Metagenome / Metatranscriptome Family F050410

Basic Information
Family ID	F050410
Family Type	Metagenome / Metatranscriptome
Number of Sequences	145
Average Sequence Length	40 residues
Representative Sequence	LDNGRMKRELRVRLRYPDPAALLAEIAPRDLKKQLALPL
Number of Associated Samples	131
Number of Associated Scaffolds	145

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	97.93 %
% of genes from short scaffolds (< 2000 bps)	90.34 %
Associated GOLD sequencing projects	122
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Unclassified (66.897 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (7.586 % of family members)
Environment Ontology (ENVO)	Unclassified (46.207 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.586 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 20.90% β-sheet: 0.00% Coil/Unstructured: 79.10%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 145 Family Scaffolds
PF01040	UbiA	87.59
PF03167	UDG	4.14
PF01977	UbiD	1.38
PF00106	adh_short	0.69
PF07884	VKOR	0.69
PF00202	Aminotran_3	0.69
PF01568	Molydop_binding	0.69
PF07690	MFS_1	0.69
PF04039	MnhB	0.69
PF08327	AHSA1	0.69
PF01738	DLH	0.69

COG ID	Name	Functional Category	% Frequency in 145 Family Scaffolds
COG0692	Uracil-DNA glycosylase	Replication, recombination and repair [L]	4.14
COG1573	Uracil-DNA glycosylase	Replication, recombination and repair [L]	4.14
COG3663	G:T/U-mismatch repair DNA glycosylase	Replication, recombination and repair [L]	4.14
COG0043	3-polyprenyl-4-hydroxybenzoate decarboxylase	Coenzyme transport and metabolism [H]	1.38
COG2111	Multisubunit Na+/H+ antiporter, MnhB subunit	Inorganic ion transport and metabolism [P]	0.69
COG4243	Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation	General function prediction only [R]	0.69

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.90 %
All Organisms	root	All Organisms	33.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.90 %
cellular organisms	root	All Organisms → cellular organisms	33.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.90 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	33.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.90 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	30.34 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.90 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	28.97 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.90 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	16.55 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.69 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.90 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	12.41 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.69 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.90 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	2.07 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.69 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	0.69 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.69 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.90 %
pseudomallei group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group	2.07 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.69 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	0.69 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.69 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.90 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	2.07 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.69 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	0.69 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.69 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.90 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	2.07 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.69 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	0.69 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.69 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.69 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908043\|A2_c1_ConsensusfromContig13101	Not Available	741	Open in IMG/M
3300000890\|JGI11643J12802_11721136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	641	Open in IMG/M
3300005179\|Ga0066684_10422114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	896	Open in IMG/M
3300005181\|Ga0066678_10965485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	554	Open in IMG/M
