


| Basic Information | |
|---|---|
| Family ID | F050511 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MGNLTSALQQLRAERREAQLQVEKLDQAISVIESLNGS |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.14 % |
| % of genes near scaffold ends (potentially truncated) | 88.28 % |
| % of genes from short scaffolds (< 2000 bps) | 81.38 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.310 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.069 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.517 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.448 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 3.45 |
| PF01547 | SBP_bac_1 | 3.45 |
| PF00160 | Pro_isomerase | 2.76 |
| PF07238 | PilZ | 1.38 |
| PF03796 | DnaB_C | 1.38 |
| PF12161 | HsdM_N | 1.38 |
| PF00719 | Pyrophosphatase | 0.69 |
| PF05593 | RHS_repeat | 0.69 |
| PF00293 | NUDIX | 0.69 |
| PF04055 | Radical_SAM | 0.69 |
| PF13195 | DUF4011 | 0.69 |
| PF00383 | dCMP_cyt_deam_1 | 0.69 |
| PF13545 | HTH_Crp_2 | 0.69 |
| PF13570 | PQQ_3 | 0.69 |
| PF13565 | HTH_32 | 0.69 |
| PF03544 | TonB_C | 0.69 |
| PF06289 | FlbD | 0.69 |
| PF01609 | DDE_Tnp_1 | 0.69 |
| PF15780 | ASH | 0.69 |
| PF02371 | Transposase_20 | 0.69 |
| PF00135 | COesterase | 0.69 |
| PF05163 | DinB | 0.69 |
| PF08308 | PEGA | 0.69 |
| PF12146 | Hydrolase_4 | 0.69 |
| PF00589 | Phage_integrase | 0.69 |
| PF09137 | Glucodextran_N | 0.69 |
| PF04794 | YdjC | 0.69 |
| PF13460 | NAD_binding_10 | 0.69 |
| PF01757 | Acyl_transf_3 | 0.69 |
| PF13181 | TPR_8 | 0.69 |
| PF07676 | PD40 | 0.69 |
| PF00082 | Peptidase_S8 | 0.69 |
| PF14329 | DUF4386 | 0.69 |
| PF02897 | Peptidase_S9_N | 0.69 |
| PF13424 | TPR_12 | 0.69 |
| PF00069 | Pkinase | 0.69 |
| PF00933 | Glyco_hydro_3 | 0.69 |
| PF07730 | HisKA_3 | 0.69 |
| PF04545 | Sigma70_r4 | 0.69 |
| PF04313 | HSDR_N | 0.69 |
| PF10604 | Polyketide_cyc2 | 0.69 |
| PF13817 | DDE_Tnp_IS66_C | 0.69 |
| PF00561 | Abhydrolase_1 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.76 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 2.76 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.38 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 1.38 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.69 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.69 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.69 |
| COG1582 | Swarming motility protein SwrD | Cell motility [N] | 0.69 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.69 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.69 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.69 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.69 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.69 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.69 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.69 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.69 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.69 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.69 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.69 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.69 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.69 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.31 % |
| Unclassified | root | N/A | 40.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10215024 | Not Available | 743 | Open in IMG/M |
| 3300001593|JGI12635J15846_10030669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4302 | Open in IMG/M |
| 3300001593|JGI12635J15846_10605176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100881673 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101849647 | Not Available | 505 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10067682 | Not Available | 1387 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10069536 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300004080|Ga0062385_11080377 | Not Available | 543 | Open in IMG/M |
