NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050515

Metagenome / Metatranscriptome Family F050515

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050515
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 42 residues
Representative Sequence MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRA
Number of Associated Samples 118
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.62 %
% of genes near scaffold ends (potentially truncated) 93.79 %
% of genes from short scaffolds (< 2000 bps) 92.41 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.862 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.724 % of family members)
Environment Ontology (ENVO) Unclassified
(41.379 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.103 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.29%    β-sheet: 0.00%    Coil/Unstructured: 79.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF13365Trypsin_2 14.48
PF13561adh_short_C2 6.90
PF007253HCDH 3.45
PF02798GST_N 2.76
PF00550PP-binding 1.38
PF027373HCDH_N 1.38
PF00043GST_C 1.38
PF05231MASE1 1.38
PF02515CoA_transf_3 1.38
PF00561Abhydrolase_1 1.38
PF00501AMP-binding 0.69
PF00199Catalase 0.69
PF01522Polysacc_deac_1 0.69
PF01264Chorismate_synt 0.69
PF08450SGL 0.69
PF00211Guanylate_cyc 0.69
PF07592DDE_Tnp_ISAZ013 0.69
PF00183HSP90 0.69
PF14497GST_C_3 0.69
PF01553Acyltransferase 0.69
PF02738MoCoBD_1 0.69
PF00771FHIPEP 0.69
PF12974Phosphonate-bd 0.69
PF03725RNase_PH_C 0.69
PF02913FAD-oxidase_C 0.69
PF03466LysR_substrate 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 4.83
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.38
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 1.38
COG0435Glutathionyl-hydroquinone reductaseEnergy production and conversion [C] 1.38
COG0625Glutathione S-transferasePosttranslational modification, protein turnover, chaperones [O] 1.38
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 1.38
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.38
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.38
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 1.38
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 1.38
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 1.38
COG3447Integral membrane sensor domain MASE1Signal transduction mechanisms [T] 1.38
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 1.38
COG0082Chorismate synthaseAmino acid transport and metabolism [E] 0.69
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.69
COG0326Molecular chaperone, HSP90 familyPosttranslational modification, protein turnover, chaperones [O] 0.69
COG0689Ribonuclease PHTranslation, ribosomal structure and biogenesis [J] 0.69
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.69
COG0753CatalaseInorganic ion transport and metabolism [P] 0.69
COG1185Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)Translation, ribosomal structure and biogenesis [J] 0.69
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.69
COG2123Exosome complex RNA-binding protein Rrp42, RNase PH superfamilyIntracellular trafficking, secretion, and vesicular transport [U] 0.69
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.69
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.86 %
UnclassifiedrootN/A4.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003219|JGI26341J46601_10067492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1088Open in IMG/M
3300004091|Ga0062387_100349029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria976Open in IMG/M
3300004633|Ga0066395_10094386All Organisms → cellular organisms → Bacteria → Proteobacteria1429Open in IMG/M
3300005167|Ga0066672_10577258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017729Open in IMG/M
3300005435|Ga0070714_101066282All Organisms → cellular organisms → Bacteria → Proteobacteria787Open in IMG/M
3300005450|Ga0066682_10760199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2589Open in IMG/M