3300005328\|Ga0070676_10298004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1092	Open in IMG/M
3300005330\|Ga0070690_100959809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	672	Open in IMG/M
3300005338\|Ga0068868_100126846	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2085	Open in IMG/M
3300005340\|Ga0070689_101307577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	653	Open in IMG/M
3300005355\|Ga0070671_101279369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	647	Open in IMG/M
3300005356\|Ga0070674_101327905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	642	Open in IMG/M
3300005366\|Ga0070659_100014910	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5813	Open in IMG/M
3300005518\|Ga0070699_100289918	All Organisms → cellular organisms → Bacteria → Proteobacteria	1467	Open in IMG/M
3300005535\|Ga0070684_100698080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	946	Open in IMG/M
3300005539\|Ga0068853_102128807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	544	Open in IMG/M
3300005561\|Ga0066699_10050693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2547	Open in IMG/M
3300005576\|Ga0066708_10965857	Not Available	530	Open in IMG/M
3300005578\|Ga0068854_101361062	Not Available	641	Open in IMG/M
3300005618\|Ga0068864_101298805	Not Available	728	Open in IMG/M
3300005718\|Ga0068866_11268993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	534	Open in IMG/M
3300005840\|Ga0068870_10989716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	599	Open in IMG/M
3300006032\|Ga0066696_10322107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1006	Open in IMG/M
3300006358\|Ga0068871_100249769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	1545	Open in IMG/M
3300006606\|Ga0074062_11857521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	718	Open in IMG/M
3300006755\|Ga0079222_10331569	Not Available	1015	Open in IMG/M
3300006791\|Ga0066653_10646792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	541	Open in IMG/M
3300006800\|Ga0066660_10060678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2519	Open in IMG/M
3300006881\|Ga0068865_100287043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1312	Open in IMG/M
3300007076\|Ga0075435_100455718	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1103	Open in IMG/M
3300009091\|Ga0102851_11278660	Not Available	810	Open in IMG/M
3300009093\|Ga0105240_10456446	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1429	Open in IMG/M
3300009093\|Ga0105240_10976662	Not Available	907	Open in IMG/M
3300009094\|Ga0111539_12110394	Not Available	654	Open in IMG/M
3300009098\|Ga0105245_10714008	Not Available	1036	Open in IMG/M
3300009137\|Ga0066709_103227050	Not Available	594	Open in IMG/M
3300009174\|Ga0105241_10799817	Not Available	869	Open in IMG/M
3300009174\|Ga0105241_11690273	Not Available	615	Open in IMG/M
3300009179\|Ga0115028_10654922	Not Available	794	Open in IMG/M
3300009545\|Ga0105237_11997234	Not Available	588	Open in IMG/M
3300009553\|Ga0105249_10550402	Not Available	1204	Open in IMG/M
3300010046\|Ga0126384_11360442	All Organisms → cellular organisms → Bacteria → Acidobacteria	661	Open in IMG/M
3300010359\|Ga0126376_10468552	Not Available	1156	Open in IMG/M
3300010397\|Ga0134124_12761245	Not Available	535	Open in IMG/M
3300011119\|Ga0105246_12582753	Not Available	501	Open in IMG/M
3300012203\|Ga0137399_10937543	Not Available	729	Open in IMG/M
3300012209\|Ga0137379_10497800	Not Available	1126	Open in IMG/M
3300012532\|Ga0137373_10306586	Not Available	1260	Open in IMG/M
3300012923\|Ga0137359_10219958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1696	Open in IMG/M
3300012984\|Ga0164309_10941986	Not Available	707	Open in IMG/M
3300012989\|Ga0164305_12063737	Not Available	522	Open in IMG/M
3300013104\|Ga0157370_10010102	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	9969	Open in IMG/M
3300013105\|Ga0157369_10454903	Not Available	1326	Open in IMG/M
3300013297\|Ga0157378_11329207	Not Available	760	Open in IMG/M
3300013297\|Ga0157378_12302595	Not Available	590	Open in IMG/M
3300013306\|Ga0163162_12728477	Not Available	569	Open in IMG/M
3300013306\|Ga0163162_13224527	Not Available	523	Open in IMG/M
3300013307\|Ga0157372_11006663	Not Available	965	Open in IMG/M
3300013308\|Ga0157375_10243088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1960	Open in IMG/M
3300014969\|Ga0157376_11648603	Not Available	676	Open in IMG/M
