NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050502

Metagenome / Metatranscriptome Family F050502

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050502
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 38 residues
Representative Sequence VPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA
Number of Associated Samples 114
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.59 %
% of genes near scaffold ends (potentially truncated) 91.72 %
% of genes from short scaffolds (< 2000 bps) 92.41 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.103 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(44.138 % of family members)
Environment Ontology (ENVO) Unclassified
(54.483 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.207 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.69%    β-sheet: 0.00%    Coil/Unstructured: 70.31%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF00496SBP_bac_5 16.55
PF07883Cupin_2 4.83
PF04392ABC_sub_bind 2.76
PF03352Adenine_glyco 2.76
PF13649Methyltransf_25 2.07
PF04993TfoX_N 1.38
PF01436NHL 1.38
PF13432TPR_16 1.38
PF00293NUDIX 1.38
PF02518HATPase_c 1.38
PF03976PPK2 0.69
PF00149Metallophos 0.69
PF13561adh_short_C2 0.69
PF06627DUF1153 0.69
PF11860Muramidase 0.69
PF01209Ubie_methyltran 0.69
PF03060NMO 0.69
PF00889EF_TS 0.69
PF03729DUF308 0.69
PF13565HTH_32 0.69
PF13302Acetyltransf_3 0.69
PF04229GrpB 0.69
PF08388GIIM 0.69
PF00012HSP70 0.69
PF028262-Hacid_dh_C 0.69
PF07080DUF1348 0.69
PF12848ABC_tran_Xtn 0.69
PF02668TauD 0.69
PF00589Phage_integrase 0.69
PF00485PRK 0.69
PF13384HTH_23 0.69
PF07746LigA 0.69
PF04909Amidohydro_2 0.69
PF09297zf-NADH-PPase 0.69
PF16861Carbam_trans_C 0.69
PF01204Trehalase 0.69
PF07690MFS_1 0.69
PF01070FMN_dh 0.69
PF14224DUF4331 0.69
PF00326Peptidase_S9 0.69
PF00476DNA_pol_A 0.69
PF00941FAD_binding_5 0.69
PF00536SAM_1 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG28183-methyladenine DNA glycosylase TagReplication, recombination and repair [L] 2.76
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.76
COG3070Transcriptional regulator of competence genes, TfoX/Sxy familyTranscription [K] 1.38
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.69
COG0264Translation elongation factor EF-TsTranslation, ribosomal structure and biogenesis [J] 0.69
COG0272NAD-dependent DNA ligaseReplication, recombination and repair [L] 0.69
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.69
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.69
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 0.69
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.69
COG1626Neutral trehalaseCarbohydrate transport and metabolism [G] 0.69
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.69
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.69
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.69
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.69
COG2320GrpB domain, predicted nucleotidyltransferase, UPF0157 familyGeneral function prediction only [R] 0.69
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.69
COG2816NADH pyrophosphatase NudC, Nudix superfamilyNucleotide transport and metabolism [F] 0.69
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.69
COG3558Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamilyFunction unknown [S] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.10 %
UnclassifiedrootN/A6.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_13086464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844659Open in IMG/M
3300000955|JGI1027J12803_109342458All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300004082|Ga0062384_100542188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria778Open in IMG/M
