Basic Information | |
---|---|
Family ID | F050528 |
Family Type | Metagenome |
Number of Sequences | 145 |
Average Sequence Length | 47 residues |
Representative Sequence | MLAYCGRPPSASFCDRFPYIGPRYARETIAEICSMGVALATAIISQTGS |
Number of Associated Samples | 82 |
Number of Associated Scaffolds | 145 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 91.55 % |
% of genes near scaffold ends (potentially truncated) | 64.83 % |
% of genes from short scaffolds (< 2000 bps) | 71.72 % |
Associated GOLD sequencing projects | 68 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.345 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil (15.172 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.276 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.26% β-sheet: 0.00% Coil/Unstructured: 59.74% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 145 Family Scaffolds |
---|---|---|
PF01738 | DLH | 2.07 |
PF13561 | adh_short_C2 | 1.38 |
PF02775 | TPP_enzyme_C | 1.38 |
PF00107 | ADH_zinc_N | 1.38 |
PF05036 | SPOR | 1.38 |
PF01351 | RNase_HII | 1.38 |
PF06325 | PrmA | 1.38 |
PF02541 | Ppx-GppA | 1.38 |
PF01963 | TraB_PrgY_gumN | 1.38 |
PF14031 | D-ser_dehydrat | 1.38 |
PF00753 | Lactamase_B | 1.38 |
PF02687 | FtsX | 1.38 |
PF00590 | TP_methylase | 1.38 |
PF13365 | Trypsin_2 | 1.38 |
PF00501 | AMP-binding | 0.69 |
PF01943 | Polysacc_synt | 0.69 |
PF00108 | Thiolase_N | 0.69 |
PF13278 | Obsolete Pfam Family | 0.69 |
PF02602 | HEM4 | 0.69 |
PF02699 | YajC | 0.69 |
PF07075 | DUF1343 | 0.69 |
PF00005 | ABC_tran | 0.69 |
PF00128 | Alpha-amylase | 0.69 |
PF05227 | CHASE3 | 0.69 |
PF01075 | Glyco_transf_9 | 0.69 |
PF02803 | Thiolase_C | 0.69 |
PF01895 | PhoU | 0.69 |
PF01336 | tRNA_anti-codon | 0.69 |
PF02321 | OEP | 0.69 |
PF13502 | AsmA_2 | 0.69 |
PF09339 | HTH_IclR | 0.69 |
PF00116 | COX2 | 0.69 |
PF13193 | AMP-binding_C | 0.69 |
PF01425 | Amidase | 0.69 |
PF08245 | Mur_ligase_M | 0.69 |
PF13426 | PAS_9 | 0.69 |
PF13349 | DUF4097 | 0.69 |
PF08281 | Sigma70_r4_2 | 0.69 |
PF13183 | Fer4_8 | 0.69 |
PF00400 | WD40 | 0.69 |
PF02423 | OCD_Mu_crystall | 0.69 |
PF02652 | Lactate_perm | 0.69 |
PF04754 | Transposase_31 | 0.69 |
PF13714 | PEP_mutase | 0.69 |
PF03776 | MinE | 0.69 |
PF03472 | Autoind_bind | 0.69 |
PF11906 | DUF3426 | 0.69 |
PF12700 | HlyD_2 | 0.69 |
PF00285 | Citrate_synt | 0.69 |
PF13546 | DDE_5 | 0.69 |
PF12773 | DZR | 0.69 |
PF13738 | Pyr_redox_3 | 0.69 |
PF01618 | MotA_ExbB | 0.69 |
PF13380 | CoA_binding_2 | 0.69 |
PF01914 | MarC | 0.69 |
PF01207 | Dus | 0.69 |
PF02416 | TatA_B_E | 0.69 |
PF13544 | Obsolete Pfam Family | 0.69 |
PF04348 | LppC | 0.69 |
PF04011 | LemA | 0.69 |
PF00072 | Response_reg | 0.69 |
PF12627 | PolyA_pol_RNAbd | 0.69 |
PF00293 | NUDIX | 0.69 |
PF12221 | HflK_N | 0.69 |
PF00282 | Pyridoxal_deC | 0.69 |
PF00127 | Copper-bind | 0.69 |
PF07859 | Abhydrolase_3 | 0.69 |
PF05977 | MFS_3 | 0.69 |
PF00440 | TetR_N | 0.69 |
PF05768 | Glrx-like | 0.69 |
PF07992 | Pyr_redox_2 | 0.69 |
PF00486 | Trans_reg_C | 0.69 |
PF00676 | E1_dh | 0.69 |
PF01346 | FKBP_N | 0.69 |
PF03150 | CCP_MauG | 0.69 |
PF00117 | GATase | 0.69 |
PF01694 | Rhomboid | 0.69 |
PF00528 | BPD_transp_1 | 0.69 |
PF13361 | UvrD_C | 0.69 |
PF01408 | GFO_IDH_MocA | 0.69 |
PF06580 | His_kinase | 0.69 |
PF01726 | LexA_DNA_bind | 0.69 |
PF03602 | Cons_hypoth95 | 0.69 |
PF01380 | SIS | 0.69 |
PF12833 | HTH_18 | 0.69 |
PF00106 | adh_short | 0.69 |
PF00294 | PfkB | 0.69 |
PF01218 | Coprogen_oxidas | 0.69 |
PF04413 | Glycos_transf_N | 0.69 |
PF13435 | Cytochrome_C554 | 0.69 |
PF02104 | SURF1 | 0.69 |
PF02696 | SelO | 0.69 |
PF00041 | fn3 | 0.69 |
PF01751 | Toprim | 0.69 |
PF00848 | Ring_hydroxyl_A | 0.69 |
PF11839 | Alanine_zipper | 0.69 |
PF01323 | DSBA | 0.69 |
PF02788 | RuBisCO_large_N | 0.69 |
PF00593 | TonB_dep_Rec | 0.69 |
PF00990 | GGDEF | 0.69 |
PF01367 | 5_3_exonuc | 0.69 |
PF09363 | XFP_C | 0.69 |
PF00933 | Glyco_hydro_3 | 0.69 |
PF12710 | HAD | 0.69 |
PF04751 | DUF615 | 0.69 |
PF04613 | LpxD | 0.69 |
PF03734 | YkuD | 0.69 |
COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
---|---|---|---|
COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 2.76 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 2.07 |
COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 1.38 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.38 |
COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 1.38 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
COG1916 | Pheromone shutdown protein TraB, contains GTxH motif (function unknown) | Function unknown [S] | 1.38 |
COG2197 | DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains | Transcription [K] | 1.38 |
COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 1.38 |
COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 1.38 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.38 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.69 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.69 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.69 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.69 |
COG0372 | Citrate synthase | Energy production and conversion [C] | 0.69 |
COG0397 | Protein adenylyltransferase (AMPylase) SelO/YdiU (selenoprotein O) | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
COG0408 | Coproporphyrinogen-III oxidase HemH, oxygen-dependent | Coenzyme transport and metabolism [H] | 0.69 |
COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.69 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.69 |
COG0695 | Glutaredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG0851 | Septum formation topological specificity factor MinE | Cell cycle control, cell division, chromosome partitioning [D] | 0.69 |
COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.69 |
COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.69 |
COG1519 | 3-deoxy-D-manno-octulosonic-acid transferase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.69 |
COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 0.69 |
COG1620 | L-lactate permease | Energy production and conversion [C] | 0.69 |
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.69 |
COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.69 |
COG1850 | Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like protein | Carbohydrate transport and metabolism [G] | 0.69 |
COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
COG1862 | Protein translocase subunit YajC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.69 |
COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.69 |
COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.69 |
COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.69 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.69 |
COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.69 |
COG3028 | Ribosomal 50S subunit-associated protein YjgA, DUF615 family | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG3107 | Outer membrane lipoprotein LpoA, binds and activates PBP1a | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG3118 | Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.69 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.69 |
COG3346 | Cytochrome oxidase assembly protein ShyY1 | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.69 |
COG5464 | Recombination-promoting DNA endonuclease RpnC/YadD | Replication, recombination and repair [L] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 71.03 % |
Unclassified | root | N/A | 28.97 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886015|FOassembled-_contig28870 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300003320|rootH2_10009794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2253 | Open in IMG/M |
3300005260|Ga0074072_1000550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 24251 | Open in IMG/M |
3300005329|Ga0070683_100838151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
3300005335|Ga0070666_10416927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 967 | Open in IMG/M |
3300005367|Ga0070667_100727808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 919 | Open in IMG/M |
3300005367|Ga0070667_101385198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 659 | Open in IMG/M |
3300005435|Ga0070714_100536395 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300005436|Ga0070713_100181269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1893 | Open in IMG/M |
3300005436|Ga0070713_100260922 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1583 | Open in IMG/M |
3300005436|Ga0070713_101657788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 621 | Open in IMG/M |
3300005439|Ga0070711_100803819 | Not Available | 798 | Open in IMG/M |
3300005439|Ga0070711_101916556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 521 | Open in IMG/M |
3300005529|Ga0070741_10011993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15813 | Open in IMG/M |
3300005529|Ga0070741_10018247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11395 | Open in IMG/M |
3300005529|Ga0070741_10021747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9933 | Open in IMG/M |
3300005529|Ga0070741_10059932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4447 | Open in IMG/M |