3300018032\|Ga0187788_10518515	Not Available	517	Open in IMG/M
3300018083\|Ga0184628_10441312	Not Available	678	Open in IMG/M
3300018084\|Ga0184629_10302311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	842	Open in IMG/M
3300018433\|Ga0066667_11322257	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	630	Open in IMG/M
3300018433\|Ga0066667_11668377	Not Available	571	Open in IMG/M
3300018469\|Ga0190270_12721131	Not Available	557	Open in IMG/M
3300018476\|Ga0190274_10943038	Not Available	933	Open in IMG/M
3300018481\|Ga0190271_13538393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	523	Open in IMG/M
3300018482\|Ga0066669_11203766	Not Available	684	Open in IMG/M
3300018482\|Ga0066669_12249828	Not Available	518	Open in IMG/M
3300019888\|Ga0193751_1088771	Not Available	1216	Open in IMG/M
3300019890\|Ga0193728_1203989	Not Available	828	Open in IMG/M
3300020062\|Ga0193724_1091991	Not Available	622	Open in IMG/M
3300021384\|Ga0213876_10042970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2389	Open in IMG/M
3300022309\|Ga0224510_10007430	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5640	Open in IMG/M
3300022756\|Ga0222622_10567611	Not Available	817	Open in IMG/M
3300025443\|Ga0208081_1045887	Not Available	727	Open in IMG/M
3300025461\|Ga0208851_1027725	Not Available	1060	Open in IMG/M
3300025893\|Ga0207682_10286026	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	771	Open in IMG/M
3300025906\|Ga0207699_11301798	Not Available	538	Open in IMG/M
3300025907\|Ga0207645_10253696	Not Available	1164	Open in IMG/M
3300025907\|Ga0207645_10507910	Not Available	816	Open in IMG/M
3300025908\|Ga0207643_10408550	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	859	Open in IMG/M
3300025913\|Ga0207695_10393932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1270	Open in IMG/M
3300025913\|Ga0207695_10647768	Not Available	937	Open in IMG/M
3300025913\|Ga0207695_11005493	Not Available	713	Open in IMG/M
3300025914\|Ga0207671_10849604	Not Available	723	Open in IMG/M
3300025916\|Ga0207663_11683694	Not Available	510	Open in IMG/M
3300025917\|Ga0207660_10525416	Not Available	961	Open in IMG/M
3300025921\|Ga0207652_11805957	Not Available	516	Open in IMG/M
3300025925\|Ga0207650_10835147	Not Available	781	Open in IMG/M
3300025927\|Ga0207687_10598752	Not Available	929	Open in IMG/M
3300025928\|Ga0207700_11589731	Not Available	579	Open in IMG/M
3300025940\|Ga0207691_11077600	Not Available	669	Open in IMG/M
3300025942\|Ga0207689_10099664	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2387	Open in IMG/M
3300025945\|Ga0207679_10460124	Not Available	1130	Open in IMG/M
3300025960\|Ga0207651_10723089	Not Available	878	Open in IMG/M
3300025966\|Ga0210105_1051209	Not Available	626	Open in IMG/M
3300025981\|Ga0207640_12181100	Not Available	503	Open in IMG/M
3300026023\|Ga0207677_11420454	Not Available	640	Open in IMG/M
3300026041\|Ga0207639_12193291	Not Available	514	Open in IMG/M
3300026041\|Ga0207639_12213708	Not Available	511	Open in IMG/M
3300026067\|Ga0207678_10563690	Not Available	997	Open in IMG/M
3300026095\|Ga0207676_12183476	Not Available	552	Open in IMG/M
3300026121\|Ga0207683_11532916	Not Available	615	Open in IMG/M
3300026142\|Ga0207698_10065695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2851	Open in IMG/M
3300026357\|Ga0256810_1043704	Not Available	616	Open in IMG/M
3300026538\|Ga0209056_10351443	Not Available	967	Open in IMG/M
3300027885\|Ga0209450_10064244	All Organisms → cellular organisms → Bacteria	2320	Open in IMG/M
3300028592\|Ga0247822_10813534	Not Available	762	Open in IMG/M
3300028732\|Ga0302264_1012862	All Organisms → cellular organisms → Bacteria	1921	Open in IMG/M
3300028743\|Ga0302262_10263646	Not Available	586	Open in IMG/M
3300028770\|Ga0302258_1020447	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1484	Open in IMG/M
3300028770\|Ga0302258_1143716	Not Available	586	Open in IMG/M
3300029984\|Ga0311332_10022114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	4269	Open in IMG/M
3300029990\|Ga0311336_11716738	Not Available	554	Open in IMG/M
3300030010\|Ga0302299_10308371	Not Available	822	Open in IMG/M
3300030010\|Ga0302299_10398599	Not Available	703	Open in IMG/M
3300030114\|Ga0311333_10037749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	3407	Open in IMG/M
3300031232\|Ga0302323_102598254	Not Available	578	Open in IMG/M
