NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050456

Metagenome / Metatranscriptome Family F050456

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050456
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 46 residues
Representative Sequence VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGANKVFGWA
Number of Associated Samples 136
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 51.72 %
% of genes near scaffold ends (potentially truncated) 97.24 %
% of genes from short scaffolds (< 2000 bps) 88.97 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.931 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.310 % of family members)
Environment Ontology (ENVO) Unclassified
(27.586 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.552 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.72%    β-sheet: 12.68%    Coil/Unstructured: 67.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF00571CBS 46.21
PF08495FIST 15.86
PF04237YjbR 11.72
PF10442FIST_C 8.28
PF13489Methyltransf_23 1.38
PF12706Lactamase_B_2 1.38
PF01625PMSR 1.38
PF07973tRNA_SAD 0.69
PF13673Acetyltransf_10 0.69
PF00296Bac_luciferase 0.69
PF13189Cytidylate_kin2 0.69
PF03625DUF302 0.69
PF01810LysE 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG3287FIST domain protein MJ1623, contains FIST_N and FIST_C domainsSignal transduction mechanisms [T] 15.86
COG4398Small ligand-binding sensory domain FISTSignal transduction mechanisms [T] 15.86
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 11.72
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 1.38
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.69
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 0.69

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.93 %
UnclassifiedrootN/A2.07 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c1039331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300000156|NODE_c0738519All Organisms → cellular organisms → Bacteria11538Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101115662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300000880|AL20A1W_1248535All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300000891|JGI10214J12806_10548579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1566Open in IMG/M
3300000891|JGI10214J12806_10710234All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300000953|JGI11615J12901_11673129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300000956|JGI10216J12902_109903230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium673Open in IMG/M
3300001334|A2165W6_1021791All Organisms → cellular organisms → Bacteria1644Open in IMG/M
3300001686|C688J18823_10155879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1564Open in IMG/M
3300004114|Ga0062593_100926567All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300004480|Ga0062592_100708295All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300004643|Ga0062591_101443475All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300005171|Ga0066677_10449294All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005172|Ga0066683_10468634All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300005329|Ga0070683_101901652All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005332|Ga0066388_100124993All Organisms → cellular organisms → Bacteria3105Open in IMG/M
3300005335|Ga0070666_10520082All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300005337|Ga0070682_100113907All Organisms → cellular organisms → Bacteria1807Open in IMG/M
3300005437|Ga0070710_10681521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300005441|Ga0070700_101063165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300005445|Ga0070708_101167560All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300005450|Ga0066682_10378795All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300005535|Ga0070684_100581294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300005543|Ga0070672_100390462All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300005545|Ga0070695_100590326All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300005553|Ga0066695_10689751All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300005553|Ga0066695_10852204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes523Open in IMG/M
3300005556|Ga0066707_10420812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales868Open in IMG/M