3300005529|Ga0070741_10060190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4433 | Open in IMG/M |
3300005529|Ga0070741_10128531 | All Organisms → cellular organisms → Bacteria | 2596 | Open in IMG/M |
3300005548|Ga0070665_100002654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 19446 | Open in IMG/M |
3300005548|Ga0070665_100012682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 8488 | Open in IMG/M |
3300005548|Ga0070665_100022794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6304 | Open in IMG/M |
3300005548|Ga0070665_100031690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5320 | Open in IMG/M |
3300005548|Ga0070665_100036447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 4947 | Open in IMG/M |
3300005548|Ga0070665_100053034 | All Organisms → cellular organisms → Bacteria | 4067 | Open in IMG/M |
3300005548|Ga0070665_102227927 | Not Available | 551 | Open in IMG/M |
3300005563|Ga0068855_100787309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63 | 1012 | Open in IMG/M |
3300005563|Ga0068855_102039692 | Not Available | 579 | Open in IMG/M |
3300005591|Ga0070761_10598320 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300005591|Ga0070761_10650894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 658 | Open in IMG/M |
3300005591|Ga0070761_10706041 | Not Available | 632 | Open in IMG/M |
3300005591|Ga0070761_10790602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 597 | Open in IMG/M |
3300005602|Ga0070762_10036431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2661 | Open in IMG/M |
3300005602|Ga0070762_10043318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2459 | Open in IMG/M |
3300005602|Ga0070762_10154025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1377 | Open in IMG/M |
3300005602|Ga0070762_10195096 | Not Available | 1236 | Open in IMG/M |
3300005602|Ga0070762_11177514 | Not Available | 530 | Open in IMG/M |
3300005610|Ga0070763_10168335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1154 | Open in IMG/M |
3300005614|Ga0068856_100895064 | Not Available | 906 | Open in IMG/M |
3300005614|Ga0068856_102432904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300005616|Ga0068852_101281087 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 754 | Open in IMG/M |
3300005712|Ga0070764_10000616 | All Organisms → cellular organisms → Bacteria | 14213 | Open in IMG/M |
3300005712|Ga0070764_10227962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1054 | Open in IMG/M |
3300005841|Ga0068863_101719351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 637 | Open in IMG/M |
3300005841|Ga0068863_102035990 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300005842|Ga0068858_100734055 | Not Available | 962 | Open in IMG/M |
3300005842|Ga0068858_100989481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 824 | Open in IMG/M |
3300005842|Ga0068858_101290434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 718 | Open in IMG/M |
3300005843|Ga0068860_100666276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
3300006175|Ga0070712_101349684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
3300006176|Ga0070765_100656771 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300006176|Ga0070765_100973936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 802 | Open in IMG/M |
3300006176|Ga0070765_101715818 | Not Available | 590 | Open in IMG/M |
3300006893|Ga0073928_10283712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
3300006893|Ga0073928_10612266 | Not Available | 768 | Open in IMG/M |
3300009101|Ga0105247_10050864 | Not Available | 2550 | Open in IMG/M |
3300009545|Ga0105237_10333816 | Not Available | 1520 | Open in IMG/M |
3300009545|Ga0105237_11807749 | Not Available | 619 | Open in IMG/M |
3300009551|Ga0105238_12052217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 606 | Open in IMG/M |
3300010048|Ga0126373_12263144 | Not Available | 604 | Open in IMG/M |
3300010361|Ga0126378_10284089 | Not Available | 1755 | Open in IMG/M |
3300010361|Ga0126378_13142801 | Not Available | 525 | Open in IMG/M |
3300010371|Ga0134125_11154652 | Not Available | 847 | Open in IMG/M |
3300010379|Ga0136449_100328541 | All Organisms → cellular organisms → Bacteria | 2765 | Open in IMG/M |
3300010379|Ga0136449_102586810 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300010379|Ga0136449_103478644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 600 | Open in IMG/M |
3300011120|Ga0150983_10131742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 525 | Open in IMG/M |
3300012359|Ga0137385_10443600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1103 | Open in IMG/M |