3300005454|Ga0066687_10188120All Organisms → cellular organisms → Bacteria → Proteobacteria1119Open in IMG/M
3300005561|Ga0066699_10853750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales638Open in IMG/M
3300005575|Ga0066702_10139217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1427Open in IMG/M
3300005586|Ga0066691_10684409All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales607Open in IMG/M
3300005764|Ga0066903_101382311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1321Open in IMG/M
3300005842|Ga0068858_101735487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria617Open in IMG/M
3300006176|Ga0070765_100040351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3732Open in IMG/M
3300006796|Ga0066665_10619450All Organisms → cellular organisms → Bacteria → Proteobacteria867Open in IMG/M
3300006854|Ga0075425_101707913All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria708Open in IMG/M
3300009137|Ga0066709_103169389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium600Open in IMG/M
3300009156|Ga0111538_12512234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria646Open in IMG/M
3300009444|Ga0114945_10157079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1306Open in IMG/M
3300009525|Ga0116220_10267447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium748Open in IMG/M
3300009672|Ga0116215_1199541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium881Open in IMG/M
3300009840|Ga0126313_11438814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria572Open in IMG/M
3300010044|Ga0126310_11145779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium621Open in IMG/M
3300010048|Ga0126373_10096538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2725Open in IMG/M
3300010048|Ga0126373_11231818All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetoovum → Candidatus Magnetoovum chiemensis814Open in IMG/M
3300010048|Ga0126373_12597519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria565Open in IMG/M
3300010162|Ga0131853_10791852All Organisms → cellular organisms → Bacteria → Proteobacteria765Open in IMG/M
3300010325|Ga0134064_10330343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria589Open in IMG/M
3300010335|Ga0134063_10530811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria592Open in IMG/M
3300010337|Ga0134062_10795903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300010358|Ga0126370_10083180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2159Open in IMG/M
3300010360|Ga0126372_10680284All Organisms → cellular organisms → Bacteria → Proteobacteria1001Open in IMG/M
3300010361|Ga0126378_10141763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2436Open in IMG/M
3300010361|Ga0126378_11266179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium833Open in IMG/M
3300010399|Ga0134127_10284497Not Available1584Open in IMG/M
3300010401|Ga0134121_11788511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium641Open in IMG/M
3300010880|Ga0126350_10023528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria552Open in IMG/M
3300011269|Ga0137392_11223095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300011442|Ga0137437_1192331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria708Open in IMG/M
3300012189|Ga0137388_10336223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1390Open in IMG/M
3300012202|Ga0137363_10480577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1042Open in IMG/M
3300012202|Ga0137363_10737888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium834Open in IMG/M
3300012207|Ga0137381_10161525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1932Open in IMG/M
3300012359|Ga0137385_11237514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria608Open in IMG/M
3300012948|Ga0126375_11779304Not Available537Open in IMG/M
3300012971|Ga0126369_10024243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales4910Open in IMG/M