| 3300004092|Ga0062389_102809006 | Not Available | 650 | Open in IMG/M |
| 3300005434|Ga0070709_11660181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300005467|Ga0070706_100163590 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300005471|Ga0070698_100262871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 1658 | Open in IMG/M |
| 3300005534|Ga0070735_10093158 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
| 3300005559|Ga0066700_10710881 | Not Available | 688 | Open in IMG/M |
| 3300005591|Ga0070761_10016541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4097 | Open in IMG/M |
| 3300005610|Ga0070763_10395256 | Not Available | 776 | Open in IMG/M |
| 3300005610|Ga0070763_10985097 | Not Available | 504 | Open in IMG/M |
| 3300005921|Ga0070766_11297083 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006176|Ga0070765_100149223 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300006176|Ga0070765_101989223 | Not Available | 544 | Open in IMG/M |
| 3300006176|Ga0070765_102253440 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006797|Ga0066659_11832253 | Not Available | 514 | Open in IMG/M |
| 3300006893|Ga0073928_10219985 | Not Available | 1473 | Open in IMG/M |
| 3300006893|Ga0073928_10222521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1462 | Open in IMG/M |
| 3300007982|Ga0102924_1062619 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
| 3300007982|Ga0102924_1318920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300009523|Ga0116221_1384206 | Not Available | 610 | Open in IMG/M |
| 3300009524|Ga0116225_1571494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300009643|Ga0116110_1007874 | All Organisms → cellular organisms → Bacteria | 4586 | Open in IMG/M |
| 3300009824|Ga0116219_10504247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 669 | Open in IMG/M |
| 3300010379|Ga0136449_100604703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1868 | Open in IMG/M |
| 3300010379|Ga0136449_102782102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300012096|Ga0137389_11426929 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012199|Ga0137383_11090667 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012201|Ga0137365_10085063 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300012211|Ga0137377_11473337 | Not Available | 607 | Open in IMG/M |
| 3300014159|Ga0181530_10239159 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300014159|Ga0181530_10320868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
| 3300014199|Ga0181535_10825957 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300014489|Ga0182018_10159931 | Not Available | 1282 | Open in IMG/M |
| 3300014489|Ga0182018_10220838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
| 3300014489|Ga0182018_10232462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1020 | Open in IMG/M |
| 3300014495|Ga0182015_10214432 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300017822|Ga0187802_10226471 | Not Available | 721 | Open in IMG/M |
| 3300017932|Ga0187814_10013323 | All Organisms → cellular organisms → Bacteria | 3169 | Open in IMG/M |
| 3300017933|Ga0187801_10273985 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300017943|Ga0187819_10733107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300017946|Ga0187879_10241502 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300017946|Ga0187879_10441434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300017946|Ga0187879_10846497 | Not Available | 511 | Open in IMG/M |