3300012927|Ga0137416_10000054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 40057 | Open in IMG/M |
3300012927|Ga0137416_11324508 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300013296|Ga0157374_11030153 | Not Available | 843 | Open in IMG/M |
3300013296|Ga0157374_12722502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 522 | Open in IMG/M |
3300014325|Ga0163163_10097812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2955 | Open in IMG/M |
3300014325|Ga0163163_10734796 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300014325|Ga0163163_11918697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 652 | Open in IMG/M |
3300014968|Ga0157379_10057092 | All Organisms → cellular organisms → Bacteria | 3489 | Open in IMG/M |
3300014968|Ga0157379_10075269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3023 | Open in IMG/M |
3300014968|Ga0157379_10075632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3015 | Open in IMG/M |
3300014968|Ga0157379_10345855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1361 | Open in IMG/M |
3300014968|Ga0157379_10465025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1169 | Open in IMG/M |
3300014968|Ga0157379_11157684 | Not Available | 742 | Open in IMG/M |
3300015242|Ga0137412_10051797 | All Organisms → cellular organisms → Bacteria | 3347 | Open in IMG/M |
3300020580|Ga0210403_10812134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 743 | Open in IMG/M |
3300020582|Ga0210395_11363399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 518 | Open in IMG/M |
3300021086|Ga0179596_10602785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 557 | Open in IMG/M |
3300021170|Ga0210400_10835697 | Not Available | 754 | Open in IMG/M |
3300021180|Ga0210396_10497543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1067 | Open in IMG/M |
3300021402|Ga0210385_10616663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 828 | Open in IMG/M |
3300021402|Ga0210385_10724523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 762 | Open in IMG/M |
3300021405|Ga0210387_10381059 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
3300021405|Ga0210387_10769946 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300021405|Ga0210387_11563856 | Not Available | 562 | Open in IMG/M |
3300021406|Ga0210386_11633802 | Not Available | 534 | Open in IMG/M |
3300021407|Ga0210383_11453408 | Not Available | 569 | Open in IMG/M |
3300021407|Ga0210383_11568710 | Not Available | 543 | Open in IMG/M |
3300021433|Ga0210391_10381775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1106 | Open in IMG/M |
3300021475|Ga0210392_10574494 | Not Available | 835 | Open in IMG/M |
3300021477|Ga0210398_10067116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2922 | Open in IMG/M |
3300021479|Ga0210410_10128666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2249 | Open in IMG/M |
3300024288|Ga0179589_10030961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1878 | Open in IMG/M |
3300025914|Ga0207671_10370290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1137 | Open in IMG/M |
3300025928|Ga0207700_10958567 | Not Available | 766 | Open in IMG/M |
3300025929|Ga0207664_11357291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 631 | Open in IMG/M |
3300025939|Ga0207665_10127773 | Not Available | 1801 | Open in IMG/M |
3300025944|Ga0207661_10811882 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300026035|Ga0207703_11171765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 739 | Open in IMG/M |
3300026035|Ga0207703_11510407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
3300026035|Ga0207703_11612344 | Not Available | 624 | Open in IMG/M |
3300026078|Ga0207702_11403214 | Not Available | 692 | Open in IMG/M |
3300026088|Ga0207641_11881188 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300026557|Ga0179587_11128361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
3300027853|Ga0209274_10482923 | Not Available | 641 | Open in IMG/M |
3300027879|Ga0209169_10001829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12907 | Open in IMG/M |
3300027879|Ga0209169_10006263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 6816 | Open in IMG/M |
3300027879|Ga0209169_10037894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2532 | Open in IMG/M |
3300027879|Ga0209169_10099887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1502 | Open in IMG/M |
3300027884|Ga0209275_10045383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2091 | Open in IMG/M |
3300027908|Ga0209006_10450620 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300027908|Ga0209006_11467596 | Not Available | 518 | Open in IMG/M |