3300005471|Ga0070698_101981495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria536Open in IMG/M
3300005471|Ga0070698_102006574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844532Open in IMG/M
3300005548|Ga0070665_101749430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria629Open in IMG/M
3300005554|Ga0066661_10518578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales718Open in IMG/M
3300005568|Ga0066703_10623877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria626Open in IMG/M
3300005569|Ga0066705_10944127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300005576|Ga0066708_10592245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria711Open in IMG/M
3300005610|Ga0070763_10077863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1634Open in IMG/M
3300005614|Ga0068856_100684722All Organisms → cellular organisms → Bacteria → Proteobacteria1046Open in IMG/M
3300005618|Ga0068864_101525534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria671Open in IMG/M
3300006041|Ga0075023_100565388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844523Open in IMG/M
3300006176|Ga0070765_100391375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1296Open in IMG/M
3300006796|Ga0066665_11698341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales500Open in IMG/M
3300006854|Ga0075425_101821937All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300007822|Ga0104325_100996Not Available1014Open in IMG/M
3300009143|Ga0099792_10028087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2581Open in IMG/M
3300010047|Ga0126382_10431438All Organisms → cellular organisms → Bacteria → Proteobacteria1038Open in IMG/M
3300010048|Ga0126373_10466387All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300010048|Ga0126373_10636364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1121Open in IMG/M
3300010048|Ga0126373_11960350Not Available648Open in IMG/M
3300010048|Ga0126373_11960734All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui648Open in IMG/M
3300010048|Ga0126373_11994568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria643Open in IMG/M
3300010321|Ga0134067_10236043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria684Open in IMG/M
3300010323|Ga0134086_10275240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria647Open in IMG/M
3300010359|Ga0126376_11925620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales631Open in IMG/M
3300010361|Ga0126378_10046812All Organisms → cellular organisms → Bacteria → Proteobacteria4005Open in IMG/M
3300010366|Ga0126379_11811337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria714Open in IMG/M
3300010376|Ga0126381_102090333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria815Open in IMG/M
3300010376|Ga0126381_103867103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria584Open in IMG/M
3300010398|Ga0126383_11785701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria703Open in IMG/M
3300010398|Ga0126383_11881177All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300011270|Ga0137391_10488630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1043Open in IMG/M
3300012202|Ga0137363_10837044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium781Open in IMG/M
3300012205|Ga0137362_10773913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae823Open in IMG/M
3300012350|Ga0137372_11165106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300012930|Ga0137407_11949006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844560Open in IMG/M