| 3300017995|Ga0187816_10324150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300018007|Ga0187805_10094855 | Not Available | 1348 | Open in IMG/M |
| 3300018012|Ga0187810_10315041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300018013|Ga0187873_1045162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1948 | Open in IMG/M |
| 3300018017|Ga0187872_10202659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300018019|Ga0187874_10165829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 929 | Open in IMG/M |
| 3300018022|Ga0187864_10131326 | Not Available | 1261 | Open in IMG/M |
| 3300018026|Ga0187857_10272047 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300018033|Ga0187867_10006854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8377 | Open in IMG/M |
| 3300018034|Ga0187863_10478830 | Not Available | 696 | Open in IMG/M |
| 3300018035|Ga0187875_10039695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2782 | Open in IMG/M |
| 3300018037|Ga0187883_10692053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300018038|Ga0187855_10601531 | Not Available | 640 | Open in IMG/M |
| 3300018040|Ga0187862_10698130 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300018042|Ga0187871_10223181 | Not Available | 1049 | Open in IMG/M |
| 3300018042|Ga0187871_10251174 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300018046|Ga0187851_10019878 | All Organisms → cellular organisms → Bacteria | 4719 | Open in IMG/M |
| 3300018047|Ga0187859_10890585 | Not Available | 513 | Open in IMG/M |
| 3300018057|Ga0187858_10543232 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300019786|Ga0182025_1057498 | Not Available | 589 | Open in IMG/M |
| 3300019786|Ga0182025_1084735 | Not Available | 652 | Open in IMG/M |
| 3300019786|Ga0182025_1108776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 2438 | Open in IMG/M |
| 3300019786|Ga0182025_1124782 | Not Available | 878 | Open in IMG/M |
| 3300019879|Ga0193723_1138209 | Not Available | 663 | Open in IMG/M |
| 3300019888|Ga0193751_1004413 | All Organisms → cellular organisms → Bacteria | 8037 | Open in IMG/M |
| 3300020579|Ga0210407_10013952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5977 | Open in IMG/M |
| 3300020579|Ga0210407_10509564 | Not Available | 940 | Open in IMG/M |
| 3300020580|Ga0210403_10264900 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300020583|Ga0210401_10517819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1055 | Open in IMG/M |
| 3300021168|Ga0210406_10916581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300021171|Ga0210405_11394223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 511 | Open in IMG/M |
| 3300021178|Ga0210408_10954074 | Not Available | 665 | Open in IMG/M |
| 3300021180|Ga0210396_10068828 | All Organisms → cellular organisms → Bacteria | 3223 | Open in IMG/M |
| 3300021180|Ga0210396_10931650 | Not Available | 739 | Open in IMG/M |
| 3300021181|Ga0210388_10268189 | Not Available | 1499 | Open in IMG/M |
| 3300021181|Ga0210388_10363244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1273 | Open in IMG/M |
| 3300021404|Ga0210389_10763728 | Not Available | 756 | Open in IMG/M |
| 3300021405|Ga0210387_11297078 | Not Available | 629 | Open in IMG/M |
| 3300021406|Ga0210386_10210451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 1649 | Open in IMG/M |
| 3300021406|Ga0210386_11533233 | Not Available | 555 | Open in IMG/M |
| 3300021407|Ga0210383_10312993 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300021407|Ga0210383_11554349 | Not Available | 546 | Open in IMG/M |
| 3300021420|Ga0210394_10107021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2420 | Open in IMG/M |
| 3300021420|Ga0210394_10841476 | Not Available | 800 | Open in IMG/M |