3300005558|Ga0066698_10527939All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300005560|Ga0066670_10042522All Organisms → cellular organisms → Bacteria2305Open in IMG/M
3300005566|Ga0066693_10010653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2585Open in IMG/M
3300005569|Ga0066705_10660196All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300005587|Ga0066654_10527312All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300005764|Ga0066903_100729534All Organisms → cellular organisms → Bacteria1754Open in IMG/M
3300006028|Ga0070717_10134664All Organisms → cellular organisms → Bacteria2127Open in IMG/M
3300006237|Ga0097621_100041760All Organisms → cellular organisms → Bacteria3693Open in IMG/M
3300006755|Ga0079222_10888834All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300006804|Ga0079221_10981734All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300006806|Ga0079220_11043036All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300006881|Ga0068865_100105026All Organisms → cellular organisms → Bacteria2074Open in IMG/M
3300007821|Ga0104323_113347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1271Open in IMG/M
3300009012|Ga0066710_100380990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2096Open in IMG/M
3300009093|Ga0105240_10653089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1152Open in IMG/M
3300009100|Ga0075418_11679688All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300009137|Ga0066709_104140441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300009148|Ga0105243_10021607All Organisms → cellular organisms → Bacteria4885Open in IMG/M
3300009148|Ga0105243_10187030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1806Open in IMG/M
3300009148|Ga0105243_12720296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300009162|Ga0075423_11374976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria755Open in IMG/M
3300009545|Ga0105237_12541788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300010040|Ga0126308_10009152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4906Open in IMG/M
3300010145|Ga0126321_1033508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria984Open in IMG/M
3300010320|Ga0134109_10125127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium911Open in IMG/M
3300010326|Ga0134065_10320726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300010337|Ga0134062_10611338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300010360|Ga0126372_11374667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium738Open in IMG/M
3300010371|Ga0134125_10661384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1153Open in IMG/M
3300010373|Ga0134128_12102308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300010375|Ga0105239_10226637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2097Open in IMG/M
3300010396|Ga0134126_12610868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300010398|Ga0126383_13172778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300010400|Ga0134122_10452745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1149Open in IMG/M
3300011996|Ga0120156_1068866All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300011999|Ga0120148_1063680Not Available733Open in IMG/M
3300012206|Ga0137380_11151411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300012207|Ga0137381_10854215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300012210|Ga0137378_10877787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300012211|Ga0137377_10410201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1293Open in IMG/M
3300012211|Ga0137377_11803377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300012356|Ga0137371_10158486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1775Open in IMG/M
3300012356|Ga0137371_11186501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300012360|Ga0137375_10855757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300012507|Ga0157342_1068939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300012508|Ga0157315_1055187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300012532|Ga0137373_10114665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2328Open in IMG/M
3300012955|Ga0164298_10229879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1105Open in IMG/M