3300012948|Ga0126375_11587041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300012958|Ga0164299_11624945All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300015374|Ga0132255_101014191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1245Open in IMG/M
3300016270|Ga0182036_11280247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales611Open in IMG/M
3300016270|Ga0182036_11762317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300016319|Ga0182033_10178140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1670Open in IMG/M
3300016341|Ga0182035_11158511All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300016357|Ga0182032_11125713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria674Open in IMG/M
3300016387|Ga0182040_10639987All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300016404|Ga0182037_10435488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1087Open in IMG/M
3300016445|Ga0182038_10849888Not Available802Open in IMG/M
3300016445|Ga0182038_11758746All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300018085|Ga0187772_11234264All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium RIFOXYA12_FULL_46_15551Open in IMG/M
3300018468|Ga0066662_11951581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300018468|Ga0066662_12579664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria537Open in IMG/M
3300018482|Ga0066669_10655418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales923Open in IMG/M
3300020580|Ga0210403_10666895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria835Open in IMG/M
3300021178|Ga0210408_10123028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae2046Open in IMG/M
3300021178|Ga0210408_10723261Not Available783Open in IMG/M
3300021403|Ga0210397_10146338All Organisms → cellular organisms → Bacteria1647Open in IMG/M
3300021407|Ga0210383_11043431All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300021445|Ga0182009_10196180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria981Open in IMG/M
3300021478|Ga0210402_11371494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300022531|Ga0242660_1068005Not Available815Open in IMG/M
3300025929|Ga0207664_10519369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1067Open in IMG/M
3300025939|Ga0207665_10640638All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300026095|Ga0207676_10183860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1833Open in IMG/M
3300026305|Ga0209688_1037591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria923Open in IMG/M
3300027383|Ga0209213_1098543All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300027610|Ga0209528_1151809All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300027635|Ga0209625_1001391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5690Open in IMG/M
3300027651|Ga0209217_1072254Not Available1011Open in IMG/M
3300027986|Ga0209168_10383141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria685Open in IMG/M
3300031543|Ga0318516_10290540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria945Open in IMG/M
3300031544|Ga0318534_10574855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae641Open in IMG/M
3300031545|Ga0318541_10004030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae5993Open in IMG/M
3300031545|Ga0318541_10189250All Organisms → cellular organisms → Bacteria1137Open in IMG/M
3300031545|Ga0318541_10727458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria554Open in IMG/M
3300031549|Ga0318571_10075247All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300031561|Ga0318528_10327503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria822Open in IMG/M
3300031572|Ga0318515_10383147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844753Open in IMG/M