| 3300021420|Ga0210394_11268937 | Not Available | 630 | Open in IMG/M |
| 3300021432|Ga0210384_11444643 | Not Available | 593 | Open in IMG/M |
| 3300021474|Ga0210390_10622598 | Not Available | 904 | Open in IMG/M |
| 3300021474|Ga0210390_10809250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300021474|Ga0210390_11529539 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300021474|Ga0210390_11601607 | Not Available | 513 | Open in IMG/M |
| 3300021475|Ga0210392_10727674 | Not Available | 739 | Open in IMG/M |
| 3300021477|Ga0210398_11247425 | Not Available | 586 | Open in IMG/M |
| 3300021479|Ga0210410_10760499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300021479|Ga0210410_10784762 | Not Available | 837 | Open in IMG/M |
| 3300021479|Ga0210410_11364749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300021479|Ga0210410_11817914 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300022513|Ga0242667_1009547 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300022557|Ga0212123_10029551 | All Organisms → cellular organisms → Bacteria | 5697 | Open in IMG/M |
| 3300022733|Ga0224562_1022705 | Not Available | 520 | Open in IMG/M |
| 3300022881|Ga0224545_1022536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300022881|Ga0224545_1056729 | Not Available | 552 | Open in IMG/M |
| 3300023259|Ga0224551_1096033 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300024271|Ga0224564_1077714 | Not Available | 664 | Open in IMG/M |
| 3300026524|Ga0209690_1065647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1567 | Open in IMG/M |
| 3300027174|Ga0207948_1005727 | Not Available | 1417 | Open in IMG/M |
| 3300027334|Ga0209529_1012214 | Not Available | 1430 | Open in IMG/M |
| 3300027370|Ga0209010_1042746 | Not Available | 773 | Open in IMG/M |
| 3300027604|Ga0208324_1011718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2828 | Open in IMG/M |
| 3300027745|Ga0209908_10196530 | Not Available | 551 | Open in IMG/M |
| 3300027829|Ga0209773_10031510 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300027853|Ga0209274_10020000 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300027869|Ga0209579_10425945 | Not Available | 720 | Open in IMG/M |
| 3300027884|Ga0209275_10134083 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300027895|Ga0209624_10732165 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300028015|Ga0265353_1017182 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 689 | Open in IMG/M |
| 3300028906|Ga0308309_10019525 | Not Available | 4446 | Open in IMG/M |
| 3300029882|Ga0311368_10122577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 2175 | Open in IMG/M |
| 3300029889|Ga0246001_1046857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 962 | Open in IMG/M |
| 3300029999|Ga0311339_10016828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11096 | Open in IMG/M |
| 3300030494|Ga0310037_10078099 | Not Available | 1551 | Open in IMG/M |
| 3300030659|Ga0316363_10310121 | Not Available | 629 | Open in IMG/M |
| 3300030707|Ga0310038_10200748 | Not Available | 952 | Open in IMG/M |
| 3300031231|Ga0170824_103125259 | Not Available | 503 | Open in IMG/M |
| 3300031708|Ga0310686_107667899 | All Organisms → cellular organisms → Bacteria | 6513 | Open in IMG/M |
| 3300031708|Ga0310686_110352179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1880 | Open in IMG/M |
| 3300031708|Ga0310686_112320472 | Not Available | 568 | Open in IMG/M |
| 3300031718|Ga0307474_10000370 | All Organisms → cellular organisms → Bacteria | 32654 | Open in IMG/M |