3300012958|Ga0164299_10336599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium943Open in IMG/M
3300012961|Ga0164302_10664634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium766Open in IMG/M
3300012977|Ga0134087_10247390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria816Open in IMG/M
3300012984|Ga0164309_10858819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium736Open in IMG/M
3300012986|Ga0164304_10668169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium785Open in IMG/M
3300013102|Ga0157371_11093514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium611Open in IMG/M
3300013307|Ga0157372_10565853All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300013308|Ga0157375_13224390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300014157|Ga0134078_10353835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300017654|Ga0134069_1112697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria892Open in IMG/M
3300017939|Ga0187775_10049827All Organisms → cellular organisms → Bacteria1274Open in IMG/M
3300018061|Ga0184619_10115963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1211Open in IMG/M
3300018066|Ga0184617_1259025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300018081|Ga0184625_10358177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium758Open in IMG/M
3300018465|Ga0190269_10388934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300018482|Ga0066669_12143031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300019869|Ga0193705_1057310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300020022|Ga0193733_1042620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1283Open in IMG/M
3300021080|Ga0210382_10030422All Organisms → cellular organisms → Bacteria2025Open in IMG/M
3300022694|Ga0222623_10122634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1012Open in IMG/M
3300022756|Ga0222622_10726052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium723Open in IMG/M
3300022893|Ga0247787_1044224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300022915|Ga0247790_10000882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5908Open in IMG/M
3300023071|Ga0247752_1000962All Organisms → cellular organisms → Bacteria3614Open in IMG/M
3300024224|Ga0247673_1011124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1159Open in IMG/M
3300024286|Ga0247687_1012165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1168Open in IMG/M
3300024310|Ga0247681_1023023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria902Open in IMG/M
3300025901|Ga0207688_10833730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300025915|Ga0207693_10125841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2015Open in IMG/M
3300025921|Ga0207652_11065567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300025931|Ga0207644_11707369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300025935|Ga0207709_10928524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300025944|Ga0207661_11446710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300025949|Ga0207667_11645592All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300025960|Ga0207651_11191690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300026088|Ga0207641_12102322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300026118|Ga0207675_100254483All Organisms → cellular organisms → Bacteria1700Open in IMG/M
3300026306|Ga0209468_1139766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300026308|Ga0209265_1136456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300026550|Ga0209474_10394939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300027907|Ga0207428_10967560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300028281|Ga0247689_1025013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium801Open in IMG/M
3300028704|Ga0307321_1081669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
3300028708|Ga0307295_10129349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium693Open in IMG/M
3300028711|Ga0307293_10043113All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300028713|Ga0307303_10143641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300028714|Ga0307309_10009213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1739Open in IMG/M
3300028715|Ga0307313_10021012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1774Open in IMG/M
3300028715|Ga0307313_10183047Not Available649Open in IMG/M