3300013770|Ga0120123_1162590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300014325|Ga0163163_10788637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1013Open in IMG/M
3300015242|Ga0137412_10077427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2705Open in IMG/M
3300015373|Ga0132257_103697916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300016294|Ga0182041_10607243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria962Open in IMG/M
3300016294|Ga0182041_11602418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria601Open in IMG/M
3300016319|Ga0182033_10482565All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300016319|Ga0182033_10841364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria810Open in IMG/M
3300016341|Ga0182035_10227329All Organisms → cellular organisms → Bacteria1493Open in IMG/M
3300016341|Ga0182035_12092412All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300016357|Ga0182032_10881710All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300016387|Ga0182040_11578375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria558Open in IMG/M
3300016404|Ga0182037_10550866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria973Open in IMG/M
3300016422|Ga0182039_10695295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria896Open in IMG/M
3300016422|Ga0182039_11088104All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300018090|Ga0187770_11668557Not Available520Open in IMG/M
3300018431|Ga0066655_10458365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria842Open in IMG/M
3300018433|Ga0066667_10328583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1204Open in IMG/M
3300018433|Ga0066667_10839791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium785Open in IMG/M
3300020580|Ga0210403_10569637All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300020582|Ga0210395_11185707Not Available562Open in IMG/M
3300021168|Ga0210406_10317195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1264Open in IMG/M
3300021171|Ga0210405_10201693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1577Open in IMG/M
3300021180|Ga0210396_11040539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria692Open in IMG/M
3300021358|Ga0213873_10008966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2061Open in IMG/M
3300021405|Ga0210387_10772041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria850Open in IMG/M
3300021444|Ga0213878_10059494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1505Open in IMG/M
3300021560|Ga0126371_11291223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria864Open in IMG/M
3300021560|Ga0126371_11871594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103720Open in IMG/M
3300021560|Ga0126371_12268938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300021560|Ga0126371_13516589All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300025906|Ga0207699_11278178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria543Open in IMG/M
3300025915|Ga0207693_10396365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1079Open in IMG/M
3300025915|Ga0207693_11191165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300025944|Ga0207661_11767145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300026315|Ga0209686_1206447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria534Open in IMG/M
3300027383|Ga0209213_1018164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1309Open in IMG/M
3300027703|Ga0207862_1175742All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella genomosp. 10638Open in IMG/M
3300027706|Ga0209581_1157512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium735Open in IMG/M
3300027729|Ga0209248_10084382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium962Open in IMG/M
3300027738|Ga0208989_10069240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1211Open in IMG/M
3300027874|Ga0209465_10009832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00884238Open in IMG/M