3300031572|Ga0318515_10512087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria640Open in IMG/M
3300031572|Ga0318515_10561600All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300031573|Ga0310915_10222054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1325Open in IMG/M
3300031573|Ga0310915_10330677All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1079Open in IMG/M
3300031573|Ga0310915_10965728All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300031640|Ga0318555_10234289All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300031679|Ga0318561_10700431All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300031681|Ga0318572_10932151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria516Open in IMG/M
3300031713|Ga0318496_10812890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria515Open in IMG/M
3300031719|Ga0306917_10567445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria892Open in IMG/M
3300031723|Ga0318493_10306411Not Available858Open in IMG/M
3300031736|Ga0318501_10308501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium845Open in IMG/M
3300031751|Ga0318494_10615980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria635Open in IMG/M
3300031765|Ga0318554_10254434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1000Open in IMG/M
3300031768|Ga0318509_10684632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae570Open in IMG/M
3300031770|Ga0318521_10388511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria831Open in IMG/M
3300031777|Ga0318543_10360444Not Available651Open in IMG/M
3300031780|Ga0318508_1077657All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300031793|Ga0318548_10532170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales573Open in IMG/M
3300031795|Ga0318557_10595411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300031797|Ga0318550_10219343Not Available922Open in IMG/M
3300031797|Ga0318550_10526584Not Available569Open in IMG/M
3300031798|Ga0318523_10015551All Organisms → cellular organisms → Bacteria3207Open in IMG/M
3300031819|Ga0318568_10384804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria874Open in IMG/M
3300031833|Ga0310917_10923982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales587Open in IMG/M
3300031845|Ga0318511_10610407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300031859|Ga0318527_10388912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium594Open in IMG/M
3300031879|Ga0306919_10919297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria670Open in IMG/M
3300031880|Ga0318544_10015275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2499Open in IMG/M
3300031890|Ga0306925_10224071All Organisms → cellular organisms → Bacteria → Proteobacteria2028Open in IMG/M
3300031890|Ga0306925_10671200All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300031893|Ga0318536_10168482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1114Open in IMG/M
3300031893|Ga0318536_10508306All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300031893|Ga0318536_10637503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria532Open in IMG/M
3300031894|Ga0318522_10011100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2720Open in IMG/M
3300031896|Ga0318551_10805751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844546Open in IMG/M
3300031897|Ga0318520_10989548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria531Open in IMG/M
3300031910|Ga0306923_10844869All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300031910|Ga0306923_11324053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria763Open in IMG/M
3300031910|Ga0306923_11736595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae643Open in IMG/M
3300031912|Ga0306921_10133534All Organisms → cellular organisms → Bacteria → Proteobacteria2898Open in IMG/M
3300031912|Ga0306921_11462713All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300031912|Ga0306921_11942561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria628Open in IMG/M
3300031942|Ga0310916_10354495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1246Open in IMG/M
3300031945|Ga0310913_10534608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria832Open in IMG/M
3300031954|Ga0306926_10792461All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300031954|Ga0306926_11291815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium852Open in IMG/M
3300031959|Ga0318530_10060856All Organisms → cellular organisms → Bacteria1443Open in IMG/M
3300031959|Ga0318530_10307251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria656Open in IMG/M
3300031962|Ga0307479_11886376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300032039|Ga0318559_10166097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1007Open in IMG/M
3300032041|Ga0318549_10580192All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300032043|Ga0318556_10104829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1435Open in IMG/M
3300032051|Ga0318532_10177279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales757Open in IMG/M
3300032051|Ga0318532_10247517All Organisms → cellular organisms → Bacteria → Proteobacteria633Open in IMG/M
3300032051|Ga0318532_10288820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300032052|Ga0318506_10100873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1233Open in IMG/M
3300032055|Ga0318575_10631373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300032068|Ga0318553_10075050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1699Open in IMG/M
3300032068|Ga0318553_10222805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium984Open in IMG/M
3300032205|Ga0307472_100619916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria958Open in IMG/M
3300032261|Ga0306920_100408482All Organisms → cellular organisms → Bacteria → Proteobacteria2019Open in IMG/M
3300032421|Ga0310812_10514460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300033289|Ga0310914_10987768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria742Open in IMG/M
3300033289|Ga0310914_11235595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria649Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil44.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.14%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.07%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.38%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.38%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.38%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.69%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.69%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.69%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007822Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1308646413300000789SoilFIPLGEYWQASAYRKDLTDVIPGCFTTFYGVRRA*
JGI1027J12803_10934245853300000955SoilFIPLGEYWQASAYRKDLTDIIPGCFTTFYAVRRS*
Ga0062384_10054218833300004082Bog Forest SoilKQLWEDVPFIPMGEYWQATAYRKDLTDVPPGCFAVFYGVRRT*
Ga0070698_10198149523300005471Corn, Switchgrass And Miscanthus RhizosphereQKRLWEDVPFIPLGEYWQASAYRKDLTDIIPGCFTTFYGVRRA*
Ga0070698_10200657413300005471Corn, Switchgrass And Miscanthus RhizosphereLWQDVPYIPMGEYWQATAYRKDLLDVQPGCFAVFYGVRRA*
Ga0070665_10174943023300005548Switchgrass RhizospherePFIPMGEYWQTTAYRKDITGAIPGCFTVFYNVKRA*
Ga0066661_1051857823300005554SoilCIELQKRLWEDVPFIPLGEYWQASAYRKDLTDVIPGCFTTFYGVRRT*