3300028716|Ga0307311_10169513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300028719|Ga0307301_10065508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1129Open in IMG/M
3300028784|Ga0307282_10183781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium997Open in IMG/M
3300028784|Ga0307282_10590800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300028793|Ga0307299_10286435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300028796|Ga0307287_10374019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300028807|Ga0307305_10172181All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300028819|Ga0307296_10080615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1734Open in IMG/M
3300028872|Ga0307314_10197151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium604Open in IMG/M
3300028872|Ga0307314_10316030Not Available501Open in IMG/M
3300028876|Ga0307286_10334632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300030511|Ga0268241_10093706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300031091|Ga0308201_10120122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium786Open in IMG/M
3300031901|Ga0307406_11056305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium699Open in IMG/M
3300031996|Ga0308176_10248141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1705Open in IMG/M
3300032004|Ga0307414_10695154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria920Open in IMG/M
3300032013|Ga0310906_10362996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium946Open in IMG/M
3300032770|Ga0335085_10537198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1327Open in IMG/M
3300034819|Ga0373958_0105670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil13.10%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.14%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.14%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.45%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.76%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.07%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.07%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.07%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.07%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.38%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.38%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.38%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.38%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.69%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.69%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.69%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.69%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.69%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.69%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000880Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001334Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007821Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011996Permafrost microbial communities from Nunavut, Canada - A39_65cm_12MEnvironmentalOpen in IMG/M
3300011999Permafrost microbial communities from Nunavut, Canada - A28_65cm_6MEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300024224Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14EnvironmentalOpen in IMG/M
3300024286Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28EnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028281Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_103933122228664021SoilVRKATIERRITELALSFPESYEDRPWGDFPVFKVGQNKVFGWMVT
NODE_073851993300000156Sugar Cane Bagasse Incubating BioreactorVRKATLERRITELALSFPEAYEDRPWGDFPVFKVGKNKVFGWLVADENGVRV
INPhiseqgaiiFebDRAFT_10111566213300000364SoilVPFRPKTAIRRVRELALSFPQAYEDDPWGFPVFKVA
AL20A1W_124853533300000880PermafrostVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGANKVFGWAQVEGGAVHVTVS*
JGI10214J12806_1054857943300000891SoilMRVAAIERRITEEALSFPESYEDRPWGDFPVFKVGE
JGI10214J12806_1071023413300000891SoilVRKTTIERRITELALSFPEAYEDRPWGDFPVFKVG
JGI11615J12901_1167312923300000953SoilVRVAAIERRITEEALSFPESYEDRPWGDFPVFKVGENK
JGI10216J12902_10990323023300000956SoilVRLKAIEEQIRSSALAFPGTYEDRPWGDFPVFKVGE
A2165W6_102179113300001334PermafrostVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGANKVFGWAQVEGGAVHVTVKLT
C688J18823_1015587913300001686SoilMRVATIERRITELALSFPEAYEDRPWGDFPVFKVGDNKVFA