3300031562\|Ga0310886_10807851	Not Available	591	Open in IMG/M
3300031720\|Ga0307469_11778033	Not Available	595	Open in IMG/M
3300031772\|Ga0315288_10727028	Not Available	931	Open in IMG/M
3300031820\|Ga0307473_10410226	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	890	Open in IMG/M
3300031834\|Ga0315290_10944071	Not Available	729	Open in IMG/M
3300031847\|Ga0310907_10821472	Not Available	521	Open in IMG/M
3300031918\|Ga0311367_12172991	Not Available	533	Open in IMG/M
3300031939\|Ga0308174_10044834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2949	Open in IMG/M
3300031996\|Ga0308176_11045594	Not Available	862	Open in IMG/M
3300032008\|Ga0318562_10080047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1834	Open in IMG/M
3300032008\|Ga0318562_10287878	Not Available	955	Open in IMG/M
3300032076\|Ga0306924_12630841	Not Available	501	Open in IMG/M
3300032092\|Ga0315905_11004037	Not Available	702	Open in IMG/M
3300032174\|Ga0307470_11379294	Not Available	581	Open in IMG/M
3300032256\|Ga0315271_11274648	Not Available	635	Open in IMG/M
3300032256\|Ga0315271_11530839	Not Available	574	Open in IMG/M
3300032261\|Ga0306920_101238553	Not Available	1076	Open in IMG/M
3300032420\|Ga0335397_10952184	Not Available	581	Open in IMG/M
3300032516\|Ga0315273_13120633	Not Available	515	Open in IMG/M
3300032770\|Ga0335085_12449164	Not Available	519	Open in IMG/M
3300032782\|Ga0335082_10411335	Not Available	1217	Open in IMG/M
3300033413\|Ga0316603_11597965	Not Available	618	Open in IMG/M
3300033414\|Ga0316619_11080519	All Organisms → cellular organisms → Bacteria → Proteobacteria	703	Open in IMG/M
3300033482\|Ga0316627_100927952	Not Available	837	Open in IMG/M
3300033513\|Ga0316628_104000382	Not Available	527	Open in IMG/M
3300033521\|Ga0316616_100008518	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	5770	Open in IMG/M
3300034129\|Ga0370493_0174910	Not Available	710	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	62.76%
Host-Associated	Host-Associated	37.24%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	51.72%
Plants	Host-Associated → Plants	37.24%
Aquatic	Environmental → Aquatic	11.03%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	44.14%
Rhizosphere	Host-Associated → Plants → Rhizosphere	23.45%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.41%
Freshwater	Environmental → Aquatic → Freshwater	7.59%
Peat	Environmental → Terrestrial → Peat	7.59%
Sediment	Environmental → Aquatic → Sediment	2.07%
Marine	Environmental → Aquatic → Marine	1.38%
Roots	Host-Associated → Plants → Roots	1.38%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	31.72%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	15.17%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.72%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.28%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	7.59%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.21%
Loam	Environmental → Terrestrial → Soil → Loam	6.21%
Lake	Environmental → Aquatic → Freshwater → Lake	3.45%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.07%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.38%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.69%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.69%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.69%
Ice	Environmental → Aquatic → Freshwater → Ice	0.69%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.69%
Sediment	Environmental → Aquatic → Marine → Sediment	0.69%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.69%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.69%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.69%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	15.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.72%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	11.03%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	9.66%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.28%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	7.59%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.21%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.21%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.83%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	3.45%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.45%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.07%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	2.07%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.69%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.69%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.69%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.69%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.69%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	0.69%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.69%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.69%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.69%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.69%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.69%