3300028379|Ga0268266_10000228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 97214 | Open in IMG/M |
3300028379|Ga0268266_10000632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 47843 | Open in IMG/M |
3300028379|Ga0268266_10025233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5059 | Open in IMG/M |
3300028379|Ga0268266_10031789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4484 | Open in IMG/M |
3300028536|Ga0137415_10000036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 102002 | Open in IMG/M |
3300028536|Ga0137415_10575133 | Not Available | 937 | Open in IMG/M |
3300028906|Ga0308309_11290779 | Not Available | 628 | Open in IMG/M |
3300029999|Ga0311339_10990250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 789 | Open in IMG/M |
3300030520|Ga0311372_10224619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3091 | Open in IMG/M |
3300030520|Ga0311372_10506374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1770 | Open in IMG/M |
3300030521|Ga0307511_10445352 | Not Available | 514 | Open in IMG/M |
3300030580|Ga0311355_10744992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 906 | Open in IMG/M |
3300030580|Ga0311355_11811127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
3300030617|Ga0311356_11142746 | Not Available | 720 | Open in IMG/M |
3300030618|Ga0311354_10905941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
3300030693|Ga0302313_10143081 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300030906|Ga0302314_10147897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3012 | Open in IMG/M |
3300031231|Ga0170824_112525571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1027 | Open in IMG/M |
3300031708|Ga0310686_101918592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 743 | Open in IMG/M |
3300031715|Ga0307476_10824483 | Not Available | 686 | Open in IMG/M |
3300031962|Ga0307479_11422882 | Not Available | 652 | Open in IMG/M |
3300032160|Ga0311301_10627912 | Not Available | 1538 | Open in IMG/M |
3300032515|Ga0348332_13204325 | Not Available | 1169 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 15.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.03% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 9.66% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.90% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.21% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.83% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.14% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.14% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.07% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.07% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 2.07% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.38% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.38% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.38% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.38% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.69% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.69% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.69% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886015 | Grass soil microbial communities from Rothamsted Park, UK - FO (Mercury 0.02g/kg) assembled | Environmental | Open in IMG/M |
3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
3300005260 | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FOassembled-_0870.00001900 | 2162886015 | Grass Soil | MLAYCGRPPSASFCDRFPYIGPRYARETIAEICSMGVALATAIISQTGS |
rootH2_100097943 | 3300003320 | Sugarcane Root And Bulk Soil | MIAYCGRPAAASFCDQLTHSDDYARELIAKICSLWVALVTAIIRQTGSSP* |
Ga0074072_100055016 | 3300005260 | Soil | MIAYCGRPPTASFGDRLPYIEPRYARETIAETCSLGVALATAIITQTGS* |
Ga0070683_1008381512 | 3300005329 | Corn Rhizosphere | MIAYCGRPPAASSGDRFPYIEPRYARETIAGICSLGVALATAIITQAGS* |
Ga0070666_104169271 | 3300005335 | Switchgrass Rhizosphere | MLAYCGRPSTASSGDPSSYIVPRYARVTIAGSCSLRVALATAIISQTGS |
Ga0070667_1007278082 | 3300005367 | Switchgrass Rhizosphere | MLAYCGRPAAAPFGDRSSYIVPRYARVTIAEMYSLQVALATAIISQTGSWAAGAF* |
Ga0070667_1013851981 | 3300005367 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLGVALATAII |
Ga0070714_1005363952 | 3300005435 | Agricultural Soil | MIAYCGRPPAASSGDRFPYIEPRYARETIAGICSLGVALATAIITQTGS* |
Ga0070713_1001812692 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAYCGRPPAASSGDRFPYIEPRYAREAIAEICSLGVALATAIITQAGS* |
Ga0070713_1002609222 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAYCGRPPAASSGDRFPYIEPRYARETIAGICSLGVALATAIITQTGS* |
Ga0070713_1016577881 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAYCGRPPAASSGDPFAYIVPCYARETIAEICSLGVALATAII |