Ga0062593_10092656713300004114SoilMRVAAIERRITEEALSFPESYEDRPWGDFPVFKVGENKVF
Ga0062592_10070829513300004480SoilVRLEQIEARIREVALGFPESYEDHPWGDFPVFKVGQNKVFGW
Ga0062591_10144347523300004643SoilMRRDELARLRQIEAKIHEVALGFPEAYEDRPWGDFPVFKV
Ga0066677_1044929413300005171SoilVRLQAIEERVKETALGFPQAYEDRPWGDFPVFKVGQNKVFGWAVVRD
Ga0066683_1046863433300005172SoilVRLSTIERRIHDLALSFPETYEDRPWGDFPVFKVGENKVFGWA
Ga0070683_10190165223300005329Corn RhizosphereMRAATIERKVKELALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVTRDGAVDV
Ga0066388_10012499343300005332Tropical Forest SoilVRVSAIKRRITEVALSFPQSYEDRPWGDFPVFKVGENKVF
Ga0070666_1052008213300005335Switchgrass RhizosphereVRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAIT
Ga0070682_10011390713300005337Corn RhizosphereVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVAREESVDVTVKL
Ga0070710_1068152133300005437Corn, Switchgrass And Miscanthus RhizosphereVVGTAFEQRIRELALSFPETYEDHPWGDFPVFKVGDNKVFAW
Ga0070700_10106316513300005441Corn, Switchgrass And Miscanthus RhizosphereMLGEALEERIRELALSFPETYEDHPWGDFPVFKVGSNKVFAWL
Ga0070708_10116756013300005445Corn, Switchgrass And Miscanthus RhizosphereMESTTPAERQNAAVRLKAIEERITELALGFPQTYEDRPWGDFPVYKVG
Ga0066682_1037879533300005450SoilMRLQAIEERIVELALGFPQAYEDRPWGDFPVFKVGENRVFGWAVVEDGAVHVTVKLTAEERD
Ga0070684_10058129413300005535Corn RhizosphereVRNGQNAAVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQ
Ga0070672_10039046223300005543Miscanthus RhizosphereVRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKV
Ga0070695_10059032613300005545Corn, Switchgrass And Miscanthus RhizosphereVRLATIERRIKDAALAFPEAYEDRPWGDFPVFKVGQNKVFGWA
Ga0066695_1068975113300005553SoilVRLEVIEERIKDLALGFPQAYEDRPWGDFPVFKVGENKVFGWAV
Ga0066695_1085220423300005553SoilVRLSTIERRIHDLALSFPETYEDRPWGDFPVFKVGENKVFGWAVVEDGAVH
Ga0066707_1042081213300005556SoilVRLELIEERIKELALGFPQAYEDRPWGDFPVFKVGENKVFG
Ga0066698_1052793913300005558SoilMRLNAIERRIRDLALSFPEAYEDRPWGDFPVFKVGENKVFGWAVAE
Ga0066670_1004252213300005560SoilVRGTAIEERIRELALSFPETYEDHPWGDFPVFKVGA
Ga0066693_1001065313300005566SoilVLGTAIEARIRELALSFPETYEDHPWGDFPVFKVG
Ga0066705_1066019613300005569SoilVRLATIEERIHDLALGFPEAYEDRPWGDFPVYKVGENKVFGW
Ga0066654_1052731223300005587SoilVRGTAIEERIRELALSFPETYEDHPWGDFPVFKVGSN
Ga0066903_10072953413300005764Tropical Forest SoilMRGTAIEDRIRELALSFPETYEDHPWGDFPVFKVG
Ga0070717_1013466433300006028Corn, Switchgrass And Miscanthus RhizosphereVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGENKVFGWVVA
Ga0097621_10004176063300006237Miscanthus RhizosphereVRTATIERRITELALSFPEAYEDRPWGNFPVFKVGQNKVFGWVVAREESV
Ga0079222_1088883413300006755Agricultural SoilVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVF
Ga0079221_1098173413300006804Agricultural SoilMRAVRLGAIEQRITELALGFPQAYEDRPWGDFPVFKVGDNKVF
Ga0079220_1104303613300006806Agricultural SoilVRASTIERRIIELALSFPEAYEDRPWGDFPVFKVGQNKVFGW
Ga0068865_10010502613300006881Miscanthus RhizosphereVRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITRDGAV
Ga0104323_11334713300007821SoilVSSRNRENGAVRTATIERRITELALSFPQSYEDRPWGDFPVFKVGENKVFG
Ga0066710_10038099043300009012Grasslands SoilVRLEVIEERIKDLALGFPQAYEDRPWGDFPVFKVGENKVFGWAVVDDGAVHVT
Ga0105240_1065308943300009093Corn RhizosphereLATIERRIKDAALAFPEAYEDRPWGDFPVFKVGQNKVFGWAVTREESVDVTMKLTAE
Ga0075418_1167968813300009100Populus RhizosphereVRKTTIERRITELALSFPEAYEDRPWGDFPVFKVGQNKV
Ga0066709_10414044113300009137Grasslands SoilVRLELIEERIKELALGFPQAYEDRPWGDFPVFKVGENKVFGWAVVDDGAVHVT
Ga0105243_1002160783300009148Miscanthus RhizosphereVRTATIERRITELALSFPEAYEDRPWGNFPVFKVGQNKVFGWAIVRDG
Ga0105243_1018703043300009148Miscanthus RhizosphereVRAATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAIVRDGAVDVT
Ga0105243_1272029623300009148Miscanthus RhizosphereVRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITRDGAVDVTV
Ga0075423_1137497613300009162Populus RhizosphereVRTATIERRITELALSFPESYEDRPWGDFPVFKVGENKVFGWAQVAEGAVHVTV
Ga0105237_1254178823300009545Corn RhizosphereMRAATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITRDGAV
Ga0126308_1000915213300010040Serpentine SoilVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVEDGA
Ga0126321_103350813300010145SoilMGGVRTATIQRRITELALSFPEAYEDRPWGDFPVFKVGANKVF
Ga0134109_1012512733300010320Grasslands SoilVRLATIEERIRELALGFPESYEDRPWGDFPVYKVGENKVFGW
Ga0134065_1032072623300010326Grasslands SoilVRLSTIERRIRELALGFPEAYEDRPWGDFPVYKVGQNKVFGWAIVRDGSVDVTLKL
Ga0134062_1061133813300010337Grasslands SoilVRLEVIEERLNDLALGFPQAYEDRPWGDFPVFKVGENKVFGWA
Ga0126372_1137466723300010360Tropical Forest SoilVRVATIERRVTELALSFPESYEDRPWGDFPVFKVGENKVF
Ga0134125_1066138413300010371Terrestrial SoilVRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITR
Ga0134128_1210230813300010373Terrestrial SoilVVGTAIEQRMRELALSFPETYEDHPWGDFPVFKVG
Ga0105239_1022663743300010375Corn RhizosphereMRAVRKTTIERRITELALSFPEAYEDRPWGDFPVFKVGENKVFGWMV
Ga0134126_1261086823300010396Terrestrial SoilVTLEDLAAEIHGLALSFPEAHEDRPWGDLPVYKVGENRVFAWAVRDDACVRVTLKLTP
Ga0126383_1317277823300010398Tropical Forest SoilVRGTAIEERIRVLALSFPETYEDHPWGDFPVFKVGANKV
Ga0134122_1045274513300010400Terrestrial SoilVRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITRDG
Ga0120156_106886633300011996PermafrostVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGANKVFGWAQVEGGAVHV
Ga0120148_106368013300011999PermafrostVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGANKVFGWA
Ga0137380_1115141113300012206Vadose Zone SoilVRLKAIEERITELALGFPEAYEDRPWGDFPVFKVGE
Ga0137381_1085421533300012207Vadose Zone SoilVLGESIEQRIRELALSFPETYEDHPWGDFPVFKVG
Ga0137378_1087778713300012210Vadose Zone SoilVLGESIEQRIRELALSFPETYEDHPWGDFPVFKVGENKV
Ga0137377_1041020113300012211Vadose Zone SoilVLGESIEQRIRELALSFPETYEDHPWGDFPVFKVGENK
Ga0137377_1180337713300012211Vadose Zone SoilVRLATIEKRIKELALGFPEAYEDRPWGDFPVFKVGENKVFG
Ga0137371_1015848633300012356Vadose Zone SoilVRLEAIEQRITELALSFPEAYEDRPWGDFPVFKVGD
Ga0137371_1118650113300012356Vadose Zone SoilVRLATIEERIRELALGFPEAYEDRPWGDFPVYKVGENKVFGWAIVRDESVDVTVKLT
Ga0137375_1085575733300012360Vadose Zone SoilVRTATIERRISELALSFPESYEDRPWGDFPVFKVGA
Ga0157342_106893923300012507Arabidopsis RhizosphereVRTTAIERRITELALSFPESYEDRPWGDFPVFKVGQNKVFGWVVAREESVDVTVKLTA
Ga0157315_105518723300012508Arabidopsis RhizosphereVLKATIERRITELALSFPESYEDRPWGDFPVFKVGQNKVFGWMVT
Ga0137373_1011466553300012532Vadose Zone SoilVRTATIERRISELALSFPESYEDRPWGDFPVFKVGANKVFGWAQV
Ga0164298_1022987913300012955SoilVVGTAIEQRIRELALSFPETYEDHPWGDFPVFKVGDNKVFAW
Ga0164299_1033659923300012958SoilVRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVTRDGAVDVTVKLTL
Ga0164302_1066463413300012961SoilVVGTAIEQRVRELALSFPETYEDHPWGDFPVFKVGDNKVFAWL
Ga0134087_1024739013300012977Grasslands SoilVRLATIEERIRDLALGFPEAYEDRPWGDFPVYKVGENRVF
Ga0164309_1085881913300012984SoilMRPATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVTR
Ga0164304_1066816923300012986SoilMRPATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVT
Ga0157371_1109351423300013102Corn RhizosphereLATIERRIKDAALAFPEAYEDRPWGDFPVFKVGQNKVFGWAVTREDSVDVTMKLT
Ga0157372_1056585313300013307Corn RhizosphereVRNGQNAAVRTATIERRITELALSFPEAYEDRPWGDFPVFK
Ga0157375_1322439023300013308Miscanthus RhizosphereMLGEALEARIRELALSFPETYEDHPWGDFPVFKVGSNKVF
Ga0134078_1035383513300014157Grasslands SoilVRLSTIERRIHDLALSFPETYEDRPWGDFPVFKVGENKVFCWAVAQDGA
Ga0134069_111269713300017654Grasslands SoilVRLSTIERRIYDLALSFPEAYEDRPWGDFPVFKVGQN
Ga0187775_1004982733300017939Tropical PeatlandVRLATIEERIRELALGFPEAYEDRPWGDFPVYKVGENKVFGWAIVRDGSVDVTVKLTHEE
Ga0184619_1011596313300018061Groundwater SedimentMLGTAIETRIRELALSFPATYEDHRWGDFPVFKVGENK
Ga0184617_125902523300018066Groundwater SedimentVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVEDGAVHLTVKRTAEE
Ga0184625_1035817713300018081Groundwater SedimentVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVE
Ga0190269_1038893413300018465SoilVRKATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAV
Ga0066669_1214303123300018482Grasslands SoilVRLSTIERRIYDLALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVAENGAVHVTV
Ga0193705_105731013300019869SoilVRTATIERRITELALSFPESYEDRPWGDFPVFKVGA
Ga0193733_104262013300020022SoilVRLATIEERIRELALGFPEAYEDRPWGDFPVYKVGESKVFGWAI
Ga0210382_1003042253300021080Groundwater SedimentMLGTVIETRIRELALSFPATYEDHPWGDFPVFKVGENKVFAWLTI
Ga0222623_1012263443300022694Groundwater SedimentVRKATIERRITALALSFPEAYEDRPWGDFPVFKVGQN
Ga0222622_1072605213300022756Groundwater SedimentVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVEGGAVHVTVK
Ga0247787_104422423300022893SoilVRKTTIERRITELALSFPEAYEDRPWGDFPVFKVGENKVFGWMVTRDDSVDL
Ga0247790_1000088213300022915SoilVRKTTIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWMVTRDDSVDLTLK
Ga0247752_100096263300023071SoilVRKTTIERRITELALSFPEAYEDRPWGDFPVFKVGENKVFG