| 3300031718|Ga0307474_11021458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300031823|Ga0307478_11265256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300031962|Ga0307479_11468275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 639 | Open in IMG/M |
| 3300032160|Ga0311301_12372423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300032160|Ga0311301_12425408 | Not Available | 590 | Open in IMG/M |
| 3300033887|Ga0334790_106689 | Not Available | 899 | Open in IMG/M |
| 3300034195|Ga0370501_0001154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6269 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.07% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.10% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.83% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.76% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.76% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.76% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.07% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.07% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.69% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.69% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_102150241 | 3300001356 | Peatlands Soil | MGNLTNALQELREERKQMQSQVEKLDTAISVIESLNGSGTIT |
| JGI12635J15846_100306695 | 3300001593 | Forest Soil | MSNLNIALQELRAERSRAQMQVEKLDQAISVIQSSNGTATTGKMAHE* |
| JGI12635J15846_106051763 | 3300001593 | Forest Soil | MGNLANALQELRAERKQAQLQVEKLDQAIAVIESLNG |
| JGIcombinedJ26739_1008816731 | 3300002245 | Forest Soil | MANLENALQQLRAEQREAQLHVEKLGQAISVIESLHGS |
| JGIcombinedJ26739_1018496472 | 3300002245 | Forest Soil | MSNPNIALQELRAERSRAQTQVEKLDQAISVIESLNGTANN* |
| JGIcombinedJ51221_100676823 | 3300003505 | Forest Soil | MGNLTSVLQQLRAERKQAQARVESIDQAIAVIESLNGSTF |
| JGIcombinedJ51221_100695364 | 3300003505 | Forest Soil | MGNLGSALQQLRAERKQAQARVESIDQAIAVIESLNGSTF |
| Ga0062385_110803772 | 3300004080 | Bog Forest Soil | MSNLNIALQELRAERSRAQMQVEKLDQAISVIESLNGTATTGKMAHE* |
| Ga0062389_1028090063 | 3300004092 | Bog Forest Soil | MGNLSSALQQLRAERRQAQSRVESIDQAISVIESLNGSGT |
| Ga0070709_116601812 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNLNSALQQLRDERKQAQGQVEKLDQAISVIEGLSSRTN |
| Ga0070706_1001635902 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNLNIALQALRAERSRAQMQVEKLDQASSVIESLNDTATTGRMAHE* |
| Ga0070698_1002628711 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | NLNIALQALRAERSRAQMQVEKLDQASSVIESLNDTATTGRMAHE* |
| Ga0070735_100931583 | 3300005534 | Surface Soil | MGNLNNALQELRAERKHAQARVENLDRAILVIESLNG |
| Ga0066700_107108812 | 3300005559 | Soil | MTNLTNALEQLRAERGIAQAQVEKLDQAISVIESLNGS |
| Ga0070761_100165411 | 3300005591 | Soil | MGNLGSALQELRAERKQAQLLVEKLDQAISVIESLNG |
| Ga0070763_103952562 | 3300005610 | Soil | MGNLGSALHQLREERKRARLQVEKLDQAISVIES* |
| Ga0070763_109850972 | 3300005610 | Soil | MGNLSSALQQLRVERKQAQLHVEKLDQAISVIQSLPGRR* |
| Ga0070766_112970831 | 3300005921 | Soil | LADLENALQALRADLREAQLHVGKLDQATSMIEPLNGA |
| Ga0070765_1001492231 | 3300006176 | Soil | MGNLANALQQLRAERKQVQLQVEKLDTAISAIESLNGSGASRTTNQSTG |
| Ga0070765_1019892232 | 3300006176 | Soil | MGNLTSALQQLRAERKQAQSHVEKLDTAISVIESLNGS |
| Ga0070765_1022534402 | 3300006176 | Soil | MANLENALRQLRAEQREAQSHVEKLGQAISVIESLHGSGSSHQ |
| Ga0066665_104450251 | 3300006796 | Soil | MANLDNALQQLREERKQAQVQVEKLDSAISVIESLGGRNFLARARN |
| Ga0066659_118322531 | 3300006797 | Soil | MANLENALQQLRAERREAQLHLEKLDQAILVIESLNGRGSSR |
| Ga0073928_102199851 | 3300006893 | Iron-Sulfur Acid Spring | MANLTNALQQLRAEQREAQLHVETLDQAISVIESLNGTGVSRK |
| Ga0073928_102225214 | 3300006893 | Iron-Sulfur Acid Spring | MSNLNIALQELRAERSWAQMQVEKLDQAISVIESLNGTATTGKMAHE* |
| Ga0102924_10626191 | 3300007982 | Iron-Sulfur Acid Spring | MGNLDNALQELRAEREKLDKAISVIESLNGTGTSGHTSQSTRIVSAPSR |
| Ga0102924_13189201 | 3300007982 | Iron-Sulfur Acid Spring | MANLTSALQQLREERKRAQTHVGKLDQAISVIESLN |