3300027894|Ga0209068_10694611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria596Open in IMG/M
3300029636|Ga0222749_10105197All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300031446|Ga0170820_13079002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300031545|Ga0318541_10095556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1590Open in IMG/M
3300031561|Ga0318528_10210144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1042Open in IMG/M
3300031561|Ga0318528_10686054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium548Open in IMG/M
3300031564|Ga0318573_10223063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1002Open in IMG/M
3300031573|Ga0310915_10149724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea rosea1613Open in IMG/M
3300031679|Ga0318561_10679633All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031718|Ga0307474_10126994All Organisms → cellular organisms → Bacteria → Proteobacteria1917Open in IMG/M
3300031719|Ga0306917_10286738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1269Open in IMG/M
3300031724|Ga0318500_10142683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1122Open in IMG/M
3300031753|Ga0307477_10933262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria572Open in IMG/M
3300031763|Ga0318537_10008431All Organisms → cellular organisms → Bacteria3431Open in IMG/M
3300031771|Ga0318546_10224513All Organisms → cellular organisms → Bacteria → Proteobacteria1288Open in IMG/M
3300031782|Ga0318552_10372857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria727Open in IMG/M
3300031793|Ga0318548_10395204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria678Open in IMG/M
3300031795|Ga0318557_10226783Not Available854Open in IMG/M
3300031795|Ga0318557_10497773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria560Open in IMG/M
3300031798|Ga0318523_10598325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria543Open in IMG/M
3300031819|Ga0318568_10172885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1327Open in IMG/M
3300031819|Ga0318568_10266803All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300031831|Ga0318564_10200754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi888Open in IMG/M
3300031833|Ga0310917_10778438All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300031859|Ga0318527_10069979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1405Open in IMG/M
3300031860|Ga0318495_10401039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria604Open in IMG/M
3300031879|Ga0306919_10510814All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300031879|Ga0306919_11335164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium542Open in IMG/M
3300031890|Ga0306925_10891770All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300031896|Ga0318551_10161116Not Available1228Open in IMG/M
3300031896|Ga0318551_10909332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300031912|Ga0306921_10601522All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300031912|Ga0306921_10890036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1011Open in IMG/M
3300031912|Ga0306921_11469401All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300031941|Ga0310912_10462648All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300031945|Ga0310913_11210822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria525Open in IMG/M
3300031946|Ga0310910_10383700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea rosea1112Open in IMG/M
3300031947|Ga0310909_10131812All Organisms → cellular organisms → Bacteria → Proteobacteria2039Open in IMG/M
3300031947|Ga0310909_10396287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea rosea1159Open in IMG/M
3300031947|Ga0310909_11587211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria519Open in IMG/M
3300031981|Ga0318531_10215348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium866Open in IMG/M
3300032001|Ga0306922_10440192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1394Open in IMG/M
