITTALVGMSREQHVLANAKLVAVPTATIDQFSKLFSRGQVG*
Ga0153916_1011536553300012964Freshwater WetlandsMSKVEHVRANARLAQVASATVDQFSKLFQRGESK*
Ga0126369_1053543713300012971Tropical Forest SoilGITTALVGMSREQHVRANAKLVRIPPATIDQFSQLFSRGQAG*
Ga0163162_1256107723300013306Switchgrass RhizosphereGMSKEQHVIANAKLAAVPPATLDQFSRLFSRGQSG*
Ga0181531_1010844933300014169BogVGMSHLEHVRANAKLIGVPPATVDQFSKLFTRGERA*
Ga0181537_1114286813300014201BogMANPEHVIANTKLVSVPPANIDQFSKLFTRGESA*
Ga0137420_111503623300015054Vadose Zone SoilATALVGMSRAEHVKANARLVRVAPATAEQFSKLFSRGEGA*
Ga0182041_1085115313300016294SoilLVGMSRTTHVEENSNVVAAAPAGLEQFSKLFQRGENA
Ga0182032_1009031713300016357SoilGMSRTAHVEANAKLVTVPPADLEQFSKLFSRDETA
Ga0182032_1096886423300016357SoilVGMSREEHVRANAKLVNLPPATIDQFSRLFSRGQSSG
Ga0182039_1041288313300016422SoilPGITSALVGMSRTAHVEANAKLVTVAPAGLEQFNKLFSRGESA
Ga0182038_1140265413300016445SoilTTALVGMSRTAHVDANAKLVTVPPASLEQLGKLFSRGERA
Ga0187801_1016293813300017933Freshwater SedimentTSALVGMSRTSHVEANARLVEVPPAGLEQFSKLFSRGEGV
Ga0187819_1071003813300017943Freshwater SedimentGITTALVGMSRVEHVRANLAIVGVAPASQDQFSKLFQRGEKA
Ga0187817_1054857423300017955Freshwater SedimentALVGMSRVEHVRANTKLVGVAPATVDQFTKLFTRGEGA
Ga0187822_1035758023300017994Freshwater SedimentALVGMSRTAHVVANARLVEVPPAGIDQFSQLFSRGGGA
Ga0187888_125330023300018008PeatlandTALVGMSRLEHVRANLRLVGIAPAPQDVFSKLFERR
Ga0187863_1085069923300018034PeatlandLVGMTRIEHVRANLSLAEVSPASQDEFSRLFERGKRA
Ga0187772_1083430123300018085Tropical PeatlandLVGMSRAAHVEANAKLVSANPAGIEEFSKLFEKGNSA
Ga0187771_1170356023300018088Tropical PeatlandATALVGMSRVAHVEANTRLVRRAPAGIEEFNKLFAQGEDS
Ga0066669_1139893713300018482Grasslands SoilVGMSRVEHVKANARLVGVAPATTEEFSRLFSRREGA
Ga0193728_122143213300019890SoilPGITTALVGMSRVEHARANTRLVNEPTATVDQFSKLFSRGESA
Ga0193753_1036612423300020034SoilITTALVGMSRPEHARANTRLLNLPTATVDQFSKLFARGESA
Ga0193716_128693913300020061SoilVGMSRVEHVKANSRLVNVPPATEEQFTNLFSRGNEA
Ga0210407_1058353023300020579SoilSSPGITSALVGMSRPEHVRANARLVGLPPATVDEFSKLFSRGETA
Ga0210399_1072849413300020581SoilALVGMSRVEHVEANARLVGAAPATVDQFSKLFTRGEGA
Ga0210399_1106508013300020581SoilALVGMSHAEHVRANTRLLGIPPATVDEFGKLFTRGEGA
Ga0210401_1095919213300020583SoilGITTALVGMSHVEHVHANAKLVSVAPATVDQFTQLFTRGEGA
Ga0210406_1023407143300021168SoilGITTALVGMSRAEHVRANTRLVNIAPATVDEFSKLFARGESA
Ga0210406_1027922013300021168SoilTALVGMSRVEHVKANAKLVSVAPATVDEFTKLFSRGEGA
Ga0210405_1018800313300021171SoilLGGMSRVEHVKANARLVGVPPATVEEFSKLFSGGEGA
Ga0210405_1074895523300021171SoilSTALVGMSHAEHVRANTRLLGIPPATIDEFGKLFTRGEGA
Ga0210405_1128702213300021171SoilLVGMSRVEHVKANARLVGVPPATVEEFSKLFSRGEGA
Ga0210388_1003757613300021181SoilGMSRTPHVEANTRLIVEVPAGLEQFSKLFSRGERA
Ga0213876_1049505713300021384Plant RootsVGMANPEHVVANTKLVSVPPANIDQFSKLFTRGESA
Ga0210393_1015025713300021401SoilLVGMSRVEHVHANAKLVGIAPATVDQFTQLFTRGEGA
Ga0210386_1031073333300021406SoilGITTALVGMSRTAHVEANGRLVSIPPAGLEQFNNLFTKGETA
Ga0210383_1178212513300021407SoilSSPGITTALVGMSHVEHVIANAKLVGVAPATVDQFTQLFTRGESA
Ga0210394_1114716623300021420SoilTALVGMSHVEHVRANAKLAGVAPATRDQFSKLFTRGEGG
Ga0213878_1035510923300021444Bulk SoilTTALVGMSRTAHVEANARLVQAPPAGVEQFGRLFSRSEGS