Habitat	Taxonomy	Distribution
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	7.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.21%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	6.21%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.52%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	4.14%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	4.14%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	3.45%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.45%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.76%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.76%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.07%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.07%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.07%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.07%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.07%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.07%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.38%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.38%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.38%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.38%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.38%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.38%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.38%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.69%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.69%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.69%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.69%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.69%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	0.69%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.69%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.69%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.69%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.69%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.69%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.69%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.69%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.69%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908043	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009179	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1	Environmental	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300018032	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300019890	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1	Environmental	Open in IMG/M
3300020062	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1	Environmental	Open in IMG/M
3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Host-Associated	Open in IMG/M
3300022309	Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025443	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-092012 (SPAdes)	Environmental	Open in IMG/M
3300025461	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes)	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025966	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026357	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU5	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028732	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4	Environmental	Open in IMG/M
3300028743	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4	Environmental	Open in IMG/M
3300028770	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4	Environmental	Open in IMG/M
3300029984	I_Fen_E1 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030010	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4	Environmental	Open in IMG/M
3300030114	I_Fen_E2 coassembly	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031918	III_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032420	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental	Open in IMG/M
3300034129	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
A2_c1_00004130	2124908043	Soil	MKRELRVRLKYPTPQTLFAEVAPKALRKQLALPLGAVNVNSA
JGI11643J12802_117211362	3300000890	Soil	RLVNDRLKRELRISLAHPTPQAMLAQTAPRALTRQLPLPIG
Ga0066684_104221141	3300005179	Soil	SNTRLKRELRVKLKFPTPQALLAQIAPRELKKQLALPIE*
Ga0066678_109654852	3300005181	Soil	ESRRLSNARMKRELRVRLRYPTPATLLAEVAPRELKKQIQLPL*
Ga0070676_102980041	3300005328	Miscanthus Rhizosphere	RLVNDRLKRELRLSLAHPTPHAMLAQAAPRALTRQLALPIG*
Ga0070690_1009598091	3300005330	Switchgrass Rhizosphere	MSESRRLSNTRMKRELRVRLEFATPDALLADIAPRALKKQLALPLGVR*
Ga0068868_1001268464	3300005338	Miscanthus Rhizosphere	LSNTRMKRELRVRLEFATPDALLADIAPRALKKQLALPLGVR*
Ga0070689_1013075771	3300005340	Switchgrass Rhizosphere	RRLVNTRMKRELRVRLAYPTPQVLLAAVAPRELKKQLPLAL*
Ga0070671_1012793691	3300005355	Switchgrass Rhizosphere	NTRMKRELRVRLEFATPDALLADIAPRALKKQLALPLGVR*
Ga0070674_1013279052	3300005356	Miscanthus Rhizosphere	SYMSESRRLSNARMKRELRVRLRYRTPQQLLDEIAPRDLKKQMALPL*
Ga0070659_1000149107	3300005366	Corn Rhizosphere	RRLANARMKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG*
Ga0070699_1002899181	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	ESRRLSNARMKRELRVRLRYPTPQALLAEVAPRELKKQLNLLL*
Ga0070684_1006980802	3300005535	Corn Rhizosphere	MNESRRLSNARMKRELRLRLLHPTPHAMLAQVAPRELTRQLALPIGA*
Ga0068853_1021288071	3300005539	Corn Rhizosphere	SRRLVNARMKRELRVRLRYPSPLALLREVAPRDLKRQLALPL*
Ga0066699_100506934	3300005561	Soil	FMSESRRLANQRMKRELRVRLKYPTPQTLFAEVAPKALRKQLALPLGAVNVDSA*
Ga0066708_109658572	3300005576	Soil	RLKYPTPQTLFAEVAPKALRKQLALPLGAVNVDSA*
Ga0068854_1013610621	3300005578	Corn Rhizosphere	NDRMKRELRVALRYPEPATLLARIAPREPKKQLALPLG*
Ga0068864_1012988052	3300005618	Switchgrass Rhizosphere	MKRELRVRLRYRTPQELLDEIAPRDLKKQMTLPL*
Ga0068866_112689931	3300005718	Miscanthus Rhizosphere	SRRLDNDRLKRELRVRLRFPTPDALLSDVARRGLKKQLALPL*
Ga0068870_109897161	3300005840	Miscanthus Rhizosphere	NESRRLSNARMKRELRVRLRYPEPQALLAQIAPRDLRKQLNLPL*
Ga0066696_103221072	3300006032	Soil	SFMSESRRLSNTRMKRELRIGLDYPTPQKLLKEIAPRELKKQLALAI*
Ga0068871_1002497691	3300006358	Miscanthus Rhizosphere	RMKRELRVRLRYPIPQAMLEAVAPRELRKQLALPI*
Ga0074062_118575211	3300006606	Soil	LTNGRMKRELRVRLRYPVPDVMLSQIAPRNLKRQLALPL*
Ga0079222_103315691	3300006755	Agricultural Soil	KRELRVRLRHPTPDAMLAQCAPRELRKQLALPIG*
Ga0066653_106467922	3300006791	Soil	SNARMKRELRVRLRYPTSQALLAEVAPRELKKQLNLPL*
Ga0066660_100606781	3300006800	Soil	ESRRLANQRMKRELRVRLKYPTPHTLFAEVAPKALRKQLALPLGAVKVDSA*
Ga0068865_1002870433	3300006881	Miscanthus Rhizosphere	LVNARMKRELRVRLRYPSPLALLREVAPRDLKRQLALPL*
Ga0075435_1004557182	3300007076	Populus Rhizosphere	RRLANMRMKDELRVRLRYPTPQHLLDAVAPRDLKKQLALPL*
Ga0102851_112786602	3300009091	Freshwater Wetlands	LSNARMKRELRLRLQYPTPHRLLDEIAPRDLRKQLALPL*
Ga0105240_104564461	3300009093	Corn Rhizosphere	RMKRELRVRLRHPTPDAMLAQCAPRELRRQLALPIG*
Ga0105240_109766622	3300009093	Corn Rhizosphere	RLSNTRMKRELRVRLAYATPDALLTDIAPRALKKQLALPLGVR*
Ga0111539_121103941	3300009094	Populus Rhizosphere	RRLSNTRMKRELRVRQRYPTPAAFLADMVPREFRKQLALPI*
Ga0105245_107140082	3300009098	Miscanthus Rhizosphere	SESRRLSNARMKRELRVRLRYKTPQQLLDEIAPRDLKKQLALPL*
Ga0066709_1032270501	3300009137	Grasslands Soil	KRELRVRLKYPTPQTLFAQVAPRELKKQMPLPLDY*
Ga0105241_107998171	3300009174	Corn Rhizosphere	SESRRLGNARMKRELRVRLRHPTPDAMLAQCAPRELKRQLALPIG*
Ga0105241_116902731	3300009174	Corn Rhizosphere	RMKRELRMRLRHPTPHAMLAQTAPRELRRQLALPIG*
Ga0115028_106549221	3300009179	Wetland	SESRRLSNARMKGELRVRLRYPTPQRLLDEIAPRDLKKQLALPL*
Ga0105237_119972342	3300009545	Corn Rhizosphere	LVNARMKRELRVRLAYPTPQVLLAAVAPRELKKQLALAL*
Ga0105249_105504021	3300009553	Switchgrass Rhizosphere	RAKRELRMRLAYPTPQSLLAEVAPRELKKQLPLAL*
Ga0126384_113604422	3300010046	Tropical Forest Soil	MKRELRVSLRYPTPERLLAEVARRDLKKQMPLPL*
Ga0126376_104685521	3300010359	Tropical Forest Soil	MKRELRVSLRYPTPERLLAEVARRDFKKQMPLPL*
Ga0134124_127612452	3300010397	Terrestrial Soil	NARMKRELRVRLRYPSPLALLREVAPRDLKRQLALPL*
Ga0105246_125827532	3300011119	Miscanthus Rhizosphere	LSNARMKRELRLRLLYPTPQRLLAEIAPRDLKKQLALAL*
Ga0137399_109375431	3300012203	Vadose Zone Soil	TRMKRELRVRLRYSTPQAMLARIAPRELKKQLALPI*
Ga0137379_104978001	3300012209	Vadose Zone Soil	NTRMKRELRVRLKYPTPQTLLAQVAPRELRKQMALPLD*
Ga0137373_103065861	3300012532	Vadose Zone Soil	NARMKRELRVRLRYPTPMPLLDAIAPRDLKKQLTLPL*