3300032002|Ga0307416_102649716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria599Open in IMG/M
3300032043|Ga0318556_10564002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium594Open in IMG/M
3300032044|Ga0318558_10100834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1351Open in IMG/M
3300032044|Ga0318558_10348891All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300032044|Ga0318558_10364651All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300032059|Ga0318533_10623138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea rosea792Open in IMG/M
3300032059|Ga0318533_11099199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300032060|Ga0318505_10515163All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300032060|Ga0318505_10529903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria555Open in IMG/M
3300032065|Ga0318513_10063165All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella1681Open in IMG/M
3300032090|Ga0318518_10188366All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300032174|Ga0307470_11025620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria658Open in IMG/M
3300032261|Ga0306920_100587450All Organisms → cellular organisms → Bacteria1648Open in IMG/M
3300032261|Ga0306920_100597823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1632Open in IMG/M
3300032515|Ga0348332_14034650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria578Open in IMG/M
3300032896|Ga0335075_10014347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD008811906Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.76%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.07%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.07%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.07%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.38%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.38%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.38%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.38%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.38%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.38%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.69%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.69%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.69%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.69%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.69%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.69%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.69%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.69%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.69%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.69%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.69%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009444Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010162Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)Host-AssociatedOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26341J46601_1006749233300003219Bog Forest SoilMARYREISPAEMTSAQKEVHDEIVAGRRGRFGGPFQVLIRSPEVCR
Ga0062387_10034902923300004091Bog Forest SoilMARYLDITPAEMTPAQRRVHDLIVSGRRGRFGGPFQLLIRAPEICEHAA
Ga0066395_1009438623300004633Tropical Forest SoilMARYREISPAEMNSEQHRVRDLIVAGRRGRFGGPFQLLIRAPEICEHAAKL
Ga0066672_1057725813300005167SoilMARYGKITLAEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEICEHAAKL
Ga0070714_10106628223300005435Agricultural SoilMSRYREITTAEMNPEQKRVHDQIVGGKRGRFGGPFQLLIRAPEICEHA
Ga0066682_1076019913300005450SoilMNRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCRHLQRLG
Ga0066687_1018812023300005454SoilMSRYRDITVAEMNPAQKRVHDQIIAGRRGRFGGPFQLLIRA
Ga0066699_1085375013300005561SoilMSRYRDITVGEMDPAQKRVHDQIIAGKRGRFGGPF
Ga0066702_1013921733300005575SoilMARYRDITPAEMTPAQRRVHDLIVSGRRGRFGGPFQL
Ga0066691_1068440913300005586SoilMGRYREITAAEVNPAQQRVHDQIIAGRRGRFGGPFQLLIRAPEIC