Ga0066703_1062387733300005568SoilPFIPMGEYWQATAYRKDLTDVLPGCFAVFYGVRRA*
Ga0066705_1094412723300005569SoilPFIPMGEYWQASADRKDITDVIPCCFTTFYGARCPGH*
Ga0066708_1059224513300005576SoilPFIPMGEYWQASAYRKDLTNVLPGCFAVFYAVRRA*
Ga0070763_1007786323300005610SoilVPFIPMGEYWQASAYRKDLTDVLPGCFAVFYGVRRA*
Ga0068856_10068472223300005614Corn RhizosphereLWEDVPFIPLGEYWQASAYRKDLIDVIPGCFTTLYGVRRA*
Ga0068864_10152553413300005618Switchgrass RhizosphereQKRLWEDVPFIPLGEYWQASAYRKDVTDVIPGCFATFYGVRRA*
Ga0075023_10056538823300006041WatershedsVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA*
Ga0070765_10039137523300006176SoilRLWEDVPFIPLGEYWQASAYRKDLTDVIPGCFTTFYGVRRA*
Ga0066665_1169834113300006796SoilPFIPMGEYWQTTAYRKGLTGIIPGCFTMFYNVKRA*
Ga0075425_10182193733300006854Populus RhizosphereFIPMGEYWQATAYSKHLTDVLPGCFAVFYGVRRA*
Ga0104325_10099613300007822SoilPFIPMGEYWQTTAYRKGLTGIIPGCFTVFWGVRRA*
Ga0099792_1002808743300009143Vadose Zone SoilPFIPMGEYWQTTAYRKELSGIIPGCFTVFWGVKRA*
Ga0126382_1043143833300010047Tropical Forest SoilMQVWQDVPFIPMGEYWQCTAFRKELTGIIPGCFAVFYNINRA*
Ga0126373_1046638723300010048Tropical Forest SoilVPFIPTGEYWQATAYRKNLTDILPGSFAVFHGVRRA*
Ga0126373_1063636423300010048Tropical Forest SoilLQKQLWEDVPFIPMGEYWQASAYRKRLTDILPSRFATFYRARPA*
Ga0126373_1196035013300010048Tropical Forest SoilYIPMGEDSQSTDYREDLLDVLPGCFSEFWGIRRA*
Ga0126373_1196073413300010048Tropical Forest SoilDVPYIPMGEYSQATAYRKDLLDVLPGCFAVFYGVRRA*
Ga0126373_1199456823300010048Tropical Forest SoilPYIPMGEYWQSTAYRKDLLDVVPGCFAVFWRVRRA*
Ga0134067_1023604313300010321Grasslands SoilQLWEDVTFIPLGEYWQATAYRKDLTDVLPGCFTVFYGVRRA*
Ga0134086_1027524013300010323Grasslands SoilVPFIPMGEYWQATAYRKHLTDVLPGCFAVFYGVRRA*
Ga0126376_1192562023300010359Tropical Forest SoilPFIPLGEYWQATAYRKRLTDIVPGCFATFYGVRPA*
Ga0126378_1004681213300010361Tropical Forest SoilQLWTDVPFIPMGEYWQATAYRKDLTDVLPGCFATSYGVRRA*
Ga0126379_1181133713300010366Tropical Forest SoilDVPYIPMGEYWQSSAYRKDLLDVLPGCFAVFYGVRRG*
Ga0126381_10209033313300010376Tropical Forest SoilDLQKQLWEDVPFIPMGEYWQASAYRKRLTDILHGCFATFYGVRPA*
Ga0126381_10386710323300010376Tropical Forest SoilMQRQVWEDVPFIPMGEYWQTTAYRKDLVDVLPGCFVTFYGVRRT*
Ga0126383_1178570123300010398Tropical Forest SoilPYIPMGEYWQCTAYRKDLVDVLAGCFTVFWGIRRA*
Ga0126383_1188117733300010398Tropical Forest SoilVPFIPTGEYWQATAYRKNLTDILPGSFAVFHGVRRA
Ga0137391_1048863023300011270Vadose Zone SoilVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA*
Ga0137363_1083704423300012202Vadose Zone SoilDLPFIPMGEYWQTTAYRKELSGIIPGCFTVFWGVKRA*
Ga0137362_1077391313300012205Vadose Zone SoilMQLWQDVPYIPMGEYWQATAYRKDLLDVTPGCFAVFYGVHR
Ga0137372_1116510623300012350Vadose Zone SoilYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA*
Ga0137407_1194900613300012930Vadose Zone SoilDVPFIPMGEYWQTTAYRKDLTGILPGCFTVFYGVRRA*
Ga0126375_1158704123300012948Tropical Forest SoilPFIPIGEYWQTTAYRKDLTGINPGCFTVFWGVRRA*
Ga0164299_1162494513300012958SoilMQVWQDLPFIPMGEYWQTTAYRKELSGIIPGCFTVFWGVQRA*
Ga0132255_10101419123300015374Arabidopsis RhizosphereCADLQKRLWEDVPFIPMGEYWQASAYRKHLTDIVPGCFTTFYGVRRS*
Ga0182036_1128024713300016270SoilPFIPMGEYWQATAHRKDLTDVLSGCFATFYGVRRA
Ga0182036_1176231723300016270SoilVPFIPTGEYWRATAYRKNLTDILPGCFAVSHGVRRA
Ga0182033_1017814023300016319SoilVPYIPMGEYWQSTAYRKDLLDVQPGCFAVVWGIRRA
Ga0182035_1115851123300016341SoilVHPMGEYWQVTAYHKDLLDVQRGCFAVFYGVRRGERHPC
Ga0182032_1112571313300016357SoilPYIPMGEYWQSTAYRRDLLDVLPGCFAVFWGIRRA
Ga0182040_1063998723300016387SoilPYIPMGEYWQSSAYRKDLIDVFPGCFSVFWGIRRA
Ga0182037_1043548823300016404SoilQDVPYIPMGEYWQSSAYRKDLINVFPGCFSVFWGIRRA
Ga0182038_1084988823300016445SoilMQVWQDVRFILMDEYWQTTGKRLSGIIPGCFMVFY
Ga0182038_1175874613300016445SoilPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA
Ga0187772_1123426423300018085Tropical PeatlandVPFIPMGEYWQASAYRKRLTDILPGCFATFYGVRPA
Ga0066662_1195158113300018468Grasslands SoilMQTRRRDLRQDLPFVPMGAYRQTTAYRNDLKGVIPGCFTVFYGVERA
Ga0066662_1257966413300018468Grasslands SoilRLWEDVPFIPLGEYWQASAYRKDLTDIVPGCFTTFYGVRRA
Ga0066669_1065541823300018482Grasslands SoilWEDVPFIPLGEYWQASAYRKDLTDIIPGCFTTFYGVRRA
Ga0210403_1066689523300020580SoilPYIPMGEYWQSTAYRKDLLDVMPGCFAVFYGVRRS
Ga0210408_1012302813300021178SoilVPFIPMGEYWQATAYRKDLTDVLPGCFAMFYGVRRT
Ga0210408_1072326113300021178SoilDVPYIPMGEYWQSTAYRKDIVDVLPGCFAVFYGIHRCHRYLH
Ga0210397_1014633813300021403SoilICEELQKQLWQDVPFIPLGEYWQASAYRKRLVDIIPGCFATSYGVRPA
Ga0210383_1104343123300021407SoilTADPELQKQLWQDVPFIPLGEYWQASAYRKRLVDIIPGCFATFYGVRPA
Ga0182009_1019618013300021445SoilVPFIPLGEYWQASAYRKDVTDVIPGCFATFYGVRRA
Ga0210402_1137149413300021478SoilMQLWQDVPYIPMGEYWQSTAFRKDIVGVQPGCFSVFDGVRRA
Ga0242660_106800523300022531SoilQDVPFIPMGEYWQTTGYRKGLTGIIPGCFTVFYNVKRA
Ga0207664_1051936933300025929Agricultural SoilWEDVPFIPLGEYWQASAYRKDVTDVIPGCFATFYGVRRA
Ga0207665_1064063823300025939Corn, Switchgrass And Miscanthus RhizosphereMQLWQDVPYIPMGEYWQSTAYRKDLLDVQPGCFAVFWGLPSR
Ga0207676_1018386013300026095Switchgrass RhizosphereQKRLWEDVPFIPLGEYWQASAYRKDVTDVIPGCFATFYGVRRA
Ga0209688_103759133300026305SoilLQKQLWHDVPFIPLGEYWQASAYRKHLVDIIPGCFATFYGVRPA
Ga0209213_109854323300027383Forest SoilMQKRLWEDVPFIPLGEYWQASAYRKDLTDVIPGCFTTFYGVRRA
Ga0209528_115180913300027610Forest SoilQDLPFIPMGEYWQTTAYRKELTGILPGCFTVFWGVQRA
Ga0209625_100139153300027635Forest SoilPFIPMGEYWQTTAYRKGLTGIIPGCFTVFYNVKRA
Ga0209217_107225423300027651Forest SoilVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA
Ga0209168_1038314123300027986Surface SoilQTRLWEDVPFIPLGEYWQASAYRKDLIDIIPGCFATFYGVRRA
Ga0318516_1029054013300031543SoilQDVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIHRA
Ga0318534_1057485523300031544SoilQLWQDVPYIPMGEYWQATAYRKDLLDVQPGCFKVFYGVRRA
Ga0318541_1000403053300031545SoilVAGVPYIPMGEYWQSTAYRKDLLDVLSGCFAVFWGIRRA
Ga0318541_1018925033300031545SoilLWQDVPYIRMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA
Ga0318541_1072745823300031545SoilYIPMGEYWQSTAYRKDLLGVIPGCFAVFWGIRPAS
Ga0318571_1007524713300031549SoilPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIHRA
Ga0318528_1032750313300031561SoilVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRG
Ga0318515_1038314713300031572SoilWQDVPFIPMGEYWQSTAYRKGLTGIIPDCFTVFYNVKRA
Ga0318515_1051208713300031572SoilWKDVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYRVRRG
Ga0318515_1056160013300031572SoilVPYIPMGEYWQSSAYRKDLINVFPGCFSVFWGIRRA
Ga0310915_1022205413300031573SoilDVPYIPMGEYWQSTAYRKDMLDVQPGCFAVFWGIRRAP
Ga0310915_1033067733300031573SoilVPYIPMGEYWQSTAYRKDLLDVLPGCLAVFWGIRRA
Ga0310915_1096572823300031573SoilQLWEDVPYIRMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA
Ga0318555_1023428923300031640SoilDVPYIPMGEYWQSTAYRKDLLDVRPGCFAVFWGIRRA
Ga0318561_1070043113300031679SoilPYIPMGEYWQSTAYRKDLLDVLPGCFPVFWGIRRA
Ga0318572_1093215123300031681SoilPYIPMGEYYQSSAYRKDLLDVLPGCFAVFWGIRRA
Ga0318496_1081289013300031713SoilVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRPAS
Ga0306917_1056744513300031719SoilWEDVPFIPMGEYWQATAYRRRLTDIVPDCFATFYGVRPA
Ga0318493_1030641113300031723SoilPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA
Ga0318501_1030850113300031736SoilVPFIPMGEYWQTTAYRKGLTGIIPGCFTVFYNVKRA
Ga0318494_1061598013300031751SoilVELQMQLWQELPYIPMGEYWQFTAYRKDLLDVLPGCFAV
Ga0318554_1025443413300031765SoilPYIPMGEYWQSTAYRKDLLDVQPGCFAVFYGVRRV
Ga0318509_1068463223300031768SoilPYIPMGEYWQSTAYRNDLLDVLPGCLAVFWGIRRG
Ga0318521_1038851123300031770SoilQLWRDVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRA
Ga0318543_1036044413300031777SoilQDVPYIPMGEYWQSTAYRKDLLDVVPGCFATFYGVRRA
Ga0318508_107765723300031780SoilDVPYIPMGEYWQSTAYRKDLLDVLPGCFSVFWGIRHA
Ga0318548_1053217023300031793SoilDVPYIPMGEYWQSTAYRKGLLDVLPGCFPVFWGIRRV
Ga0318557_1059541113300031795SoilDVPYIPMGEYWQSTAYRKDLLEVLPGCFAVFWGIRRA
Ga0318550_1021934323300031797SoilPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVHRA
Ga0318550_1052658423300031797SoilPFIPMGEYWQATAYRRRLTDIVPGCFATFYGVRAA
Ga0318523_1001555163300031798SoilVPYIPMGEYWQSTAYRKDLIDVLPGCFATFYGVRRA
Ga0318568_1038480413300031819SoilWKDVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFYGVRRG
Ga0310917_1092398223300031833SoilVPFIPMGEYWQATAHRKDLTDVLSGCFATFYGVRRA
Ga0318511_1061040713300031845SoilQDVPYIPMGEYWQSIAYRKDLLDVLPGCFAVFWGIRRA
Ga0318527_1038891213300031859SoilPFIPMGESWQATAYRKGLTGIIPGCFTVFYNVKRA
Ga0306919_1091929723300031879SoilQDVPYIPMGEYWQSIAYRKDLLDVLPGCFAVFWGIRRE
Ga0318544_1001527543300031880SoilVPFIPMGESWQATAYRKGLSGIIPGCFTVFYNVKRA
Ga0306925_1022407133300031890SoilPYIPMGEYWQSTAYRKDLLDVLPGCFSVFWGIRRA
Ga0306925_1067120013300031890SoilVPFIPMGESWQATAYRKGLTGIIPGCFTVFYNVKRA
Ga0318536_1016848223300031893SoilDVPYIPMGEYWQATAYRKDLLDVLPGCFAVFYGVRRA
Ga0318536_1050830613300031893SoilVPYVPMGEYWQSTAFRKDLLDVLPGCFPVFWGIRRA
Ga0318536_1063750323300031893SoilVPYIPMGEYWQATAYRKDLLDVQPGCFAAFYGVRKA
Ga0318522_1001110013300031894SoilVPYIPMGEYWQATAYRKDLLDVLPGCFAVFYGVRRA
Ga0318551_1080575113300031896SoilVWQDVPFIPMGEYWQSTAYRKGLTGIIPDCFTVFYNVKRA
Ga0318520_1098954833300031897SoilSGNVPFIPMGEYRQATAYRKHLTDIVPGCFATFYGVRMA
Ga0306923_1084486933300031910SoilLWQDVPYIPTGEYRQSTAYRKDLLDVLPGCFATFYGVRRT
Ga0306923_1132405313300031910SoilDVPYIPLGEYWQSTAYRKDLLDVLPGYFAVFYGVRRG
Ga0306923_1173659513300031910SoilDVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA
Ga0306921_1013353433300031912SoilMGEYWQVTAYHKDLLDVQRGCFAVFYGVRRGERHPC
Ga0306921_1146271323300031912SoilLWQDVRYIPMGEFWQSTAYRKDLLDVLPGCFAVFWGIRRA
Ga0306921_1194256123300031912SoilQDVPYIPMGEYWQATAYRKDLLDVQPGCFAVFYGVRKA
Ga0310916_1035449523300031942SoilQDVPYIPMGEYWQSTAYRKDMLDVQPGCFAVFWGIRRAP
Ga0310913_1053460813300031945SoilVPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA
Ga0306926_1079246113300031954SoilQDVPFIPMGEYWQSTAYRKELTGIVPGCFAVFYNVSRA
Ga0306926_1129181513300031954SoilVPLIPMGEYWQATAYRKDLVDVLPGCFAVFYGVRRV
Ga0318530_1006085633300031959SoilPYIPMGEYWQSTAYRKDLIDVLPGCFATFYGVRRA
Ga0318530_1030725123300031959SoilMQLWQELPYIPMGEYWQFTAYRKDLLDVLPGCFAV
Ga0307479_1188637623300031962Hardwood Forest SoilVPFIPMGEYWQATAYRKDLTDVLPGCFAVFYGVRRV
Ga0318559_1016609723300032039SoilQDVPYIPMGEYWQSTAYRKDLLEVLPGCFAVFWGIRRA
Ga0318549_1058019213300032041SoilDVPFIPMGESWQATAYRKGLTGIIPGCFTVFYNVKRA
Ga0318556_1010482913300032043SoilVPYIPMGEYWQSTAYRRDLLDVLPGCFAVFWGIRRA
Ga0318532_1017727923300032051SoilPYIPMGEYWQSTAYRKDLVDVLPGCFAVFWGIRRA
Ga0318532_1024751723300032051SoilQLWQDLPYIPMGEYWQSTAYRKDLLDVQPGCFAVFYGVRRA
Ga0318532_1028882023300032051SoilLWQDLPYIPMGEYWQSTAYRKDLLDVQPGCFAVFYGVRRV
Ga0318506_1010087333300032052SoilLWQDVPCIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRA
Ga0318575_1063137313300032055SoilPFIPMGESWQATAYRKGLSGIIPGCFTVFYNVKRA
Ga0318553_1007505023300032068SoilPYIPMGEYWQSTAYRKDLLDVLPGCFAVFWGIRRV
Ga0318553_1022280513300032068SoilDVPFIPMGESWQATAYRKGLSGIIPGCFTVFYNVKRA
Ga0307472_10061991623300032205Hardwood Forest SoilWQDVPFIPIGEYWQTTAYRKGLTGIIPGCFTVFYNVKRA
Ga0306920_10040848213300032261SoilVPFIPMGEYRQATAYRKHLTDIVPGCFATFYGVRMA
Ga0310812_1051446013300032421SoilWQDLPFIPMGEYWQTTAYRKELSGIIPGCFTVFWGVQRA
Ga0310914_1098776813300033289SoilMRVWQDVPYIPMAEYWQSTAYRKDVLDVMPACFAVFY
Ga0310914_1123559523300033289SoilMQLWQDVPYIPMGEYSQATAYRKDLLDVLPGCFAVFYG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.