Ga0070711_1008038191 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAYCGRPSAAYFCDRFPYIEPSYARETIAEICSLRVALATAIISQTGS* |
Ga0070711_1019165562 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PMLAYCGRPSAASFGDRSSYIVPRYARVTIAEMYSLQVALATAIISQTGSWAAGAF* |
Ga0070741_1001199311 | 3300005529 | Surface Soil | MLAYCGRPAAASFCDPFPYIEPRYARETIAESCSLPVVLATAIISQTGS* |
Ga0070741_100182477 | 3300005529 | Surface Soil | MLAYCGRPAVASCCDPFPYIEHRYARETIAAICSLPGALATAIIRQTGSYPT* |
Ga0070741_100217474 | 3300005529 | Surface Soil | MLAYCGRPAAASSCDPFPYIEHSYARETIAGICSLTVALATAIIGQTGS* |
Ga0070741_100599322 | 3300005529 | Surface Soil | MLAYCGRPAAASFCDPFPYIEPRYARETITEICSLPVVLATAIMGQTGSFT* |
Ga0070741_100601902 | 3300005529 | Surface Soil | MIAYCGRPSAASCRDHFPYIDPRYARETIAAICSLAVVLATAIISQTGS* |
Ga0070741_101285313 | 3300005529 | Surface Soil | MLAYCGRPAAAAFCDPFPYIEPRYARETIAEIRSLGVALATAIITQTGS* |
Ga0070665_10000265417 | 3300005548 | Switchgrass Rhizosphere | MIAYCGRPPAASFGDRYSYIVPRYARVTIAETCSLGVALAT |
Ga0070665_1000126823 | 3300005548 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRYPYIEPRYARVTITETCSLGVALATAIITHTGS* |
Ga0070665_1000227946 | 3300005548 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLGVALA |
Ga0070665_1000316901 | 3300005548 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLGVAL |
Ga0070665_1000364471 | 3300005548 | Switchgrass Rhizosphere | MLAYCGRPPAAYSGDPSSYIVPRYARVTIAGICSLGVALATAI |
Ga0070665_1000530342 | 3300005548 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRFPYIVPAMPRETIAEICSLGVALATAIISQTGSREKYQ* |
Ga0070665_1022279272 | 3300005548 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRFPHSTRYARVTIAESCSLAVALATAIITQPGS* |
Ga0068855_1007873091 | 3300005563 | Corn Rhizosphere | MLAYCGRPPAASSGDRFPYIEPRYARETIAAICSLGVALATAIITQTGS* |
Ga0068855_1020396921 | 3300005563 | Corn Rhizosphere | MLAYCGRPSAASFGDRSSYIVPRYARVTIAETCSLRVAL |
Ga0070761_105983202 | 3300005591 | Soil | MITYCGRPSSASFCDRFPYICVGYARETIAETCSIWVALATAIMSQPGS* |
Ga0070761_106508942 | 3300005591 | Soil | MLAYCGRPRSASFCDPFPYIGPRYARETLAESCSTGAALATAIMSQAGS* |
Ga0070761_107060411 | 3300005591 | Soil | MLAYCGRPSSAAFCDPFPYIVPRYARETIAETCSIWVALATAIMSQPGS |
Ga0070761_107906022 | 3300005591 | Soil | MLAYCGRPPSASFCDPFPYIDPRYARKTIAESCSIWVALATAITGQTGPCASYNS* |
Ga0070762_100364313 | 3300005602 | Soil | MLAYCGRPGSASFCDRFPYICVGYARETIAESCSIRVALATAIISQTGSESAPP* |
Ga0070762_100433181 | 3300005602 | Soil | MLAYCGRPRSASFCDRFPYICVGYAREAIAESCSIWVALATAIISQTGSWR* |
Ga0070762_101540252 | 3300005602 | Soil | MLAYCGRPSSASFCDRFPYIDPRYAREAIAEICSSGVALATAIIGQSGS* |
Ga0070762_101950962 | 3300005602 | Soil | MLAYCGRPSSASFCDPFPYIDPRYARETITESCSIWVALATAIISQA |
Ga0070762_111775142 | 3300005602 | Soil | MLAYCGRPRSAVFCDPFPYICVGYARETIAETCSTWVALATAIINQTGSYL* |
Ga0070763_101683353 | 3300005610 | Soil | MLTYCGRPISAAFCDPFPYIGPRYAREAIAESCSSWVALATAIIDQSGS* |
Ga0068856_1008950642 | 3300005614 | Corn Rhizosphere | MLAYCGRPSAASSGDPSSYIVPRYARVTIAGSCSLRVA |
Ga0068856_1024329041 | 3300005614 | Corn Rhizosphere | MLAYCGRLPASSFGDRFPYIVRASRETIAPFSIRLGSSIWVALDTAIISQLG |
Ga0068852_1012810871 | 3300005616 | Corn Rhizosphere | MIAYCGRPTAASFGDRFPHSPRYARETIAEICSLGVAL |
Ga0070764_100006162 | 3300005712 | Soil | MLAYCGRPGSASFRDRFPYICVGYAREAIAESCSIWVALATAIISQTGSWR* |
Ga0070764_102279621 | 3300005712 | Soil | MLAYCGRPRSASFCDPFPYIGPRYARETIAESCSI |
Ga0068863_1017193511 | 3300005841 | Switchgrass Rhizosphere | MIAYCGRPTAASFCDRFPYIEPSYARETIAEICSLRVALATAII |
Ga0068863_1020359901 | 3300005841 | Switchgrass Rhizosphere | MITYCGRLPAASSGDRFPYIDPRYARETIAAICSLGGALATAIIRQTGSQQEYR |
Ga0068858_1007340551 | 3300005842 | Switchgrass Rhizosphere | MIAYCGRPTAASFCDRFPYIRPSYARETIAEICSLRVAL |
Ga0068858_1009894812 | 3300005842 | Switchgrass Rhizosphere | MLAYCGRPPAASFVDRFSYIEPRYARATIDETCSLGVALATAI |
Ga0068858_1012904341 | 3300005842 | Switchgrass Rhizosphere | MIAYCGRPPAASFGDRYSYIVPRYARVTIAETCSLGVALATAII |
Ga0068860_1006662763 | 3300005843 | Switchgrass Rhizosphere | MLAYCGRPSAASSGDPSSYIVPRYARVTIAGSCSLRVALATAIISQAGS* |
Ga0070712_1013496842 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLACCGRPPAASFGDRFPYIVPRYARETIAEICSLGVALATAIISQTGSQGWTKAGRHL* |
Ga0070765_1006567711 | 3300006176 | Soil | MLAYCGRLPSADFCNPSPYKSHYARETIAELGSMGVALATAIISQTG |
Ga0070765_1009739361 | 3300006176 | Soil | MLAYCGRPRSVGFCDPFPYIVPRYARETIAETYSIWVALATAIIGQTGS |
Ga0070765_1017158181 | 3300006176 | Soil | MLAYCGRPSAASFCDPFPYRCIGYARETIAESCSTRVALATAI |
Ga0073928_102837122 | 3300006893 | Iron-Sulfur Acid Spring | MLAYCGRPRSAAFCDRFPYICVGYARETIAESCSIW |
Ga0073928_106122662 | 3300006893 | Iron-Sulfur Acid Spring | MLAYCGRPISSIFCDRFPYIEPRYARETIAETCSIWVALATAIIS |
Ga0105247_100508644 | 3300009101 | Switchgrass Rhizosphere | MIAYCGRPTAASFCDRFPYIEPSYARETIAEICSLRVALATAI |
Ga0105237_103338161 | 3300009545 | Corn Rhizosphere | MIAYCGRPPAASFGDRFPYIVPAMPRETIAESCSL |
Ga0105237_118077491 | 3300009545 | Corn Rhizosphere | MIAYCGRPLAAYSGDPSSYIVTRYARVTIAGICSLGVALATALIGHPGSR |
Ga0105238_120522171 | 3300009551 | Corn Rhizosphere | AASFRDPFAYIAGSMRRETIAEICSLRAVLVTALINQTGS* |
Ga0126373_122631442 | 3300010048 | Tropical Forest Soil | MLAYCGRPAAAAFCDPFPYIVPRYARETIAEIRSLGVALA |
Ga0126378_102840893 | 3300010361 | Tropical Forest Soil | CGRPAAAAFCDRFPYIVPRYARETIAETRSLGVALATAIINQTGS* |
Ga0126378_131428011 | 3300010361 | Tropical Forest Soil | MLAYCGRPAAPASCDRFPYIVPRYARETIAGICSLGVALATAIMSQT |
Ga0134125_111546522 | 3300010371 | Terrestrial Soil | MNAYCGRPPAASFGDRFPSIVPAMPRETIAEICSLGVALATA |
Ga0136449_1003285412 | 3300010379 | Peatlands Soil | MLAYCGRPRSASFCDRFPNIDPRYARETIAESCSIWVALATAIMGQAGS* |
Ga0136449_1025868102 | 3300010379 | Peatlands Soil | MLAYCGRPRSASFCDRFPYICVGYARETIAESCSIWVALA |
Ga0136449_1034786441 | 3300010379 | Peatlands Soil | MLAYCGRPRSASFCDRFPYICVGYARETIAESCSIWVALAT |
Ga0150983_101317421 | 3300011120 | Forest Soil | MLAYCGRPAAAAFCDPFPYIVPRYARETIAGIRSLGVALATAIMSQTGSTAK |
Ga0137385_104436003 | 3300012359 | Vadose Zone Soil | MLAYCGRPSSASFCDRFPYIVLSYARETIAETCSSWVALATAII |
Ga0137416_1000005433 | 3300012927 | Vadose Zone Soil | MIAYCGRPTAASFRDRCAYIVGAMPRGTIAEICSPRVGLVTALIGQTGS* |
Ga0137416_100102555 | 3300012927 | Vadose Zone Soil | MIAYCGRPTAASFCDPFAYIVVTMRAKPIAKICSLWVALATALLGQTGS* |
Ga0137416_101766035 | 3300012927 | Vadose Zone Soil | MFACCGRPAAASFCDPFAYIVFNYARETIAKICSLGAALAT |
Ga0137416_113245081 | 3300012927 | Vadose Zone Soil | MLAYCGRPRSASFCDRFPYICVGYARETIAESCSIWVALATAII |
Ga0157374_110301532 | 3300013296 | Miscanthus Rhizosphere | MLAYCGRPAAAPFGDRSSYIVPRYARVTISEICSLQGALATAIIS |
Ga0157374_127225023 | 3300013296 | Miscanthus Rhizosphere | MIAYCGRPPAASFGYRFPYIEPRYARETIAEICSLGGRPRDGDHY |
Ga0163163_100978122 | 3300014325 | Switchgrass Rhizosphere | MIAYCGRPSAAYFCDRFPYIEPSYARETIAESCSLRVALATAIMSQTGS* |
Ga0163163_107347962 | 3300014325 | Switchgrass Rhizosphere | MIAYCGRPTAAYFCDRFPYIEPSYARETIAEICSLRVALATAIMSQSGSYGIPPTGE* |
Ga0163163_119186972 | 3300014325 | Switchgrass Rhizosphere | MIAYCGRPSAASFCDRFPYIEPSYARETIAESCSLRVALAT |
Ga0157379_100570922 | 3300014968 | Switchgrass Rhizosphere | MLAYCGRPPAASFVDRFSYIEPRYARATIDETCSLGVALATAIMAHTGS* |
Ga0157379_100752691 | 3300014968 | Switchgrass Rhizosphere | MIAYCGRPAAASFCDRFPYIGPSYARETIAEICSL |
Ga0157379_100756322 | 3300014968 | Switchgrass Rhizosphere | MIAYCGRPSTASFCDRFPYIEPSYARETIAEICSLRVALATAIMSQTGS* |
Ga0157379_102213743 | 3300014968 | Switchgrass Rhizosphere | AASFGDRYSYIVPRYARVTIAETCSLGVALATAIISQAGS* |
Ga0157379_103458551 | 3300014968 | Switchgrass Rhizosphere | MLAYCGRPSAAASGDPSSYIVPRYARVTIAGICSLRVALATAIISQTGS |
Ga0157379_104650251 | 3300014968 | Switchgrass Rhizosphere | MITYCGRPTAASFCDRFPYIEPSYARETIAEICSLRVGLATAIMAQTGSR |
Ga0157379_111576842 | 3300014968 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRYSYIVPRYARVTIAETCSLGVALAT |
Ga0137412_100517974 | 3300015242 | Vadose Zone Soil | MIAYCGRPAAASFCDPFAYICAHYARETIAKICSLRVALVTAIISHPGSSR* |
Ga0210403_108121341 | 3300020580 | Soil | MIACCGRPAAAAFGDRFPYIVPRYARETIAEIRSLGVALATALMSQ |
Ga0210395_113633992 | 3300020582 | Soil | MLAYCGRPGSAGFCDPFPYICIGYARETIAETGSTRVALATTIISQTGSRSRHAAVVSVILSPC |
Ga0179596_106027851 | 3300021086 | Vadose Zone Soil | MLAYCGRPRSASFCDRFPYICVGYAREPIAESCSIWVALATAIISQTGSYV |
Ga0210400_108356971 | 3300021170 | Soil | MLAYCGRPSSASFCDRFPYICVGYARETIAESCSIWVALAPAIITHTG |
Ga0210396_104975432 | 3300021180 | Soil | MLAYCGRPSSASFCDRFPYICVRYARETIAESCSMR |
Ga0210385_106166632 | 3300021402 | Soil | MLAYCGRPSSASFCDRCPYICIGYARETIAETCSMRVALGTAIISQTG |
Ga0210385_107245231 | 3300021402 | Soil | MITYCGRPSSASFCDRFPYICVGYARETIAETCSIWVALATAIMSQ |
Ga0210387_103810593 | 3300021405 | Soil | MLAYCGRPRSASFCDRFPYIDPRYARETIAETCSIWVALATAIIS |
Ga0210387_107699461 | 3300021405 | Soil | MLAYCGRPSSASFCDRFPYIDPRYAREAIAEICSSGVALATAI |
Ga0210387_115638562 | 3300021405 | Soil | MITYCGRPSSASFCDRFPYIGLGYARETIAESCSIWVALATVIIDQPGSTAAAGTGDAN |
Ga0210386_116338021 | 3300021406 | Soil | MLAYCGRLSSASFCDRFPYIGPRYARVTIAESCSMR |
Ga0210383_114534082 | 3300021407 | Soil | MLAYCGRPSSASFCDRFPYICVGYARETIAESCSMR |
Ga0210383_115687102 | 3300021407 | Soil | MLAYYGRPAAAASCDPFPYIVPRYARETIAGICSLGVALATAIMSQTGPLG |
Ga0210391_103817753 | 3300021433 | Soil | MLAYCGRPPSAAFRDPFPYIVHAMRGETIAKIGSMRDALATAIIRQTDSKAAAF |
Ga0210392_105744942 | 3300021475 | Soil | PVWLMLAYCGRPGSASFCDRFPYICIGYARKTIAETCSIRVVLATAIISQTGS |