Ga0066903_10138231113300005764Tropical Forest SoilLARYKDITVTEMTPAQRRVHDLIVAGRRGRFGGPFPAAD
Ga0068858_10173548713300005842Switchgrass RhizosphereMSRYREISVAEMDPAQKRAHDQIVAGKRGRFGGPFQLLIRAPEIC
Ga0070765_10004035143300006176SoilMARYRELTTAEMNPAQKQVVDEIVSGKRGRFGGPFQLLIRAPEVCKH
Ga0066665_1061945013300006796SoilMSRYREIAPNEMSPAQKRVHDQIIAGKRGRFGGPFHIL
Ga0075425_10170791323300006854Populus RhizosphereLARYREITSAEMTPAQRHVHDLIVAGRRGRFGGPFQ
Ga0066709_10316938913300009137Grasslands SoilMNRYREITAAEMNPAQQRVHDQIIAGRRGRFGGPFQLL
Ga0111538_1251223423300009156Populus RhizosphereMSRYREITAAEMDPAQKRVHDQIVSGKRGRFGGPFQLLIRAPGVCEHA
Ga0114945_1015707933300009444Thermal SpringsMSRYREIAPAEMNPAQKRVHDEIVAGKRGRFGGPFQLL
Ga0116220_1026744723300009525Peatlands SoilMARYRELTTAEMNPVQKSVVDEIVSGKRGRFGGPFQLLVRAPEVC
Ga0116215_119954113300009672Peatlands SoilMARYRELTTAEMNPVQKSVVDEIVSGKRGRFGGPFQLLVRAPE
Ga0126313_1143881423300009840Serpentine SoilMSRYREITAAEMDPAQKRVHDQIVAGKRGRFGGPFQLLIRAP
Ga0126310_1114577923300010044Serpentine SoilMSRYSEIAVGEMTPEQKRVHDQIVSGKRGRFGGPFELLIRAPGVCEHAAP
Ga0126373_1009653833300010048Tropical Forest SoilMARYREITPAEMNSEQHRVHDLIVAGRRGRFADRSSC*
Ga0126373_1123181813300010048Tropical Forest SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEVC
Ga0126373_1259751913300010048Tropical Forest SoilLARYRDITLGEMTPAQRRVHDLIVAGRRGRFGGPFQL
Ga0131853_1079185223300010162Termite GutMTRYREISSAEMTSAQKDVHDEIVAGRRGRFGGPFQILIRAPEVCRHLQRL
Ga0134064_1033034323300010325Grasslands SoilMSRYREIPPAEMSPAQQRVRDQIIAGKRGRFGGPFELLI
Ga0134063_1053081123300010335Grasslands SoilMSRYREISPTEMSPAQKRVHDQIVAGKRGRFGGPFELLIRAPEIC
Ga0134062_1079590313300010337Grasslands SoilMSRYREISPTEMSPAQKRVHDQIIAGKRGRFGGPF
Ga0126370_1008318013300010358Tropical Forest SoilLARYKDITATEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEI
Ga0126372_1068028423300010360Tropical Forest SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCRHL*
Ga0126378_1014176313300010361Tropical Forest SoilMTRYKEISSAEMTSAQKEVRDEIVAGRRGRFGGPFHILIRAP
Ga0126378_1126617923300010361Tropical Forest SoilMARYRELSPPEMTPAQKQVHDEIIAGRRGRFGGPFQLLIRAPEVCRHLS
Ga0134127_1028449713300010399Terrestrial SoilMSRYREIAASEMDPAQKRVHDQIVSGKRGRFGGPFQ
Ga0134121_1178851113300010401Terrestrial SoilMSRYREIAPNEMSPAQRRVHDQIIAGKRGRFGGPF
Ga0126350_1002352823300010880Boreal Forest SoilMSRYREISPAEMNPAQKRVHDQIVAGKRGRFGGPFELLIRAPE
Ga0137392_1122309513300011269Vadose Zone SoilMSRYREIPSAEMSPAQKRVRDQIIAGKRGRFGGPFELLI
Ga0137437_119233123300011442SoilMSRYREIAAAEMSPAQKRVYDQIIAGARGRFGGPFQLLI
Ga0137388_1033622313300012189Vadose Zone SoilMARYREIIPVEMTPAQKRVHDLIVAGRRGRFGAPSNS*
Ga0137363_1048057713300012202Vadose Zone SoilMTRYRDITPAEMTPAQRRVHDLIIAGRRGRFSGPFQLLI
Ga0137363_1073788833300012202Vadose Zone SoilMARYGKITLAEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEICE
Ga0137381_1016152523300012207Vadose Zone SoilMSRYREIPPAEMSPAQQRVRDQIIAGKRGRFGGPFELLIRAPE
Ga0137385_1123751423300012359Vadose Zone SoilMSRYREIPPAEMSPAQQRVRDQVIAGKRGRFGGPFELLIRAPE
Ga0126375_1177930413300012948Tropical Forest SoilMARYREISPAEMNSEQHRVRDLIVAGRRGRFGGPF
Ga0126369_1002424313300012971Tropical Forest SoilMARYREITREEMTPAQRRVRELIIAGRRGRFGGPFQ
Ga0120123_116259023300013770PermafrostMSRYREISAGEMSPAQKRVHDQIIAGARGRFGGPVQLLIR
Ga0163163_1078863713300014325Switchgrass RhizosphereMSRYREITAAEMDPAQKRVHDQIVSGKRGRFGGPFQL
Ga0137412_1007742713300015242Vadose Zone SoilMSRYRDITAAEMNPAQKRVHDLIIAGRRGRFGGPFQLLIRAPE
Ga0132257_10369791613300015373Arabidopsis RhizosphereMSRYREISVGEMTPEQKRVHDQIVSGKRGRFGGPFQLL
Ga0182041_1060724313300016294SoilVARYREIMLSEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEICEHAAK
Ga0182041_1160241823300016294SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPE
Ga0182033_1048256523300016319SoilMTRYREISPVEITPAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCR
Ga0182033_1084136423300016319SoilLARYRNITPAEMTPAQRRVHDLIIAGRRGRFGGPFQ
Ga0182035_1022732923300016341SoilMTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFEILIRAP
Ga0182035_1209241223300016341SoilMTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPF
Ga0182032_1088171043300016357SoilMIRYREMNTVDMTPAQKEVHDEIVAGRRGRFGGPFQILIRAPEVC
Ga0182040_1157837523300016387SoilVARYREIMLSEMTPAQRRVHDLIVAGPRGRFGGPF
Ga0182037_1055086613300016404SoilVARYREIMLSEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEICEHA
Ga0182039_1069529533300016422SoilLARYRDIMPGEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAP
Ga0182039_1108810423300016422SoilMTRYREISPVEITPAQKEVHDEIVAGRRGRFGGPFQILI
Ga0187770_1166855713300018090Tropical PeatlandMPRYRELGTAEMNPAQKSVVDEIVSGKRGRFGGPFQL
Ga0066655_1045836523300018431Grasslands SoilMSRHREIAPNEMSPAPKRVHDQIIAGKRVRFGGSFHILIRSPEICEYASKLG
Ga0066667_1032858323300018433Grasslands SoilMSRYRDIAVAEMNPAQKRVHDQIVAGKRGRFGGPFQ
Ga0066667_1083979113300018433Grasslands SoilMSRYRDITVAEMNPAQKRVHDEIIAGKRGRCGGPFQLLIRAPEHY
Ga0210403_1056963733300020580SoilMTRYREISPAEMTSAQKEVHDEIVAGRRGRFGGPFQIL
Ga0210395_1118570723300020582SoilMARYRELAAADMNPAQKAVVDAIVSGKRGRFGEPFQL
Ga0210406_1031719513300021168SoilMARYREITPAEMTPAQRRVHDLIVAGRRGTLGGPFQLL
Ga0210405_1020169323300021171SoilMARYRELTTAEMNPAQKAVVDEIVSGKRGRFGGPFQLLIRAPEVCR
Ga0210396_1104053913300021180SoilVPRYRDITPGEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEI
Ga0213873_1000896623300021358RhizosphereMSRYRDIAVAEMDPAQRRVHDQIVAGKRGRFGGPFQILIR
Ga0210387_1077204113300021405SoilMTRYREIGSTEMTSAQKEVHDEIVAGRRGRFGGPFQILIRATE
Ga0213878_1005949413300021444Bulk SoilMSRYREISVAEMTAEQKEVQDEIVGGRRGRFGGPFQILIRSPEVCRHL
Ga0126371_1129122313300021560Tropical Forest SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQI
Ga0126371_1187159413300021560Tropical Forest SoilMTRYREISPAEMTSTQKEVHDEIVAGKRGRFGGPFE
Ga0126371_1226893813300021560Tropical Forest SoilMDRYREISPAEMNSQQHRVHDLIVAGRRGRFGGPFQLLIRTL
Ga0126371_1351658913300021560Tropical Forest SoilMSRYREISVGEMNPAQREVHDEIVAGRRGRFGGPFQLLI
Ga0207699_1127817823300025906Corn, Switchgrass And Miscanthus RhizosphereMARYREISSAEMTSAQKKVHDEIVAGRRGRFGGPFQILIRAPE
Ga0207693_1039636533300025915Corn, Switchgrass And Miscanthus RhizosphereMARYRNITPAEMTPAQRRVHDLIIAGRRGRFGGPFQLLIRAPEI
Ga0207693_1119116523300025915Corn, Switchgrass And Miscanthus RhizosphereMARYREITLAEMTPAQRRVHDLIVAGRRGRFGGPFQ
Ga0207661_1176714513300025944Corn RhizosphereMSRYREITFAEMDPAQKRVHDQIVSGKRGRFGGPFQLLIRAPGVCEHAA
Ga0209686_120644723300026315SoilMSRYRDIAVAEMNPAQKRVHDQIVAGKRGRFGVPFQLLIRA
Ga0209213_101816423300027383Forest SoilMSRYRDITAAEMNPAQKRVHDLIIAGRRGRFGGPFQLLIRAPEI
Ga0207862_117574213300027703Tropical Forest SoilMARYREITLDEMTPPQRRVHDLIVAGRRGRFGGPFQLLIRAPEICEPAAQ
Ga0209581_115751213300027706Surface SoilMSRYREITPSEMTPAQKRVHDQIVAGKRGRFGGPFQLLIRAPEICGL
Ga0209248_1008438223300027729Bog Forest SoilMSRYREISPAEMTPAQKQVHDEIVAGKRGRFGGPFQ
Ga0208989_1006924013300027738Forest SoilMSRYRDITAAEMNPAQKRVHDLIIAGRRGRFGGPFQLL
Ga0209465_1000983233300027874Tropical Forest SoilMARYREITPAEMNSEQHRVHDLIVAGRRGRFADRSSC
Ga0209068_1069461123300027894WatershedsMPRYRQLSPAEYNPAQKAAVDEIVSGKRGRFGGPFELLLRS
Ga0222749_1010519713300029636SoilMSRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCRHL
Ga0170820_1307900223300031446Forest SoilLARYRDIAPSEMTPAQSRVHDLIVAGRRGRFGGPFQLLIRAPEICEHAA
Ga0318541_1009555623300031545SoilMARYREITLVEMSPVQRRVHDLILAGRRGRFGGPFQLLIRAPEI
Ga0318528_1021014423300031561SoilMTRYREISAAEMTSAQKEVHDEIVAGRRGRFGGPFQI
Ga0318528_1068605423300031561SoilMTRYREINSAEMTSAQKDVHDEIVAGRRGRFGGPFQILIRAPEVCRHLQ
Ga0318573_1022306323300031564SoilMTRYREINSAEMTSAQKDVHDEIVAGRRGRFGGPFQILIRAPEVC
Ga0310915_1014972413300031573SoilMTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQI
Ga0318561_1067963323300031679SoilMTRYREISPVEITPAQKEVHDEIVAGRRGRFGGPFQI
Ga0307474_1012699413300031718Hardwood Forest SoilMTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFQILIRAPEV
Ga0306917_1028673833300031719SoilVARYREIMLSEMTPAQRRVHDLIVAGQRGRFGGPFQLLIRAPEICEHAAK
Ga0318500_1014268323300031724SoilVARYREITLSEMTPAQRRVHDLIVAGPRGRFGGPFQLLI
Ga0307477_1093326213300031753Hardwood Forest SoilMARYREITTAEMTPAQRRVHDLIVAGRRGRFGGPF