| Ga0116221_13842061 | 3300009523 | Peatlands Soil | MGNLNNALQQLREERKQAQSHVEKLDTAISVIESLNGSGSF |
| Ga0116225_15714942 | 3300009524 | Peatlands Soil | MPNFDNALQQLREERSRAQVEVDKYDQVISMIESFDGTGVSQNAN |
| Ga0116110_10078741 | 3300009643 | Peatland | VPNLENALQQLREERRRAQAEVEKLDQAISVIESLNG |
| Ga0116219_105042471 | 3300009824 | Peatlands Soil | MPNLENALQELREERSRTQLQVETLDQAISVIESL |
| Ga0136449_1006047032 | 3300010379 | Peatlands Soil | MGNLNNALQELRSERKQAQLQVEKLDQAISVIESL |
| Ga0136449_1027821022 | 3300010379 | Peatlands Soil | MGNLSSALQELRAERKQAQARVESIDRAISVIESLNGSGTFG |
| Ga0137389_114269291 | 3300012096 | Vadose Zone Soil | MGNLNNALQELRAERKQAQSHVEKLDQAISVIESLNRS |
| Ga0137383_110906672 | 3300012199 | Vadose Zone Soil | MASLTNALQELRKERSRAQTEVEKLDQAISVIESLNGSGASRKAN |
| Ga0137365_100850634 | 3300012201 | Vadose Zone Soil | MTNLSNALEQLRAERGKAQAQVEKLDQAISVIESLNGSVGSR |
| Ga0137377_114733372 | 3300012211 | Vadose Zone Soil | MTNLTNALEQLRAERGIAQAQVEKLDQAISVIESLNGSVGSRSTVPRRAG |
| Ga0181530_102391594 | 3300014159 | Bog | MGNLENALRELREQSKQAQLQVEKLDQAISVIESLNGSGASRNGNQPK |
| Ga0181530_103208683 | 3300014159 | Bog | MPNLKDALQQLRQERSRAQAEVEKLDEAISVIESLNGSGVSRKG |
| Ga0181535_108259571 | 3300014199 | Bog | MPNLKDALQQLRQERSRAQAEVEKLDEAISVIESLNG |
| Ga0182018_101599312 | 3300014489 | Palsa | MANLENTLLQLRAEHSRAQLELEKLGQAISAIELLNGSGASR |
| Ga0182018_102208381 | 3300014489 | Palsa | MATLENTLQQLRAEHSRAQFEVEKLGQAISAIESLNGSG |
| Ga0182018_102324623 | 3300014489 | Palsa | MANLKNALQELRAEHSRAQLEVEKLGQAISAIESLDGSGASR |
| Ga0182015_102144323 | 3300014495 | Palsa | MANLENALQQLRAEQREAQLHVQKLDQAISVIESLNGSGPSRIAT |
| Ga0187802_102264712 | 3300017822 | Freshwater Sediment | MGTLSNALQQLREERKQAQLQVEKLDQAISVIESLNGSGTVRQA |
| Ga0187814_100133231 | 3300017932 | Freshwater Sediment | MGNLNNALQELRAELKQAQLHVEKLDQAILVIESLN |
| Ga0187801_102739851 | 3300017933 | Freshwater Sediment | MGNLASALQQLRAERRVAQLQVEKLDQAISVIESLNG |
| Ga0187819_107331072 | 3300017943 | Freshwater Sediment | MGTLSNALQQLREERKQAQLQVEKLDQAISVIESLNGSGTVRQANQS |
| Ga0187879_102415023 | 3300017946 | Peatland | MSNLKDALQQLRQERSRAQAEVEKLDEAISVIESLNGSGISR |
| Ga0187879_104414342 | 3300017946 | Peatland | MANLNNALQQLRAEHGRAQLEVEKLGQAISAIESLNGSGASRKG |
| Ga0187879_108464971 | 3300017946 | Peatland | MANLENALQQLRAERREAHLQVEKLDQAILVIESLNGRGSFRN |
| Ga0187816_103241501 | 3300017995 | Freshwater Sediment | MGTLANALQQLRAERKQAQLQVEKLDQAISVIDSLNGSGTVRQAKTRII |
| Ga0187805_100948553 | 3300018007 | Freshwater Sediment | MGNLSSALQQLRAERKQAQSHVEKLDQAISVIESLNGSGTFATKQPTRII |
| Ga0187810_103150413 | 3300018012 | Freshwater Sediment | MGNLRSALQVLRAERKQAQSHVEKLDSAISVIESLNGSGTVKQAS |
| Ga0187873_10451623 | 3300018013 | Peatland | MPNLENALQELREERSRVQLQVETLDQAISVIESLNGTGVSRRSSRP |
| Ga0187872_102026591 | 3300018017 | Peatland | MATLENALRQLRAERRRAQLEVEKLGQAISVIESLNGSGV |
| Ga0187874_101658292 | 3300018019 | Peatland | MPNLENALQELREERSRVQLQVETLDQAISVIESLNGTGVSRR |
| Ga0187864_101313261 | 3300018022 | Peatland | MANLEIALQQLREERSRTQLQVETLDQAISVIESLN |
| Ga0187857_102720472 | 3300018026 | Peatland | MANLNNALQQLRAEHRRAQLEVEKLGQAISVIESLNGSGTSR |
| Ga0187867_1000685412 | 3300018033 | Peatland | MATLENTLQQLRAEHGRAQLEVEKLGQAISAIESLDGSGASRNGNQPKR |
| Ga0187863_104788302 | 3300018034 | Peatland | MANLNNALQQLRAEHGRAQLEVEKLGQAISAIESLNGSGASRKGNQP |
| Ga0187875_100396955 | 3300018035 | Peatland | MATLENTLQQLRAEHGRAQLEVEKLGQAISAIESLDGSGASR |
| Ga0187883_106920532 | 3300018037 | Peatland | MANLENALQQLRAERREAQLHVEKLDQAISVIESLN |
| Ga0187855_106015312 | 3300018038 | Peatland | MANLENTLQQLRAEHSRAQLEVEKLGQAISAIESL |
| Ga0187862_106981301 | 3300018040 | Peatland | MANLNNALQQLRAEHRRAQLEVEKLGEAISVIESLNGAGSSRNANQPRRV |