Ga0210392_1000884583300021475SoilALVGMSRAAHVEANAKLVGVKPAGIDEFSKLFERGESA
Ga0210398_1070773113300021477SoilALVGMSHVEHVHANAKLVSVAPATVDQFTQLFSRGEGA
Ga0210409_1002994313300021559SoilGMARTAHVEANGKLVQVEPAGVAEFSKLFERGEGA
Ga0224562_102447723300022733SoilITTALVGMSRVEHVRENLSIVGVAPASQDQFARLFQRGA
Ga0247679_102159723300024251SoilGMSRVEHVHANAKLVGVAPATVDQFTQLFTRGEGA
Ga0247679_106678123300024251SoilTTALVGMSGADHARANAKLVSIPPATLDQFSQLFSRGESA
Ga0179589_1045535713300024288Vadose Zone SoilLVGMSREEHVRANAKLVAVPPATIEQFSKLFSRGQSST
Ga0209863_1015060223300026281Prmafrost SoilGMSQVEHVRTNARLVKAVPATVEEFSKLFARGESA
Ga0209690_113383713300026524SoilALVGMSREEHVHANAKLISVAPATIDQFSKLFSRGQSST
Ga0207944_100178513300027105Forest SoilVGMSRTTHVEENSNVVAAAPAGLEQLSKLFQRGETA
Ga0209213_101383813300027383Forest SoilFTTALVGMSRVEHVGANLSLVAVPPASKDEFSRLFERGKQV
Ga0209525_108313923300027575Forest SoilTALVGMSRVEHVRANLSLVGVAPASQDQFSKLFQRGEKA
Ga0209118_114580523300027674Forest SoilVGMSHPEHVRANARLVGVAPATVEEFSKLFTRGEGA
Ga0207826_107344623300027680Tropical Forest SoilALVGMSRTARVEANARLVTVPPATLEQFSKLFSRRETA
Ga0209180_1009415313300027846Vadose Zone SoilTTALVGMSRAEHVKANARLVGVAPATADEFTKLFSRGEGA
Ga0209166_1022654913300027857Surface SoilTSALVGMSHPEHVKANARLAGIAPATIDEFSKLFARG
Ga0209579_1054024323300027869Surface SoilSMPGITTALVGMRHTEHVHANAKLLALPLMTEDQFARLFSRGESA
Ga0209698_1130213813300027911WatershedsGMSRAGHVEANAKLIGVKPAGIDEFSKLFQRGESA
Ga0307504_1021083513300028792SoilTALVGMSRVEHVKANSRLVGIPPATVEEFTKLFARGEGA
Ga0222749_1009581123300029636SoilVGMSRVEHVRENLSLVGVAPASQDQFGRLFQRGEKA
Ga0170834_10635903123300031057Forest SoilSGITTALVGMSREEHVRANAKLVAVPPATIDQFSQLFSRGQSST
Ga0170823_1092531233300031128Forest SoilALVGMSREEHVRANAKLVAVPPATIDQFSKLFSRGQSST
Ga0170824_11828536233300031231Forest SoilALVGMSRTTHVEENSNVVAAAPAGLEQFSKLFQRGENA
Ga0170824_12063316623300031231Forest SoilSSPGITTALVGMSRVEHVHANAKLVSVVPATVDQFTQLFSRGEGA
Ga0170820_1573712333300031446Forest SoilITTALVGMSREEHVRANAKLVAVPPATIDQFSKLFSRGQSST
Ga0170819_1290755513300031469Forest SoilLVGMSRQEHVQANAKLVKVPPATIDQFSKLFSRGQPSA
Ga0318538_1036395713300031546SoilGVTTALVGMSRVEHVRANARLVAQEVATLEQLSKLFSRGETA
Ga0310915_1013047743300031573SoilVGMSRTAHVEANAKLVTVPPADLEQFSKLFSRDETA
Ga0318574_1018483313300031680SoilAALVGMSRVEHAKANARMVDVAPATVEEFGKLFSSGESA
Ga0307474_1058500513300031718Hardwood Forest SoilTTALVGMSRVEHVRANLSLVGVAPASEDQFARLFQRGEKA
Ga0318526_1029710223300031769SoilALVGMSRTTHVEANAKLVTVPPASLEQFSKLFSRGESA
Ga0318546_1054013023300031771SoilPGITTGLVGMSHVQHVRANTKLVSVPPATIEQFSNLFSRGEAT
Ga0306923_1045927733300031910SoilALVGMSHVQHVRANTKLVSVPPATIEQFSNLFSRGEAT
Ga0318530_1042417723300031959SoilITTALVGMSRTAHVEANAKLVTVPPADLEQFSKLFSRDETA
Ga0318533_1081650313300032059SoilITTALVGMSRTTHVEANAKLVTVPPASLEQFSKLFSRGESA
Ga0307471_10075342133300032180Hardwood Forest SoilVGMSRVEHARANARLVGLAPANVDQFSKLFSRGEGA
Ga0335082_1109812013300032782SoilTALVGMSRAAHVESNAKLVGVKPAGIEEFSKLFERGNSA
Ga0335079_1003988483300032783SoilTTALVGMSRTAHVQANTRLVQAPPAGIEEFSKLFSGGERS
Ga0335084_1029241233300033004SoilAPGITTALVGMSRAEHARANAKLVSVPPATIDQFSQLFARGESADS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.