Ga0318537_1000843153300031763SoilMTRYREISPVEITPAQKEVHDEIVAGRRGRFGGPFQILIRAPE
Ga0318546_1022451333300031771SoilMTRYREINSAEMTSAQKDVHDEIVAGRRGRFGGPFQILI
Ga0318552_1037285713300031782SoilMARYREIALGEMTPAQRRVHDQIVTGRRGRFGGPFQLLIRAPEICEPTAKQRTLP
Ga0318548_1039520413300031793SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEGMPPSAAA
Ga0318557_1022678323300031795SoilMARYRDITPGEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEICE
Ga0318557_1049777313300031795SoilMTRYREINTVDMTPAQKEVHDEIVAGRRGRFGGPFQILIRA
Ga0318523_1059832513300031798SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQ
Ga0318568_1017288523300031819SoilMARYREISRAEMNSEQHRVHDLIVAGRRGRFGGPFQLLIRASEICEHAGKL
Ga0318568_1026680313300031819SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRA
Ga0318564_1020075423300031831SoilMTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPF
Ga0310917_1077843823300031833SoilMTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFQILI
Ga0318527_1006997913300031859SoilLARYRDITPGEMTPDQRRVHDLIVAGRRGRFGGPFQLLIRAPEICEHAAK
Ga0318495_1040103913300031860SoilMTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQILI
Ga0306919_1051081423300031879SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILI
Ga0306919_1133516413300031879SoilMARYRDIAPGEMTAAQRRVHDLIVAGRRGRFGGPFQLLIRAPEIC
Ga0306925_1089177013300031890SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEGMPPSAAAGRI
Ga0318551_1016111623300031896SoilMARYRDITPGEMTPAQRRVHDLIVAGRRGRFGGRRRSGRG
Ga0318551_1090933223300031896SoilLARYRNITPAEMTPAQRRVHDLIIAGRRGRFGGPF
Ga0306921_1060152223300031912SoilMTRYREISSADMTSAQKDVHDEIVAGRRGRFGGPFQILIRAPEACRHLQRL
Ga0306921_1089003623300031912SoilMARYREIALGEMTPAQRRVHDQIVTGRRGRFGGPFQLLIRAPEI
Ga0306921_1146940123300031912SoilMTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFQILIR
Ga0310912_1046264833300031941SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEGMPPSAAAGR
Ga0310913_1121082213300031945SoilMARYREITLVEMSPVQRRVHDLILAGRRGRFGGPFQ
Ga0310910_1038370023300031946SoilVAQAAAPGEPEMTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQIPIRAPEECRH
Ga0310909_1013181213300031947SoilMTRYREINSAEMTSAQKDVHDEIVAGRRGRFGGPFQIL
Ga0310909_1039628723300031947SoilMTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQIPIRAPEECRHL
Ga0310909_1158721113300031947SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEGMPPS
Ga0318531_1021534823300031981SoilMTRYREITAAEMTSAQKEVHDEIVAGRRGRFGGPFQILVRAPEVCRHLQ
Ga0306922_1044019223300032001SoilLARYRDITPGEMTPDQRRVHDLIVAGRRGLFGGPFQLLIRAPEICEHAAK
Ga0307416_10264971623300032002RhizosphereMSRYREISVVEMGPAQKRVHDQIVAGKRGRFGGPFQ
Ga0318556_1056400213300032043SoilMARYRDIAPGEMTAAQRRVHDLIVAGRRGRFGGPFQLLI
Ga0318558_1010083423300032044SoilMARYREISRAEMNSEQHRVHDLIARAGAAGSADRSSY
Ga0318558_1034889123300032044SoilMTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCRNL
Ga0318558_1036465123300032044SoilMARYREISPAEMTSAQKEVHDEIVAGRRGRFGGPFQVLIRSPEVCRHL
Ga0318533_1062313813300032059SoilMTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQIP
Ga0318533_1109919923300032059SoilMTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQILIR
Ga0318505_1051516313300032060SoilMTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFQ
Ga0318505_1052990313300032060SoilMARYREISPAEMTSAQKEVHDEIVAGRRGRFGGPFQVLIRSPEVC
Ga0318513_1006316513300032065SoilMARYREISPAEMTSAQKEVHDEIVAGRRGRFGGPFQVLI
Ga0318518_1018836623300032090SoilMTRYREISSAETTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEGMP
Ga0307470_1102562023300032174Hardwood Forest SoilMTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCRHLQRLGNICVGGAP
Ga0306920_10058745013300032261SoilMTRYREISSADMTSAQKEVHDEIVAGRRGRCGGPF
Ga0306920_10059782313300032261SoilMTRYREISSAGMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPE
Ga0348332_1403465013300032515Plant LitterMSRYREISPAEMTSAQKQVHDEIVAGKRGRFGGPF
Ga0335075_1001434713300032896SoilMARYRELSPADMSAAQKAVVDEIVSGKRGRFGGPF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.