| Ga0187871_102231812 | 3300018042 | Peatland | MANLENALQQLRAEHGRAQLEVEKLGQAISAIESLDGSGASRNG |
| Ga0187871_102511742 | 3300018042 | Peatland | MATLENTLQQLRAEHSRAQLEVEKLGQAISAIESLN |
| Ga0187851_100198781 | 3300018046 | Peatland | MAGLTNALQELRAERSRAQSQLQKLDQTISLLVSLNRAGAS |
| Ga0187859_108905851 | 3300018047 | Peatland | MANLENTLQQLRAEHSRAQLEVEKLGQAISAIESLNG |
| Ga0187858_105432321 | 3300018057 | Peatland | MANLENALQQLRAEHGRAQLEVEKLGQAISAIESLDGSGASRNGNQPKRI |
| Ga0182025_10574982 | 3300019786 | Permafrost | MSNLNIALQELRAERSRAQMQVEKLDQAISVIESL |
| Ga0182025_10847351 | 3300019786 | Permafrost | MSNLNIALQELRAERSRAQMQVEKLDQAISKLDQA |
| Ga0182025_11087762 | 3300019786 | Permafrost | MSNLNIALQELRAERSRAQMQVEKLDQPISVIESLNGTATTGKMAHE |
| Ga0182025_11247822 | 3300019786 | Permafrost | MSNLNIALQELRAERSRAQMQVEKLDQAISVIESLNGTATTGKMAHE |
| Ga0193723_11382091 | 3300019879 | Soil | MANLDNALQQLRAERKQAQLQVEKFDKAISVIESLN |
| Ga0193751_10044133 | 3300019888 | Soil | MPNLTSALQQLREERKQAQLQVEKFDQAISAIESLNGSGASRKPARPT |
| Ga0210407_100139525 | 3300020579 | Soil | MGTLSNALQQLREERKQAQLKVEKLDQAISVIESLNGL |
| Ga0210407_105095642 | 3300020579 | Soil | MGNLSSALQQLRAERKQAQARVESIDQAISVIESLNGVGTFGKAAP |
| Ga0210403_102649001 | 3300020580 | Soil | MGNLNNALQELRAERKQAQARVESIDQAISVIESLNGS |
| Ga0210401_105178191 | 3300020583 | Soil | MGNLSGALQQLRAERKQAQARVESIDQAISVIESLNGSGTF |
| Ga0210406_109165812 | 3300021168 | Soil | MGNLTSALQQLRAERKHAQARVESIDQAISVIESLNGAGTVR |
| Ga0210405_113942233 | 3300021171 | Soil | MGNLTSALQQLRAERREAQLQVEKLDQAISVIESLN |
| Ga0210408_109540741 | 3300021178 | Soil | MGNLSSALQQLRAERKQAQARVESIDQAISVIESLNGV |
| Ga0210396_100688282 | 3300021180 | Soil | MSNLNIALQALSAERSRAQMQVEKLDQAIFRYLSH |
| Ga0210396_109316501 | 3300021180 | Soil | MGNLNNALQELRSERKQAQLQVEKLDQAIGVIESLNGSGTS |
| Ga0210388_102681893 | 3300021181 | Soil | MGNLSGALQQLRAERKQAQLHVEKLDQAISVIESLNGSGTFGQANQPT |
| Ga0210388_103632441 | 3300021181 | Soil | MGNLTNALQGLRAERKQAQLQVEKLDQAISVIESLNGTR |
| Ga0210389_107637281 | 3300021404 | Soil | MANLENALQELRSERKHAQLHVERLDRAISVIESLNGSGTSRHP |
| Ga0210387_112970781 | 3300021405 | Soil | MGNLTSVLQQLRAERKQAQARVESIDQAIAVIESLNGSTFGKTNQPT |
| Ga0210386_102104511 | 3300021406 | Soil | MSHLNIALQELRAERSRAQMQVEKLDHAISVIESLNGTAT |
| Ga0210386_115332331 | 3300021406 | Soil | MGNLASALQQLRAERRVAQLQVEKLDKAISVIESLNGSGTL |
| Ga0210383_103129932 | 3300021407 | Soil | MANLENALRELRTERKQAQLQVERLDQAISVIESLDGSGTSRHP |
| Ga0210383_115543492 | 3300021407 | Soil | MANLTNALQQLRAEQREAQLHVEKLDQAISVIESLNRSGTSR |
| Ga0210394_101070213 | 3300021420 | Soil | MGNLNNALQELRAERKQAQLHVEKLDQAISVIESLNGSEP |
| Ga0210394_108414762 | 3300021420 | Soil | MGNLTEALQELRAERKQAQSHVEKLDTAISVIESLNGFGSFG |
| Ga0210394_112689371 | 3300021420 | Soil | MGNLSSALQQLRAERKRAHARVESIDQAILVIESLNGSGTLGNANHRRELYR |
| Ga0210384_114446431 | 3300021432 | Soil | MGNLGSALQQLRAERKQAQARVESIDQAIAVIESLNGSTFGKTNQPTR |
| Ga0210390_106225981 | 3300021474 | Soil | MANLENALQELRTERKQVQLQVERLDRAISVIESLNGAGTSRHPN |
| Ga0210390_108092501 | 3300021474 | Soil | MGTLSNALQQLRQERKQKQSQVEKLDQAISVIESLNG |
| Ga0210390_115295391 | 3300021474 | Soil | MANLENALQQLRAEQRDAQLHAEKLGHAISVIESLRGSGSSHQTSQPKR |
| Ga0210390_116016071 | 3300021474 | Soil | MGNLSSALQQLREERKQAQARVENIDQAISVIESLNGSGTLG |
| Ga0210392_107276741 | 3300021475 | Soil | MANLENALRELRTERKQAQLQVERLDQAISVIESLDGSGTSRH |
| Ga0210398_112474251 | 3300021477 | Soil | MANLTHALQHLRAEQREALLLVEKLGQAISVIESLNGSQTSRNGKQVTRII |
| Ga0210410_107604991 | 3300021479 | Soil | MANLTGVLHQLREEHKRAQTHVDKLDRAISVIESLNSSGESRTTKQPTRII |
| Ga0210410_107847621 | 3300021479 | Soil | MSNLNIALQELRAEHSRARMQVEKLDQAISVIESLNGTATTGKMAHE |
| Ga0210410_113647491 | 3300021479 | Soil | MGNLGSALQQLHAERKKAQLQVETLDQAISVIESINGSGTFGQTNQP |