Ga0210398_100671163 | 3300021477 | Soil | MLAYCGRPRSAVFCDPFPYICVGYARETIAETCSTWVALATAIINQTGSYL |
Ga0210410_101286661 | 3300021479 | Soil | MLAYCGRPSSASFCDRFPYICVGYARETIAESCSMRGGLATAIIGQTGYEVSSVATARAA |
Ga0179589_100309613 | 3300024288 | Vadose Zone Soil | MLAYCGRPRSSSFCDRLPYIEPRYARQTIAESCSIWVALATAIISQTGSLASYPGDF |
Ga0207671_103702902 | 3300025914 | Corn Rhizosphere | SMIAYCGRLSAASFRDPFAYIAGSMRRETIAEICSLRAVLVTALINQTGS |
Ga0207700_109585672 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PPAASSGDRFPYIEPRYARETIAGICSLGVALATAIITQTGS |
Ga0207664_113572911 | 3300025929 | Agricultural Soil | MIAYCGRLPAAAFDDPFPYIVPRYARETIVEICSLGVALATALIGQTC |
Ga0207665_101277731 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAYCGRPSAASFGDRFPYIVPAMPRETIAEICSLRVALATAIISQAGSSDI |
Ga0207661_108118822 | 3300025944 | Corn Rhizosphere | MITCCGRPPAASSGDRFPYIEPRYARETIAAICSLRVALATVIIRQAGS |
Ga0207703_111717651 | 3300026035 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRYSYIVPCYARVTIAETCSLGVALATAIISQTGSWPPVEVLSDSAGIS |
Ga0207703_115104072 | 3300026035 | Switchgrass Rhizosphere | MIAYCGRPAAASFCDRFPYIGPSYARETIAEICSLGDG |
Ga0207703_116123442 | 3300026035 | Switchgrass Rhizosphere | MIAYCGRPTAASFCDRFPYIGPSYARETIAEICSLRVALATAIM |
Ga0207702_114032143 | 3300026078 | Corn Rhizosphere | MLAYCGRPSAASSGDPSSYIVPRYARVTIAGSCSLRVALAT |
Ga0207641_118811882 | 3300026088 | Switchgrass Rhizosphere | MITYCGRLPAASSGDRFPYIDPRYARETIAAICSLGGALATAIIRQTGSQQEYRPAS |
Ga0179587_111283611 | 3300026557 | Vadose Zone Soil | MLAYCGRPSSASFCDRFPYICVGYARETIAESWRPARPR |
Ga0209274_104829232 | 3300027853 | Soil | MLAYCGRPSSAAFCDPFPYIVPRYARETIAETCSIWVALATAIMSQPGSSGR |
Ga0209169_1000182910 | 3300027879 | Soil | MLAYCGRPSSASFCDRFPYIDPRYAREAIAEICSSGVALATAIIGQSGS |
Ga0209169_100062633 | 3300027879 | Soil | MITYCGRPSSASFCDRFPYICVGYARETIAETCSIWVALATAIMSQPGS |
Ga0209169_100378941 | 3300027879 | Soil | MLAYCGRPRSVGFCDPFPYIVPCYARETIAETYSIWVALATAIIGQTGSRPHRPLEL |
Ga0209169_100998872 | 3300027879 | Soil | MLAYCGRPASASFCDRFPYIGPRYARETIAETCSMRVALATAIISQTGSWLSTLGYSVL |
Ga0209275_100453833 | 3300027884 | Soil | MLAYCGRPGSASFRDRFPYICVGYAREAIAESCSIWVALATAIISQTGSWR |
Ga0209006_104506202 | 3300027908 | Forest Soil | MLAYCGRPSSASFCDRFPYIDPRYAREAIAEICSSGV |
Ga0209006_114675961 | 3300027908 | Forest Soil | MLAYCGRPSSAAFCDPFPYIDPRYARETIAETCSIWVALATAI |
Ga0268266_1000022844 | 3300028379 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRYPYIEPRYARVTIAETCSLGVALATAIITHTGS |
Ga0268266_100006328 | 3300028379 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLGVALATAIINQTGS |
Ga0268266_100252331 | 3300028379 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLEVALATAI |
Ga0268266_100317891 | 3300028379 | Switchgrass Rhizosphere | MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLGVALATA |
Ga0137415_1000003659 | 3300028536 | Vadose Zone Soil | MIAYCGRPTAASFRDRSAYIVGAMPRGTIAEICSPRVGLVTALIGQTGS |
Ga0137415_105751331 | 3300028536 | Vadose Zone Soil | WLMLAYCGRPSSASFCDRFPYICVGYAREPIAESCSIWVALATAIITHTGS |
Ga0308309_112907792 | 3300028906 | Soil | MLAYCGRPGSAGFCDPFPYICIGYARETIAETCSTRVA |
Ga0311339_109902502 | 3300029999 | Palsa | MIAYCGRPRSAAFCDPFPYIDPRYARETIAEICSIWVALATAIINHTGS |
Ga0311372_102246193 | 3300030520 | Palsa | MLAYCGRPSSANFCDRFSYIGPRYAREAITEICSMSAALATAIIGHTGSAIHHAR |
Ga0311372_105063741 | 3300030520 | Palsa | MLAYCGRPRSASFCDRFPYICVGYARETIAETCSIWVALATAIISHT |
Ga0307511_104453521 | 3300030521 | Ectomycorrhiza | MLAYCGRPSSASFCDRFPYICVGYARETIAESCSIWVALA |
Ga0311355_107449922 | 3300030580 | Palsa | MLAYCGRPPSAAFRDPFPYIVHAMRGETIAKIGSMGDALATAIIGQTGSSA |
Ga0311355_118111271 | 3300030580 | Palsa | MLAYCGRPSSASFCDRFPYICVGYARETIAETCSIWVALVT |
Ga0311356_111427462 | 3300030617 | Palsa | MLAYCGRPRSASFCDRFPSIEPSYARETIAETCSTWVALAT |
Ga0311354_109059412 | 3300030618 | Palsa | MLAYCGRPSSAAFCDPFPYIDPRYARETIAETRSTWVALATAIISQTGSLPPCAPPPTCA |
Ga0302313_101430811 | 3300030693 | Palsa | MLAYCGRPSSAAFCDPFPYIDPRYARETIAETRSTWVALATAI |
Ga0302314_101478974 | 3300030906 | Palsa | MLAYCGRPRSASFCDRFPYICVGYARETIAETCSIWVALATAIISHTGSRS |
Ga0170824_1125255712 | 3300031231 | Forest Soil | MLAYCGRPAAAAFCDPFPYIEPRYARETIAEICSLA |
Ga0310686_1019185922 | 3300031708 | Soil | MLAYCGRPRSAFFCDRFPSIEPSYARETIAETCSTWVALATAIIS |
Ga0307476_108244831 | 3300031715 | Hardwood Forest Soil | MLAYCGRPAAAAQVFEDMGDPFPYIVPRRRRETIAEIRSLGVALVTAIMSQTSSY |
Ga0307479_114228822 | 3300031962 | Hardwood Forest Soil | VMIAYCGRPPAASFRDPLTYISIDYARSTIAEICSLAVALAT |
Ga0311301_106279124 | 3300032160 | Peatlands Soil | MLAYCGRPRSASFCDRFPYICVGYARETIAESCSIWGALAT |
Ga0348332_132043252 | 3300032515 | Plant Litter | MLTYCGRPAAASCGDPFPYIEPRYARETIAASCSLPGGLATAIISQ |
⦗Top⦘ |