Ga0137359_102199583	3300012923	Vadose Zone Soil	RLANQRMKRELRVRLKYPTPQTLFAEVAPKALRKQLALPLGAVNVDSA*
Ga0164309_109419862	3300012984	Soil	NESRRLRNLRMKRELRVALRYPEPAALLARIAPREPKKQLALPLG*
Ga0164305_120637371	3300012989	Soil	RELRLRLLHPTPHAMLAQVAPRELTRQLALPIGA*
Ga0157370_100101021	3300013104	Corn Rhizosphere	SRRLVNARMKRELRVTLRHPTPHDVLKEAAPRALRRQLSLPIA*
Ga0157369_104549032	3300013105	Corn Rhizosphere	MSESRRLSNARLKRELRARLAHPTPHAMLAQVAPRELTRQLALPIGT*
Ga0157378_113292072	3300013297	Miscanthus Rhizosphere	ESRRLSNARMKRELRLRLLYPTPQKLLAEIAPRDLKKQLALPL*
Ga0157378_123025951	3300013297	Miscanthus Rhizosphere	KRELRLSLAHPTPHAMLAQAAPRALTRQLALPIG*
Ga0163162_127284772	3300013306	Switchgrass Rhizosphere	VRLKRELRLRLLHPTPHAMLAQVAPRELTRQLALPIGT*
Ga0163162_132245271	3300013306	Switchgrass Rhizosphere	RRLSNSRMKRELRVRLKYPTPQQLLDDVAPRDLRKQLALPI*
Ga0157372_110066631	3300013307	Corn Rhizosphere	RMKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG*
Ga0157375_102430884	3300013308	Miscanthus Rhizosphere	VNTRMKRELRVRLLYPTPQHLLSEIAPRDLKKQLALPL*
Ga0157376_116486032	3300014969	Miscanthus Rhizosphere	RLSNARMKLELRLRLLYPTPQRLLAEIAPRDLKKQLALPL*
Ga0187788_105185151	3300018032	Tropical Peatland	RMKRELRLRLKYPEPGALLAEVARRRPKKQLALPL
Ga0184628_104413122	3300018083	Groundwater Sediment	MSESRRLVNTRMKRELRVRLKYPTPQHLLAEVAPRDLKKQLALPL
Ga0184629_103023111	3300018084	Groundwater Sediment	RLSNVRMKRELRVTLRYPNPQQLLDEVAPRDLRKQLALPL
Ga0066667_113222572	3300018433	Grasslands Soil	MSESRRLTNTRMKRELRLHLKYPTPDTFLAEVAPRALRKQLALPL
Ga0066667_116683772	3300018433	Grasslands Soil	NTRMKRELRVRLKYATPQALLQEVAPRELKKQLPLPL
Ga0190270_127211311	3300018469	Soil	NARAKRELRMRLAYPTPQSLLAEVAPRELKKQLPLAL
Ga0190274_109430381	3300018476	Soil	RRLVNTRMKRELRLRLKYPTPQHLLAEVAPRDLKKQLALPL
Ga0190271_135383932	3300018481	Soil	SRRLTNVRMKRELRVRLRYPTPQRLFDEAAPRDLKKQLVLPL
Ga0066669_112037661	3300018482	Grasslands Soil	RRLSNTRMKRELRVRLRYPTPAILLAQVARRELRKQIPLPL
Ga0066669_122498281	3300018482	Grasslands Soil	SESRRLTNVRMKRELRVNLKYPTPQVLLNQIAPRELKKQLALPI
Ga0193751_10887711	3300019888	Soil	RELRVRLKYPTPQVLFAEVAPKALKKQLALPLGNAP
Ga0193728_12039892	3300019890	Soil	RLANERMKRELRVRLKYPTPQTLFAEVAPRALKKQLALPLGAINVNSA
Ga0193724_10919911	3300020062	Soil	RMKRELRVRLEFATPDALLADIAPRALKKQLALPLGAQ
Ga0213876_100429701	3300021384	Plant Roots	LRLKRELRVRLRYPTPQALLSDIARRELKKQLALPI
Ga0224510_100074307	3300022309	Sediment	ANARMKRELRVRLRYPAPQDLLAEIAPRDLRKQMALPL
Ga0222622_105676112	3300022756	Groundwater Sediment	ESRRLINTRMKRELRVRLLYPTPQHLLSEIAPRDLKKQLALPL
Ga0208081_10458872	3300025443	Arctic Peat Soil	SNARMKGELRVRLRYPTAQTMLGEIAPRDLKKQMALPL
Ga0208851_10277251	3300025461	Arctic Peat Soil	RLKRELRVRLQFPTPDTLLSGVAPRDLKKQLALPL
Ga0207682_102860261	3300025893	Miscanthus Rhizosphere	VNDRLKRELRLSLAHPTPHAMLAQAAPRALTRQLALPIG
Ga0207699_113017981	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MKRELRVRLRHPTPDAMLAQCAPRELKRQLALPIG
Ga0207645_102536963	3300025907	Miscanthus Rhizosphere	RRLVNDRLKRELRLSLAHPTPHAMLAQAAPRALTRQLALPIG
Ga0207645_105079102	3300025907	Miscanthus Rhizosphere	RRLSNARMKRELRVRLRYRTPQALLDEIAPRDLKKQLTLPL
Ga0207643_104085501	3300025908	Miscanthus Rhizosphere	RLSNARMKRELRVRLRYPEPQALLAQIAPRDLRKQLNLPL
Ga0207695_103939323	3300025913	Corn Rhizosphere	NDRMKRELRVRLRHPTPDAMLAQCAPRELRRQLALPIG
Ga0207695_106477682	3300025913	Corn Rhizosphere	GNARMKRELRVRLRHPTPDAMLAQCAPRELKRQLALPIG
Ga0207695_110054932	3300025913	Corn Rhizosphere	MSESRRLSNTRMKRELRVRLEFATPDALLADIAPRALKKQLALPLGVR
Ga0207671_108496042	3300025914	Corn Rhizosphere	SESRRLANARMKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG
Ga0207663_116836941	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	RMKRELRLKLHHPTAERMLADVARRALKKQLALPL
Ga0207660_105254161	3300025917	Corn Rhizosphere	ARMKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG
Ga0207652_118059571	3300025921	Corn Rhizosphere	RMKRELRVRLRHPTPHAVLAKAAPRELRRQLTLPIG
Ga0207650_108351471	3300025925	Switchgrass Rhizosphere	RRLSNARLKRELRVRLAHPTPHAMLAQVAPRELTRQLALPIGT
Ga0207687_105987522	3300025927	Miscanthus Rhizosphere	RRLCNARMKRELRVRLAFPTPDALLADIAPRALKKQLALPLGAQ
Ga0207700_115897312	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	RRLVNSRMKRELRVRLRHPTPHGELAQTAPRELRRQLALPIG
Ga0207691_110776001	3300025940	Miscanthus Rhizosphere	RMKRELRVALRYPEPAALLARIAPREPKKQLALPLG
Ga0207689_100996641	3300025942	Miscanthus Rhizosphere	RLSNARMKRELQVRLKYPTPAAMLAAVAPRALRKQLALPI