Ga0247673_101112413300024224SoilVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFG
Ga0247687_101216523300024286SoilVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGEN
Ga0247681_102302313300024310SoilVRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVRREDRVDVTMKL
Ga0207688_1083373013300025901Corn, Switchgrass And Miscanthus RhizosphereVRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITRDGAVDVTVKLT
Ga0207693_1012584133300025915Corn, Switchgrass And Miscanthus RhizosphereVGQNGPVRMATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGW
Ga0207652_1106556713300025921Corn RhizosphereVRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWA
Ga0207644_1170736913300025931Switchgrass RhizosphereVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFAWAVTR
Ga0207709_1092852413300025935Miscanthus RhizosphereVRAATIERKITELALSFPEAYEDRPWGDFPVFKVGQNKVFGW
Ga0207661_1144671023300025944Corn RhizosphereMRAATIERKVKELALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVTRDGAVDVT
Ga0207667_1164559213300025949Corn RhizosphereVRTATIERRITELALSFPEAYEDRPWGNFPVFKVGQNKVFGWAIVRDGAVDVTVK
Ga0207651_1119169013300025960Switchgrass RhizosphereVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWVVAREESVDVTVKL
Ga0207641_1210232213300026088Switchgrass RhizosphereMRAATIERKVKELALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVTRDGAVDVTVKL
Ga0207675_10025448313300026118Switchgrass RhizosphereVRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGW
Ga0209468_113976613300026306SoilMQGTAIEARIRELALSLPKTYEDHPWGDFPVFKVGANKVFAWLT
Ga0209265_113645623300026308SoilVRGTAIEERIRELALSFPETYEDHPWGDFPVFKVGANKVFAWL
Ga0209474_1039493913300026550SoilVRLETIEGRIKELALSFPEAYEDRPWGDFPVFKVGDNKVFGWA
Ga0207428_1096756013300027907Populus RhizosphereVRVAAIERRITEEALSFPESYEDRPWGDFPVFKVGENKVFGWAVVEEGGVHVTVKL
Ga0247689_102501313300028281SoilVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWVV
Ga0307321_108166913300028704SoilVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQIEDGAVHLTV
Ga0307295_1012934923300028708SoilVQAATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGW
Ga0307293_1004311343300028711SoilVRKATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVAEDDAVHV
Ga0307303_1014364123300028713SoilVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVEGGAVHVTVKL
Ga0307309_1000921313300028714SoilVRAATIERKVKELALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVVR
Ga0307313_1002101243300028715SoilVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFG
Ga0307313_1018304723300028715SoilVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVQEGAVH
Ga0307311_1016951313300028716SoilMRRNELARLRQIEAKIHEVALGFPEAYEDRPWGDFPVFKVGQNKVFGWAVTRED
Ga0307301_1006550813300028719SoilVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQIEDGAVHLTVKLT
Ga0307282_1018378143300028784SoilMLGTAIETRIRELALSFPATYEDHPWGDFPVFKVGE
Ga0307282_1059080023300028784SoilLACPTGRVRNGKNAAVRLEAIEQRITELALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVV
Ga0307299_1028643523300028793SoilMRLEAMEQRIRGLALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVLED
Ga0307287_1037401913300028796SoilVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVF
Ga0307305_1017218113300028807SoilVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQV
Ga0307296_1008061543300028819SoilVRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVEDG
Ga0307314_1019715113300028872SoilMRLEAMEQRIRGLALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVLE
Ga0307314_1031603013300028872SoilVRTATIERRITELALSFPESYEDRPWGDFPVFKVGAN
Ga0307286_1033463223300028876SoilVQAATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVTRDGA
Ga0268241_1009370613300030511SoilVRLSTIERRIKELALSFPQAYEDRPWGDFPVFKVG
Ga0308201_1012012213300031091SoilVRKATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVQEGAVHVTMKLTAEE
Ga0307406_1105630513300031901RhizosphereMRPVRKTTIERRIMELALSFPEAYEDRPWGDFPVFKVGQNKVFGWMVTRDDSVDVT
Ga0308176_1024814113300031996SoilMRVSAIERRIHELALSFPEAYEDRPWGDFPVYKVGAN
Ga0307414_1069515413300032004RhizosphereMRPVRKTTIERRIMELALSFPEAYEDRPWGDFPVFKVGQNKVFGWMVTRDDSVD
Ga0310906_1036299623300032013SoilVGQNGPVRMATIERRITELALSFPEAYEDRPWGDFPVFKVGENKV
Ga0335085_1053719823300032770SoilVRLATIEERIRELALGFPEAYEDRPWGDFPVYKVGENKVFGWAIVREGSVDVTVKLTQE
Ga0373958_0105670_516_6653300034819Rhizosphere SoilVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGENKVFGWVVAREESV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.