| Ga0210410_118179142 | 3300021479 | Soil | MGNLNNALQELRAERKQAQLQVEKLDQAISVIESLNGSGTSRN |
| Ga0242667_10095472 | 3300022513 | Soil | IQGGNMPKLSIALQELRAERGRVQSLVEKLDQAISVI |
| Ga0212123_100295515 | 3300022557 | Iron-Sulfur Acid Spring | MSNLNIALQELRAERSRAQMQVEKLDQAISVIQSSNGTATTGKMAHE |
| Ga0224562_10227051 | 3300022733 | Soil | MGNLNNALQELRAERKQAQLQVEKLDQAISVIESLNGSGTLGR |
| Ga0224545_10225362 | 3300022881 | Soil | MGNLNNVLQELRAERKQAQSQVEKLDRAISVIESLNGSGISRQSNQPT |
| Ga0224545_10567291 | 3300022881 | Soil | MGNLVNVLQELRAELKQMQSQVEKLDQAIAVIESLSGT |
| Ga0224551_10960331 | 3300023259 | Soil | MANLENALQQLRAEQREAQLHVEKLGQAISVIESLRGSGSSHQTSQPKRTV |
| Ga0224564_10777141 | 3300024271 | Soil | MVNLSGALQELRAERNRAQLQVEKVDQAISVIESLKGSGTAQNK |
| Ga0209690_10656471 | 3300026524 | Soil | MTNLTNALEQLRAERGIAQAQVEKLDQAISVIESLNGSVGSRS |
| Ga0207948_10057272 | 3300027174 | Forest Soil | MGNLSSALQVLRAEREQAQSHVEKLDTAISVIESLNGSGTLRNANQPT |
| Ga0209529_10122141 | 3300027334 | Forest Soil | MANLNNALQELRAERSRAQLQVEKLDQAISVIESLNGSGTPPRKATQP |
| Ga0209010_10427462 | 3300027370 | Forest Soil | MANLTNALQQLRAEQREAQLHVKKLGQAISVIEALNGS |
| Ga0208324_10117183 | 3300027604 | Peatlands Soil | MGNLGSALQQLREERKQAQAHVEKLDQAISVIESLNGS |
| Ga0209908_101965301 | 3300027745 | Thawing Permafrost | MATLENTLQQLRAEHSRAQLEVEKLGQAISAIESLNGSGASRSGNQPKRII |
| Ga0209773_100315101 | 3300027829 | Bog Forest Soil | MGSLTNALQQLRAERREAQLHVEKLDQAITAIESLNGSGSSHPTSQPKRI |
| Ga0209274_100200003 | 3300027853 | Soil | MGNLGSALQELRAERKQAQLLVEKLDQAISVIESLNGTG |
| Ga0209579_104259451 | 3300027869 | Surface Soil | MGNLNNALQELRAERKHAQARVENLDRAILVIESLN |
| Ga0209275_101340831 | 3300027884 | Soil | MANLENALRELRTERKQAQLQVERLDQAISVIESLDGSGTSRHPNQP |
| Ga0209624_107321652 | 3300027895 | Forest Soil | MANLENALQQLRAEQREAQLHVEKLGQAISVIESLHGSGS |
| Ga0265353_10171821 | 3300028015 | Soil | MGNLSGALQQLRAERKQAQARVEKLDQAISVIESLNGLG |
| Ga0308309_100195251 | 3300028906 | Soil | MGNLNNALQELRAERKQAQLQVEKLEQAISVIESLNGSGPVRHTNQ |
| Ga0311368_101225772 | 3300029882 | Palsa | MSNLNIALQELRAERSRAQIQVEQLDQAISVIESLNGTATTGKMAHE |
| Ga0246001_10468571 | 3300029889 | Peat | MANLEIALQQLREERSRTQLQVETLDQAISVIESLNGTG |
| Ga0311339_100168281 | 3300029999 | Palsa | MSNLNIALQELRAERSRAQIQVEQLDQAISVIESLKGTATTGKMAHE |
| Ga0310037_100780991 | 3300030494 | Peatlands Soil | MGNLNNALQQLREERKQAQSHVEKLDTAISVIESLNGSGSFGR |
| Ga0316363_103101212 | 3300030659 | Peatlands Soil | MPNLENALQELREERSRAQVEVDKYDQAISVIESLDGTGVS |
| Ga0310038_102007481 | 3300030707 | Peatlands Soil | MGNLSSVLQQLRAERKQAQSHVEKLDQAISVIESLNGSGTVR |
| Ga0170824_1031252591 | 3300031231 | Forest Soil | MGNLSSALQQLRTERKQAQARVESIDQAIAVIESLNG |
| Ga0310686_1076678999 | 3300031708 | Soil | MANLTNALQQLRAEQREAQSHVEKLGRAISVIESLNGSGTSR |
| Ga0310686_1103521792 | 3300031708 | Soil | MGNLNNALQELRAERKQAQLQVEKLDQAISVIESLN |
| Ga0310686_1123204721 | 3300031708 | Soil | MGNLSSALQQLRDERKQSQERVESIDQAISVIEALNGSG |
| Ga0307474_1000037035 | 3300031718 | Hardwood Forest Soil | MANLENALQELRTERKQAQLHVEKLDQAISVIESLN |
| Ga0307474_110214581 | 3300031718 | Hardwood Forest Soil | MGNLSSALQQLRAERKQAQARVESIDQAISVIESLNGSGTV |
| Ga0307478_112652561 | 3300031823 | Hardwood Forest Soil | MGNLSSALRELRAKRQETQLQMEKLDQAISVIESLNGSG |
| Ga0307479_114682753 | 3300031962 | Hardwood Forest Soil | MGNLTSALQQLRAERREAQLQVEKLDQAISVIESLNGS |
| Ga0311301_123724232 | 3300032160 | Peatlands Soil | MGNLSSALQELRAERKQAQARVESIDRAISVIESLNGS |
| Ga0311301_124254081 | 3300032160 | Peatlands Soil | MGNLGSALQQLREERKQAQAHVEKLDQAISVIESLNGSGTFGKS |
| Ga0334790_106689_793_897 | 3300033887 | Soil | MGNLVNVLQELRAELKQMQSQVEKLDQAIAVIESL |
| Ga0370501_0001154_6117_6269 | 3300034195 | Untreated Peat Soil | MSNLTNALQELREERKKAQSQVEKLDQAISVIESLSGGGSSGDGNRPGRVI |
| ⦗Top⦘ |