Ga0207679_104601241	3300025945	Corn Rhizosphere	KRELRVRLAFPTPDALLADIAPRALKKQLALPLGAQ
Ga0207651_107230891	3300025960	Switchgrass Rhizosphere	ARMKRELQVRLKYPTPAAMLAAVAPRALRKQLALPI
Ga0210105_10512092	3300025966	Natural And Restored Wetlands	NARMKRELRLRLRYPLPQVLLDEVAPRDLRKQLALPL
Ga0207640_121811001	3300025981	Corn Rhizosphere	RLVNDRMKRELRVALRYPEPATLLARIAPREPKKQLALPLG
Ga0207677_114204542	3300026023	Miscanthus Rhizosphere	MNESRRLGNRRMKRELRVALRYPEPAALLARIAPREPKKQLALPLG
Ga0207639_121932911	3300026041	Corn Rhizosphere	DRMKRELRVALRYPEPAALLARIAPREPKKQLALPLG
Ga0207639_122137082	3300026041	Corn Rhizosphere	DRLKRELRVRLRFPTPDAMLGDVARRDLKKQLALPL
Ga0207678_105636901	3300026067	Corn Rhizosphere	MKRELRVALRYPEPAALLARIAPREPKKQLALPLG
Ga0207676_121834761	3300026095	Switchgrass Rhizosphere	SNVRMKRELRVRLRYPIPQAMLEAVAPRELRKQLALPI
Ga0207683_115329162	3300026121	Miscanthus Rhizosphere	SRRLSNARLKRELRVRLAHPTPHAMLAQVAPRELTRQLALPIGT
Ga0207698_100656955	3300026142	Corn Rhizosphere	MKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG
Ga0256810_10437041	3300026357	Sediment	LSNRRMKRELRLVLRHPTITQTLAEAAPRTLRKQLALPI
Ga0209056_103514431	3300026538	Soil	RRLANTRMKRELRGRLKDPTPQALLREVAPLELKKQLALPL
Ga0209450_100642441	3300027885	Freshwater Lake Sediment	SRRLVNARMKRELRVKLRYPTPQDLLDEVAPRDLRKQLALPL
Ga0247822_108135341	3300028592	Soil	RRLVNARAKRELRLRLAHPTPQPLLAEVAPRELRKQLALQL
Ga0302264_10128621	3300028732	Fen	DRLKRELRVQLRYPTPDALLSGIVPRDLKKQLALAL
Ga0302262_102636461	3300028743	Fen	RLANTRMKRELRLKLRYPTPEALLAEVAPRALKKQLALSL
Ga0302258_10204471	3300028770	Fen	NDRLKRELRVRLRYPTPDALLSGIAPRDLKKQLALAL
Ga0302258_11437161	3300028770	Fen	DRLKHELRVRLQFPTPDTLLSGVAPRDLKKQLALPI
Ga0311332_100221146	3300029984	Fen	DRLKRELRVRLQFPTPDTLLSGVAPRDLKKQLALPL
Ga0311336_117167381	3300029990	Fen	RMKRELRLKLRYPTPEALLAEVAPRALKKQLALSL
Ga0302299_103083712	3300030010	Fen	RLKRELRVRLRYPTPDALLSGIAPRDLKKQLALAL
Ga0302299_103985992	3300030010	Fen	LGNDRLKRELRVRLQYPTPDALLSGIAPRDLKKQLALAL
Ga0311333_100377491	3300030114	Fen	LVNDRLKRELRVRLQFPTPDTLLSGVAPRDLKKQLALPL
Ga0302323_1025982542	3300031232	Fen	RMKRELRVNLRYPTPQHLLTAIAPRDLRKQMALPL
Ga0310886_108078511	3300031562	Soil	ESRRLSNARMKRELRVRLRYRTPQALLDEIAPRDLKKQLALPL
Ga0307469_117780331	3300031720	Hardwood Forest Soil	RMKRELRVRLEFATPDALLADIAPRALKKQLALPLGAR
Ga0315288_107270281	3300031772	Sediment	ARMKRELRVRLKYETPQQLLTEIAPRDLKKQLALPL
Ga0307473_104102262	3300031820	Hardwood Forest Soil	RLSNARMKRELRLRLKYPLPQAMLDEIAPRQLRRQLALPLATDR
Ga0315290_109440712	3300031834	Sediment	RMKRELRVRLKYETPQQLLTEIAPRDLKKQLALPL
Ga0310907_108214721	3300031847	Soil	GESRRLANRRMKGELRVRLRYPTPQAMLDALAPRALRKQMPLTF
Ga0311367_121729912	3300031918	Fen	RLTNERLKSELRVRLRYPTPEAMLRDIAPRDLKKQLALPL
Ga0308174_100448345	3300031939	Soil	ANTRMKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG
Ga0308176_110455941	3300031996	Soil	MKRELRVRLRHPTPHAMLAQCAPRELRRQLLLPIG
Ga0318562_100800471	3300032008	Soil	RLSNARMKRELRVRLRYSTPQQLLDEIAPRDLKKQLALPL
Ga0318562_102878782	3300032008	Soil	MKRELRLHLRYPRPQVLLAEVAPRELRKQLALPLGS
Ga0306924_126308412	3300032076	Soil	RLSNARMKRELRLHLRYPRPQVLLAEVAPRELRKQLALPLGS
Ga0315905_110040372	3300032092	Freshwater	RLANVRMKRELRVRLRYPVPQVLLDEVAPRDLRKQLALPI
Ga0307470_113792941	3300032174	Hardwood Forest Soil	LDNGRMKRELRVRLRYPDPAALLAEIAPRDLKKQLALPL
Ga0315271_112746481	3300032256	Sediment	LSNARMKRELRVRLCYPIPQRLLDEIAPRDLKKQLALPL
Ga0315271_115308392	3300032256	Sediment	RLVNARMKRELRVRLQYETPQQLLTEIAPRDLKKQLALPL
Ga0306920_1012385531	3300032261	Soil	MNESRRLANARMKRELRLRLKYPTPDVLFAEVARRSPKKQLALPL
Ga0335397_109521842	3300032420	Freshwater	RMKRELRVRLAFPTPQVMLAAVVPKQLKKQLPLAL
Ga0315273_131206331	3300032516	Sediment	FMGESRRLTNVRMKRELRVRLKYPTPQRLLDEVAPRDLKKQLVLPL
Ga0335085_124491641	3300032770	Soil	ARMKRELRVRLLYPTPARLLEAIAPRDLKKQLALPL
Ga0335082_104113353	3300032782	Soil	ARMKRELRVRLRYRTPQQLLDEVAPRDLKKQLALPL
Ga0316603_115979651	3300033413	Soil	SFMSESRRLVNRRMKHELRVRLAYATPATLLAAVAPRELKKQLPLAL
Ga0316619_110805192	3300033414	Soil	MSESRRVGNGRMKRELRVRLAYPTPQRLLDEVAPRNLRKQLALPI
Ga0316627_1009279522	3300033482	Soil	LVNTRMKRELRVRLRYPIPQGLLDEVAPRDLKNQLPLPL
Ga0316628_1040003822	3300033513	Soil	NARMKRELRVVLRYATPQRLLAEIAPRDLKKQLALPL
Ga0316616_1000085187	3300033521	Soil	SNARMKRELRLVLKYPNPQQMLDEIAPRDLRKQLALPL
Ga0370493_0174910_7_123	3300034129	Untreated Peat Soil	MKRELRVRLTYPNPHQLLKEVAPRNLKRQLALPLGAEE

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F050410

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign