NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050313

Metagenome / Metatranscriptome Family F050313

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050313
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 163 residues
Representative Sequence VNRTLALIALLLLLTPVVVCQTQSHASDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDEDIAVELRDKSGTTLDAQKVVVETREKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFALHKKGVPQPAVIFPTNYSHKRSKPCDSVYMVELLCPR
Number of Associated Samples 132
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 35.17 %
% of genes near scaffold ends (potentially truncated) 51.03 %
% of genes from short scaffolds (< 2000 bps) 72.41 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.69

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(13.793 % of family members)
Environment Ontology (ENVO) Unclassified
(31.034 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.897 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 9.52%    β-sheet: 39.68%    Coil/Unstructured: 50.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.69
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF00069Pkinase 3.45
PF02371Transposase_20 2.07
PF00432Prenyltrans 2.07
PF07516SecA_SW 2.07
PF14329DUF4386 1.38
PF05649Peptidase_M13_N 1.38
PF12697Abhydrolase_6 1.38
PF00920ILVD_EDD 1.38
PF00730HhH-GPD 0.69
PF01555N6_N4_Mtase 0.69
PF01343Peptidase_S49 0.69
PF13847Methyltransf_31 0.69
PF00023Ank 0.69
PF04851ResIII 0.69
PF09989DUF2229 0.69
PF02775TPP_enzyme_C 0.69
PF07228SpoIIE 0.69
PF02578Cu-oxidase_4 0.69
PF11138DUF2911 0.69
PF00535Glycos_transf_2 0.69
PF11175DUF2961 0.69
PF04368DUF507 0.69
PF01842ACT 0.69
PF09335SNARE_assoc 0.69
PF02129Peptidase_S15 0.69
PF05175MTS 0.69
PF13414TPR_11 0.69
PF07136DUF1385 0.69
PF03422CBM_6 0.69
PF02518HATPase_c 0.69
PF08241Methyltransf_11 0.69
PF03841SelA 0.69
PF13404HTH_AsnC-type 0.69
PF07690MFS_1 0.69
PF02416TatA_B_E 0.69
PF01370Epimerase 0.69
PF13537GATase_7 0.69
PF01425Amidase 0.69
PF01841Transglut_core 0.69
PF00326Peptidase_S9 0.69
PF05685Uma2 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 13.79
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 2.76
COG0653Preprotein translocase subunit SecA (ATPase, RNA helicase)Intracellular trafficking, secretion, and vesicular transport [U] 2.07
COG3547TransposaseMobilome: prophages, transposons [X] 2.07
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.38
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 1.38
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.69
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.69
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.69
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.69
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.69
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.69
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.69
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.69
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.69
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.69
COG1496Copper oxidase (laccase) domainInorganic ion transport and metabolism [P] 0.69
COG1826Twin-arginine protein secretion pathway components TatA and TatBIntracellular trafficking, secretion, and vesicular transport [U] 0.69
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.69
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.69
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.69
COG3872Uncharacterized conserved protein YqhQ, DUF1385 familyFunction unknown [S] 0.69
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10545193All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300002245|JGIcombinedJ26739_100166156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2086Open in IMG/M
3300002245|JGIcombinedJ26739_100490639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1105Open in IMG/M
3300002245|JGIcombinedJ26739_100891904All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300004080|Ga0062385_10022637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2394Open in IMG/M
3300004082|Ga0062384_100743845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300004091|Ga0062387_101283016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300004635|Ga0062388_100496286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1091Open in IMG/M
3300005174|Ga0066680_10640339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300005177|Ga0066690_10363857All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium981Open in IMG/M
3300005179|Ga0066684_11044189All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300005186|Ga0066676_10782075All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300005435|Ga0070714_100478156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1186Open in IMG/M
3300005436|Ga0070713_100205756All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1780Open in IMG/M
3300005446|Ga0066686_10068450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2217Open in IMG/M
3300005447|Ga0066689_10078433All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300005526|Ga0073909_10075919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1280Open in IMG/M
3300005533|Ga0070734_10000011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae658267Open in IMG/M
3300005534|Ga0070735_10003121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter14635Open in IMG/M
3300005540|Ga0066697_10234700All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1088Open in IMG/M
3300005552|Ga0066701_10197681All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1231Open in IMG/M
3300005552|Ga0066701_10300413All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium995Open in IMG/M
3300005559|Ga0066700_10243048All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1256Open in IMG/M
3300005569|Ga0066705_10759445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300005586|Ga0066691_10810288All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300005591|Ga0070761_10122338All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1511Open in IMG/M
3300006028|Ga0070717_10140954All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2079Open in IMG/M
3300006028|Ga0070717_12045557All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300006052|Ga0075029_100657745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300006052|Ga0075029_100778039All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300006102|Ga0075015_100837244All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300006162|Ga0075030_100299830All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1285Open in IMG/M
3300006642|Ga0075521_10329709All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium737Open in IMG/M
3300006796|Ga0066665_10110189All Organisms → cellular organisms → Bacteria2034Open in IMG/M
3300009094|Ga0111539_11837255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300009634|Ga0116124_1235755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300009639|Ga0116122_1199504All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300009641|Ga0116120_1041980All Organisms → cellular organisms → Bacteria1593Open in IMG/M
3300009645|Ga0116106_1057581All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1288Open in IMG/M
3300009759|Ga0116101_1035378All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1035Open in IMG/M
3300009764|Ga0116134_1089653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1122Open in IMG/M
3300010379|Ga0136449_100482648All Organisms → cellular organisms → Bacteria → Acidobacteria2160Open in IMG/M
3300012207|Ga0137381_11046470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300012350|Ga0137372_10153983All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300012532|Ga0137373_11080259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300014162|Ga0181538_10206737All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1099Open in IMG/M
3300014169|Ga0181531_11090958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300016422|Ga0182039_10740448All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium869Open in IMG/M
3300017935|Ga0187848_10474285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300017939|Ga0187775_10106874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium948Open in IMG/M
3300017940|Ga0187853_10190244All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium965Open in IMG/M
3300017940|Ga0187853_10285264All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300017943|Ga0187819_10115810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1600Open in IMG/M
3300017946|Ga0187879_10023148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3821Open in IMG/M
3300017948|Ga0187847_10069965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1962Open in IMG/M
3300017948|Ga0187847_10188038All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1126Open in IMG/M
3300017955|Ga0187817_10079363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2050Open in IMG/M
3300017961|Ga0187778_10039913All Organisms → cellular organisms → Bacteria2868Open in IMG/M
3300017966|Ga0187776_10051387All Organisms → cellular organisms → Bacteria2346Open in IMG/M
3300017975|Ga0187782_11199989All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300017988|Ga0181520_10615891All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300017996|Ga0187891_1315407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300018009|Ga0187884_10011815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5143Open in IMG/M
3300018026|Ga0187857_10130225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1206Open in IMG/M
3300018034|Ga0187863_10012473All Organisms → cellular organisms → Bacteria5430Open in IMG/M
3300018035|Ga0187875_10000410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae37049Open in IMG/M
3300018035|Ga0187875_10000759All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis26067Open in IMG/M
3300018037|Ga0187883_10191872All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1048Open in IMG/M
3300018038|Ga0187855_10013684All Organisms → cellular organisms → Bacteria5405Open in IMG/M
3300018038|Ga0187855_10017138All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4773Open in IMG/M
3300018038|Ga0187855_10475951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300018044|Ga0187890_10026487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3547Open in IMG/M
3300018047|Ga0187859_10014600All Organisms → cellular organisms → Bacteria4432Open in IMG/M
3300018047|Ga0187859_10455456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300018047|Ga0187859_10733583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300018062|Ga0187784_11113824All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300018064|Ga0187773_10017350All Organisms → cellular organisms → Bacteria3053Open in IMG/M
3300018088|Ga0187771_11431398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300018089|Ga0187774_10120322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1329Open in IMG/M
3300018433|Ga0066667_11085499All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300018468|Ga0066662_10187360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1618Open in IMG/M
3300018482|Ga0066669_10194979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1544Open in IMG/M
3300019785|Ga0182022_1261806All Organisms → cellular organisms → Bacteria1807Open in IMG/M
3300019879|Ga0193723_1059406All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1114Open in IMG/M
3300020022|Ga0193733_1155901All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300021086|Ga0179596_10035255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1967Open in IMG/M
3300021171|Ga0210405_10001274All Organisms → cellular organisms → Bacteria → Acidobacteria29442Open in IMG/M
3300021402|Ga0210385_10012194All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00685275Open in IMG/M
3300021420|Ga0210394_10000008All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae502903Open in IMG/M
3300021478|Ga0210402_10066635All Organisms → cellular organisms → Bacteria3175Open in IMG/M
3300022717|Ga0242661_1144420All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300022850|Ga0224552_1044262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300024049|Ga0233359_1020014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300025507|Ga0208188_1120474All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300025527|Ga0208714_1051227All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300025915|Ga0207693_10562940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium888Open in IMG/M
3300025916|Ga0207663_11204980All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300025929|Ga0207664_11116018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium705Open in IMG/M
3300026291|Ga0209890_10011448All Organisms → cellular organisms → Bacteria3590Open in IMG/M
3300026524|Ga0209690_1139227All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium915Open in IMG/M
3300026537|Ga0209157_1055143All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2080Open in IMG/M
3300026538|Ga0209056_10163805All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1680Open in IMG/M
3300026550|Ga0209474_10586966All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300027645|Ga0209117_1029547All Organisms → cellular organisms → Bacteria1719Open in IMG/M
3300027826|Ga0209060_10000025All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae511435Open in IMG/M
3300027869|Ga0209579_10342580All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium808Open in IMG/M
3300027905|Ga0209415_10206830All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1842Open in IMG/M
3300027908|Ga0209006_10663673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300027908|Ga0209006_10853793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium734Open in IMG/M
3300027911|Ga0209698_11040078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300027986|Ga0209168_10025412All Organisms → cellular organisms → Bacteria3306Open in IMG/M
3300028766|Ga0302269_1125828All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300028800|Ga0265338_10791082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300029883|Ga0311327_10303127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1038Open in IMG/M
3300029917|Ga0311326_10132957All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1350Open in IMG/M
3300029943|Ga0311340_10007935All Organisms → cellular organisms → Bacteria13943Open in IMG/M
3300029951|Ga0311371_10119536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella4130Open in IMG/M
3300030044|Ga0302281_10108251All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1272Open in IMG/M
3300030399|Ga0311353_10012972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium9667Open in IMG/M
3300030520|Ga0311372_10193947All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella3411Open in IMG/M
3300030580|Ga0311355_10119307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2894Open in IMG/M
3300030618|Ga0311354_10018595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella8650Open in IMG/M
3300030687|Ga0302309_10500563All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300030906|Ga0302314_11981558All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300031231|Ga0170824_127021361All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300031234|Ga0302325_10067743All Organisms → cellular organisms → Bacteria6933Open in IMG/M
3300031524|Ga0302320_11969238All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300031525|Ga0302326_10475772All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1904Open in IMG/M
3300031718|Ga0307474_10266653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1314Open in IMG/M
3300031720|Ga0307469_11298679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300031813|Ga0316217_10084471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1514Open in IMG/M
3300031884|Ga0316220_1109683All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1033Open in IMG/M
3300031912|Ga0306921_10731865All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1135Open in IMG/M
3300031938|Ga0308175_100617732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1168Open in IMG/M
3300031941|Ga0310912_10848721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300031942|Ga0310916_10361021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1234Open in IMG/M
3300031954|Ga0306926_10184101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2591Open in IMG/M
3300032076|Ga0306924_10520576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1353Open in IMG/M
3300032783|Ga0335079_11264719All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300032829|Ga0335070_10011761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis10223Open in IMG/M
3300032895|Ga0335074_10227936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2226Open in IMG/M
3300032898|Ga0335072_10482094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1293Open in IMG/M
3300033134|Ga0335073_10345962All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1763Open in IMG/M
3300033402|Ga0326728_10509893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium974Open in IMG/M
3300033561|Ga0371490_1024092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2016Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland13.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.72%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.52%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.14%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.45%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.45%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.76%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.76%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.07%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.38%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.38%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.38%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.38%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.38%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.38%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.38%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.69%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.69%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.69%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.69%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022850Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 1-5EnvironmentalOpen in IMG/M
3300024049Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028766Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030687Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300031884Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1054519313300001593Forest SoilMNRSLAFAALLFLLNPLVICQTPYHGPDCSTLKYSRHKVSCLCGKVQVCSGDICGRPSNYDLDDDITVELRDKAGTTILDSKKVIAETNEKEGTTQVGTKVSYKTTERTFCFEGKGDGDYLLAFVLYKNGVPQPAVKFP
JGIcombinedJ26739_10016615623300002245Forest SoilLFMLSVTAISQAPPHGPDCSTLKYKRRKVSCLCGTVEVCAGDICGDPSAYSLDEEIIVQLRSKSGTTLESKKVVVEARDRECTTSIGVKVSCPTTERAFCFEGKPHGHYELAFVLSKNGIPQPAIKFPTKYSPTRHKSCDAVYMVQPICPTAERNWR*
JGIcombinedJ26739_10049063923300002245Forest SoilMITRKVLSVNCFLRITFVLFILNALVFCQTPYHVSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNKAGTTILDSKKVAVEKRKRECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFVISKNGVPQPAVKFPTNYSRKRNQSCNSVYMVEPSCPTAVRSWR*
JGIcombinedJ26739_10089190413300002245Forest SoilDRSALKIEGSSAIACWIHXPNASRVVXVNRRLTLTALLLLLSPIAVCQSSSQTLDCSTLKYSRHKVSCLCGTVAVCAGDICGRPSDYGLDDDIVVELRDKGGTTLDTQKVVVETREMQGTTQGGSKTSYKQTDRRFCFEGKRDGDYLLAFILHKNGIAQPAVIVPRNYSHKRSKTCDSVYMVEPLCPK*
Ga0062385_1002263723300004080Bog Forest SoilMLILPQVVLCQPQSHASDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDDDIAVELRDKSGMTLDTQKVKVETSEKQGTTQDGTKASYRQTERRFCFQSKRDGDYLLAFVLHKKGVSQPAVIFPTNYSHKRGKPCDSVYMVEPLCPR*
Ga0062384_10074384523300004082Bog Forest SoilMLNAFVFCQSPYQGSDCSTLKYKRHKVSCLCGTVQVCSGDVCGRPSDYDLDDDITVQLRNKAGTTILDSKKVVVEKRERECTTQIGTKVSCPTAERTFCFDGKGDGDYQLAFIVSKKGVPQPAVKFPTNYSGKRSKSCNSVYMVEPSCPTVRSWR
Ga0062387_10128301613300004091Bog Forest SoilRKVLAVNRFLRISSLLFMLNAFVFCQSPYQGSDCSTLKYKRHKVSCLCGTVQVCSGDVCGRPSDYDLDDDITVQLRNKAGTTILDSKKVVVEKRERECTTQIGTKVSCPTAERTFCFDGKGDGDYQLAFIVSKKGVPQPAVKFPTNYSGKRSKSCNSVYMVEPSCPTVRSWR*
Ga0062388_10049628623300004635Bog Forest SoilMLNAFVFCQSPYQGSDCSTLKYKRHKVSCLCGTVQVCSGDVCGRPSDYDLDDDITVQLRNKAGTTILDSKKVVVEKRERECTTQIGTKVSCPTAERTFCFDGKGDGDYQLAFIVSKKGVPQPAVKFPTNYSGKRSKSCNSVYMVEPSCPTVRSWR*
Ga0066680_1064033913300005174SoilVIGRKVLSVNRFLRITFLLFMLDAFVFCQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNYSRKRNQSCNSVYMVEPSCPTAVRSW*
Ga0066690_1036385713300005177SoilLSVNRFLRITFLLFMLDAFVFCQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNYSRKRNQSCNSVYMVEPSCPTAVRS*
Ga0066684_1104418913300005179SoilVIGRKVLSVNRFLRITFLLFMLDAFVFCQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNYS
Ga0066676_1078207513300005186SoilVIGRKVLSVNRFLRITFLLFMLDAFVFCQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNYSRK
Ga0070714_10047815623300005435Agricultural SoilMLVLTPIAVCQMHTHASDCSTLKYSRHKVSCLCGTVQVCSGDICGRPSDYDLDDDMAVELRDKSGTTLDTQKVVVETREKHGTTQDGTKTSYKQTERKFCFEGKRDGDYLLAFVLQKKGIPQPAVIFPTKYSHKGSKPCDSVYMVEPLCPR*
Ga0070713_10020575633300005436Corn, Switchgrass And Miscanthus RhizosphereMLVLTPIAVCQMHTHASDCSTLKYSRHKVSCLCGTVQVCSGDICGRPSDYDLDDDMAVELRDKSGTTLDTQKVVVETLEKYRTTQDGTKTSYKQTERKFCFEGKRDGDYLLAFVLQKKGIPQPAVIFPTKYSHKGSKPCDSVYMVEPLCPR*
Ga0066686_1006845013300005446SoilMLDAFVFCQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNY
Ga0066689_1007843323300005447SoilVNRTLALIALLLLLTPVVVCQTQSHASDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDEDIAVELRDKSGTTLDAQKVVVETREKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFALHKKGVPQPAVIFPTNYSHKRSKPCDSVYMVELLCPR*
Ga0073909_1007591933300005526Surface SoilVARVNRTLTLTALLLLLTPVVVCQTQSHASDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDDDIAVELRDRSGTTLATQKVVVETSEKHGTTQDGTKTSYKQTERRFCFEGKGDGDYLLAFVLHKKGVSQPAVIFPTNYSHKRSKPCDSMYVVEPLCPR*
Ga0070734_100000113903300005533Surface SoilLDAIPNGFKVAPVNRTLTHAALLLLVSPVMVCQTQGHAPDCSTLKYSRHKVSCLCGTVQVCSGDICGPPSVYELDDDIAVELRAKNGTILDTQKLVVETREMQGATQDGTKTSYKQTERRFCFEGKQDGDYVLAFVLHKKGIPQPAVIFPTNYAHKRRKSCDSIYMVEPLCPR*
Ga0070735_1000312163300005534Surface SoilMSRRRLGTGGGAGRCNLGWEVFGGTIRPRALCTSSRGFTSGLGVKCSSVNCFLVSSTLLFLLNALALCQTPNLGPDCSTLKHSRHKVSCLCGKVDVCAGDICGPPSTYGLDDDITVELRDKAGRTVLDSKKVIEETRKNEGTTQAGTRTSYKTTERRFCFEGKGDGDYLLEFIFFKNGVPQLAVKFPTNYSRKRRKSCDSVYMVDPTCPK*
Ga0066697_1023470013300005540SoilVNRTLALIALLLPLTPVVVCQTQSHASDCSTLKYLRHKVSCLCGTVQVCSGDISGRPSDYELDEDIAVELRDKSGTTLDAQKVVVETREKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFALHKKGVPQPAVIFPTNYSHKRSKPCDSVYMVELLCPR*
Ga0066701_1019768133300005552SoilVNRTLALIALLLLLTPVVVCQTQSHTSDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDEDIAVELRDKSGTTLDAQKVVVETREKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFALHKKGVPQPAVIFPTNYSHKRSKPCDSVYMVELLCPR*
Ga0066701_1030041323300005552SoilRKVLSVNRFLRITFLLFMLDAFVFCQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNYSRKRNQSCNSVYMVEPSCPTAVRSW*
Ga0066700_1024304813300005559SoilWIQVPNGCKVAPVNRTLALIALLLLLTPVVVCQTQSHASDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDEDIAVELRDKSGTTLDAQKVVVETREKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFALHKKGVPQPAVIFPTNYSHKRSKPCDSVYMVELLCPR*
Ga0066705_1075944513300005569SoilHAVIGRKVLSVNRFLRITFLLFMLDAFVFCQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNYSRKRNQSCNSVYMVEPSCPTAVRSW*
Ga0066691_1081028813300005586SoilSDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDEDIAVELRDKSGTTLDAQKVVVETREKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFALHKKGVPQPAVIFPTNYSHKRSKPCDSVYMVELLCPR*
Ga0070761_1012233833300005591SoilNGYKLAPVNRTLTLTTLLLFLGPIVVCQTPSHVSNCSSLKYLRHRVSCLCGTVQVCSGDICLRPSDYNLDDDIGVELRDKTGTTLDRQKVVVETRDKQGMTQDETKTSYRQTERRFCFEGKRDGDYLLAFVFHKNGVPQPAVVFPTNYSHKRGEPCASVYMVEPICPK*
Ga0070717_1014095423300006028Corn, Switchgrass And Miscanthus RhizosphereMLVLTPIAVCQMHTHASDCSTLKYSRHKVSCLCGTVQVCSGDICGRPSDYDLDDDMAVELRDKSGTTLDTQKVVVETLEKYRTTQDGTKTSYKQTERKFCFEGKRDGDYLLAFVLQKKGIPQPALIFPTKYSHKGSKPCDSVYMVEPLCPR*
Ga0070717_1204555713300006028Corn, Switchgrass And Miscanthus RhizospherePLPNGCKVAAVNRTLTLAALLLLLTSVVVCQTQSHASDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDDDIAVYLRDKSGTTLDTKKVVVETREMQGTTQDGVKTSNKQTERRFCFEGKRDGDYLLAFVLRKKGIPQPAVIFPTKYSHKPSKPCDAVYMVEPLCPR
Ga0075029_10065774513300006052WatershedsLTVNRSLTITAVLLVVSPLLVSQTPSNGLDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYGLDDDITVQLRNKAGTTILDSKKVVVEKRERECTTQVGTKVPCPTTERRFCFDGKRDGDYQLAFIVFKNGVPQSAIKFPTNYSHKRRKSCDSIYMVEPSCP*
Ga0075029_10077803923300006052WatershedsMDCLQSIRGFARGLGVKCLSVTPSLFGTALLFLFNPFVLCQTLNPGPDCSTLKYSRHKVSCLCGKVDVCVGDICGAPSDYSLDDDITVELRDKAGKAILDSKKAVVETHENQGTTQAGTKTTYRVTERTFCFEGKADGDYLLAFVLYKNGVPQPAIKFPTNYARKRHKFCDSV
Ga0075015_10083724413300006102WatershedsRKAGMAGQRALSPALNSYPWIHAVIRSKVPTMNRLLTVTLLLFVLNLFLVCQTPHNGSDCSTLKHLRHKVSCLCGTVDVCGGDICGPPSAYDLDDDITVELRDKVGTAIIDSKKVTVETREEAGTTQVGTTISYKRTERKFCFHGKRDGDYVLAFVFRKNGAPQPAVKFPTNYSSKRRKSCDSV
Ga0075030_10029983023300006162WatershedsQIPNWCKVAPVNRTLTLPALLLLLSPIVVCQTPSHASNCSTLKYLRHKVSCLCGTVQVCSGDICLRPSDYKLDDDIGVELRDKTGTTLDAQKVVVETRDKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFVLHKNGVPQPAVVFPTNYSHKRSKPCDSVYMVEPICPK*
Ga0075521_1032970913300006642Arctic Peat SoilVLTVNRSLTLSGLLFLLSPLVVCQTLQHGPDCSTLKYSGHKVSCLCGTVQVCSGDLCGPLSHYDLDDDITVELQDKAGTTILGSKKVIAETREKEGTTQVGTRVSYKTTERTFCFEGKRDGGYLLSFILYKNGVPQPAVKFPTNYSRKRRKPCNSVYMVEPTCPR*
Ga0066665_1011018923300006796SoilVARVNRTLALIALLLLLTPVVVCQTQSHASDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDEDIAVELRDKSGTTLDAQKVVVETREKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFALHKKGVPQPAVIFPTNYSHKRSKPCDSVYMVELLCPR*
Ga0111539_1183725513300009094Populus RhizosphereVAPVNRTLTLTAVLLLFTPVVVCQTQFLASDCSTLKYFRHKVSCLCGTVQVCSGDICLRPSDYELDDDIAVELRDKSGTTLDTQKVVLETSEKQGTTQDGTKTSYKQTDRRFCFEGKGDGNYLLAFVLHKKGIAQPAVIFPTNYSHKRSKLCDAVYMVEPLCPK*
Ga0116124_123575513300009634PeatlandTPIESGRAVRVMGCSPQLAWIHAVIGSKVLTVNRSLAITSLLFVLSPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGDGNYVLAFVMHKHGVPQPAVKF
Ga0116122_119950413300009639PeatlandVNRFLRISALLFMLNAPAISQNPYHGSDCSTLKYARHKVSCLCGTVQVCSGDLCGRPSDYGLDEDITVQLRSKTGATILDSKKAVVETRDRECTTQVGTKVSCPTTERTFCFDGKRDGDYELAFVLSKNGVPQPAIKFPTNYSHKRHKSCNSIYMVEPSCPTTERSWR*
Ga0116120_104198033300009641PeatlandVIGRKVLTVNRSLTITALIFVLNSFVVCQTPSDGSDCSTLKYLRHKVSCLCGTVQVCSGDICGRPESYDLDDDITVELRDKEGKAILDSKKVIVETREKEGTNQAGTKVSYKTTERTFCFDGKRDGDYSLAFILYKNGVPQPAIRFPTNYSHKRSKGCDSIYMLEPVCPR*
Ga0116106_105758133300009645PeatlandMLNAPAISQNPYHGSDCSTLKYARHKVSCLCGTVQVCSGDLCGRPSDYGLDEDITVQLRSKTGATILDSKKAVVETRDRECTTQVGTKVSCPTTERTFCFDGKRDGDYELAFVLSKNGVPQPAIKFPTNYSHKRHKSCNSIYMVEPSCPTTERSWR*
Ga0116101_103537813300009759PeatlandLTVNRSLAITSLLFMLNPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGDGNYVLAFVMHKHGVPQPAVKFPTNYSSKRRKACDSVYMVEWICPK*
Ga0116134_108965323300009764PeatlandMLILLAPIAGCQTPYRASDCSTLKYARHKVSCLCGSVEICSGDICGRPSDYDLDDDITVELRDKSGKTIDTQKAAIEVSEEQGTRQDGTITSYKRTERRFSFEGKGDGHYSLAFILHKNDVSQPAVIFPASYSHKRKKLGTTVYMVEPICPK*
Ga0136449_10048264823300010379Peatlands SoilMFTTLEHGFIAAIKRKFLGVNRFLTVAALLLLHSAFVVGQTDCGATDCSTLKYLQHKVSCLCGDVQVCSGDICGRPSAYNLDDDIRVELRDKAGTTILDSKKVVPEIRHRECTTAVGTEISCDTTERTFCFEGKRDGDYQLAFILFKDGVPQPAVKFPTNYSRKRRQSCNSVYMVEATCPR*
Ga0137381_1104647013300012207Vadose Zone SoilVIGRKVLSVNRFLRITFLLFMLDAFVFCQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNYSRKRNQSCNSVYMVEPSCPTAVR
Ga0137372_1015398333300012350Vadose Zone SoilMISARLFEKWEWIREPFDDKVSAMNVSLTTATLFFAFCRFAFSQTATPPPDCSTLKYLRHKVSCLCGTVQICSGDICGNPSSYNLDDDITVELRDKGGMTILDSKKVVNETRETKCTTQVGMKVPCNTRERRFCFEGKHDGNYQLAFILFKNGVPQPAIKFPTNYSRKRRKLCDSVYMVEPTCPK*
Ga0137373_1108025913300012532Vadose Zone SoilMISARMFEKWEWIREPFDDKVSAMNVSLTTATLFFAFCRFAFSQTATPPPDCSTLKYLRHKVSCLWGTVQICSGDICGNPSSYNLDDDITVELRDKGGMTILDSKKVVNETRETKCTTQVGMKVPCNTRERRFCFEGKHDGNYQLAFILFKNGVPQPAIKFPTNYSRKRRKLCDSV
Ga0181538_1020673713300014162BogTPHSGSNCSTLKYLRHKVSCLCGAVDVCTGDICGSPSNYDLDDDITVELRDKAGTMIIDSKKVIVETREEEGTTQVGTKVSYKRTERKFCFDGKHDGDYVLAFVLRKNGVPQPAVKFPTSYSSKRRKPCDSVYMVEPICPK*
Ga0181531_1109095813300014169BogAVSQADKPGTDCSTLKYSRHKVSCLCGAVQVCSGDTCGRPSDYDLDDDITVELRDKAGRTILDSKKATVETRDKMGTRQDGTKVSYKTKDRMFCFEGKDSGDYVFAFVLYKNGVPQPAVKFPTNYSPKRSKPCDAIYMVEPICPR*
Ga0182039_1074044813300016422SoilAPSHASDCSSLKYLRHKVSCLCGSVAVCSGDICGSPSTYGLDDDIVVELRDKRGTTLDTQMAALETREMQGTTQEGSKTTYKQTERRFCFDGKRDGEYQLAFVLHKNCIAQPAVVFPTNYSHKRSKPCDSMYMVEPLCPK
Ga0187848_1047428513300017935PeatlandMLNAPAISQNPYHGSDCSTLKYARHKVSCLCGTVQVCSGDLCGRPSDYGLDEDITVQLRSKTGATILDSKKAVVETRDRECTTQVGTKVSCPTTERTFCFDGKRDGDYELAFVLSKNGVPQPAIKFPTNYSHK
Ga0187775_1010687413300017939Tropical PeatlandMTIKGKVLTMNGALITTTLLSLLSPFVVCQNASPASDCSTLKYSRHKVSCLCGKVQVCSGDLCGAPLDYNLDDDIRVELRDKAGTTVLDFKKVVVEAGERECTTAVGIKFSCDTSERTFCFEGKRDGDYQLAFVLFKNGVPQPAVKFPTNYSRKRSKRCNSVYMVEPSCPR
Ga0187853_1019024423300017940PeatlandMGCSPQLAWIHAVIGSKVLTVNRSLAITSLLFVLNPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGDGNYVLAFVMHKHGVPQPAVKFPTNYSSKRRKACDSVYMVEWICPK
Ga0187853_1028526413300017940PeatlandVNRFLRISALLFMLNAPAISQNPYHGSDCSTLKYARHKVSCLCGTVQVCSGDLCGRPSDYGLDEDITVQLRSKTGATILDSKKAVVETRDRECTTQVGTKVSCPTTERTFCFDGKRDGDYELAFVLSKNGVPQPAIKFPTNYSHKRHKSCNSIYMVEPSCPTTERSWR
Ga0187819_1011581023300017943Freshwater SedimentMAGFQQVWLRAAFPGKVFAVNRSLTLTALLFLVCPFVVCQTVPKVPDCSTLKYSGHKVSCLCGRVDICVGDLCGAPQNYNLDDDITVELRDKAGTTVLDSKKVVVETHERECTTQIGIRVSCNTKERSFCFEGKRDGHYQLAFILFKNRVPQPAVKFPTNYSRKRQKSCDSVYMVEPTCP
Ga0187879_1002314833300017946PeatlandMLNAPAISQNPYHGSDCSTLKYARHKVSCLCGTVQVCSGDLCGRPSDYGLDEDITVQLRSKTGATILDSKKAVVETRDRECTTQVGTKVSCPTTERTFCFDGKRDGDYELAFVLSKNGVPQPAIKFPTNYSHKRHKSCNSIYMVEPSCPTTERSWR
Ga0187847_1006996523300017948PeatlandSFVVCQTPSDGSDCSTLKYLRHKVSCLCGTVQVCSGDICGRPESYDLDDDITVELRDKEGKAILDSKKVIVETREKEGTNQAGTKVSYKTTERTFCFDGKRDGDYSLAFILYKNGVPQPAIRFPTNYSHKRSKGCDSIYMLEPVCPR
Ga0187847_1018803813300017948PeatlandMETQSEQEYRGSVNRTLTHMALLVLLAPIAVCQTSYRAPDCSTLKYFRHKHSCLCGTVESCSGDICLSPSHWELGDDITVELRDKHGTTLDTQKTVVETSEEQGETQDGTKISIKLAERRFSFEGQRDGDYLLAFILHKNGVPQPAVIFPTRYTHKGNKPGSSVYMLEPSCPR
Ga0187817_1007936323300017955Freshwater SedimentLIGRTLLAVKPLLTIGAALLVATPLVVSQTPSNGSDCSTLKYLRHKVSCLCGTVQVCSGDICGRPATYDLDDDITVELRDKAGTTILESKKVIVETREKTGTTQVGTKVLYKATERTFCFEGKRDGDYQLAFILYKNGVPQPAIKFPTNYSHKRRKSCDSIYMVEPTCPK
Ga0187778_1003991333300017961Tropical PeatlandVAAANSSSGFIIAIKGKVLTMNGALATAALLFLLAPSVVCQSASPASDCSTLKYSRRKVSCLCGRVQVCSGDLCGRPSDYKLDDDIRVELRDKAGTTILDFKKVIVEARERQCATAVGINFSCNTTERTFCFKAKRDGDYQLAFILFKNGVPQPAVKFPTKYSHKQSKPCNSVYSVETTCPR
Ga0187776_1005138723300017966Tropical PeatlandVLIMNGALTTTTLLFLLSPFVVCQNASPASDCSTLKYSRHKVSCLCGKVQVCSGDLCGGPLDYNLDDDIRVELRDKAGTTVLDFKKVVVEVGDRECTTAVGISFSCDTSERTFCFEGKRDGDYQLAFVLFKNGVPQPAVKFPTNYSRKRSKHCNSVYMVEPSCPR
Ga0187782_1119998913300017975Tropical PeatlandSDCSTLKYLRHKVSCLCGIVNVCSGDLCGRPSDYGLDDDIVVELRDKSGTTLDTQKAVLETREMQGTTQDGTKTSYKQTERRFCFEGKRDGDYRLAFVLHKNGAAQPAVIFPTSYSHKRRKVCDSVYMVEPLCPK
Ga0181520_1061589113300017988BogNVRIADNTLKILGNMGHHRMETQSEQEYRGSVNRTLTHIALLVLLAPIAVCQTSYRAPDCSTLKYFRHKHSCLCGTVEICSGDICLSPSHWELGDDITVELRDKHGTTLDTQKTVVETSEEQGETQDGTKISIKLAERRFSFEGQRDGDYLLAFILHKNGVPQPAVIFPTRYTHKGNKPGSSVYMLEPSCPR
Ga0187891_131540713300017996PeatlandIHAVIGSKVLTVNRSLAITSLLFVLNPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGDGNYVLAFVMHKHGVPQPAVKFPTNYSSKRRKACDSVYMVE
Ga0187884_1001181553300018009PeatlandMGCSPQLAWIHAVIGSKVLTVNRSLAITSLLFVLSPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGDGNYVLAFVMHKHGVPQPAVKFPTNYSSKRRKACDSVYMVEWICPK
Ga0187857_1013022523300018026PeatlandVLAVNRFLRISALLFMLNAPAISQNPYHGSDCSTLKYARHKVSCLCGTVQVCSGDLCGRPSDYGLDEDITVQLRSKTGATILDSKKAVVETRDRECTTQVGTKVSCPTTERTFCFDGKRDGDYELAFVLSKNGVPQPAIKFPTNYSHKRHKSCNSIYMVEPSCPTTERSWR
Ga0187863_1001247323300018034PeatlandVNRTLTHIALLVLLAPIAVCQTSYRAPDCSTLKYFRHKHSCLCGTVEICSGDICLSPSHWELGDDITVELRDKHGTTLDTQKTVVETSEEQGETQDGTKISIKLAERRFSFEGQRDGDYLLAFILHKNGVPQPAVIFPTRYTHKGNKPGSSVYMLEPSCPR
Ga0187875_10000410353300018035PeatlandVIGRKVLTVNRSLTITALIFVLNSFVVCQTPSDGSDCSTLKYLRHKVSCLCGTVQVCSGDICGRPESYDLDDDITVELRDKEGKAILDSKKVIVETREKEGTNQAGTKVSYKTTERTFCFDGKRDGDYSLAFILYKNGVPQPAIRFPTNYSHKRSKGCDSIYMLEPVCPR
Ga0187875_10000759203300018035PeatlandVIGSKVLTVNRSLAITSLLFVLNPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGDGNYVLAFVMHKHGVPQPAVKFPTNYSSKRRKACDSVYMVEWICPK
Ga0187883_1019187213300018037PeatlandLTVNRSLTITALIFVLNSFVVCQTPSDGSDCSTLKYLRHKVSCLCGTVQVCSGDICGRPESYDLDDDITVELRDKEGKAILDSKKVIVETREKEGTNQAGTKVSYKTTERTFCFDGKRDGDYSLAFILYKNGVPQPAIRFPTNYSHKRSKGCDSIYMLEPVCPR
Ga0187855_1001368423300018038PeatlandVNRTLTHMALLVLLAPIAVCQTSYRAPDCSTLKYFRHKHSCLCGTVEICSGDICLSPSHWELGDDITVELRDKHGTTLDTQKTVVETSEEQGETQDGTKISIKLAERRFSFEGQRDGDYLLAFILHKNGVPQPAVIFPTRYTHKGNKPGSSVYMLEPSCPR
Ga0187855_1001713813300018038PeatlandIHAVIGSKVLTVNRSLAITSLLFVLNPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGDGNYVLAFVMHKHGVPQPAVKFPTNYSSKRRKACDSVYMVEWICPK
Ga0187855_1047595113300018038PeatlandTALTLFLSPVVVCQSQSHGSDCSTLKYLRHKVSCLCGTVQVCSGNICGRPSTFELDDDIAVELRDKSGTTLDTQKVRVETSEKQGTTQGGTKTSYQQTERRFRFEGKRDGDYSLAFVLHKNGVSQPAVIFPTNYSHKRSTPCDSVYMVEPLCPQ
Ga0187890_1002648713300018044PeatlandPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGDGNYVLAFVMHKHGVPQPAVKFPTNYSSKRRKACDSVYMVEWICPK
Ga0187859_1001460013300018047PeatlandKVLTVNRSLTITALIFVLNSFVVCQTPSDGSDCSTLKYLRHKVSCLCGTVQVCSGDICGRPESYDLDDDITVELRDKEGKAILDSKKVIVETREKEGTNQAGTKVSYKTTERTFCFDGKRDGDYSLAFILYKNGVPQPAIRFPTNYSHKRSKGCDSIYMLEPVCPR
Ga0187859_1045545613300018047PeatlandEQEYRGSVNRTLTHMALLVLLAPIAVCQTSYRAPDCSTLKYFRHKHSCLCGTVEICSGDICLSPSHWELGDDITVELRDKHGTTLDTQKTVVETSEEQGETQDGTKISIKLAERRFSFEGHRDGDYLLAFILHKNGVPQPAVIFPTRYTHKGNKPGSSVYMLEPSCPR
Ga0187859_1073358313300018047PeatlandNRTLTRSALPFIRGSIAVCQTASQASDCSTLKYFRHKVSCLCGTVEVCSGDICNRPSVYGLDDEIIVELREKNGTILDSKRVVVETREEQGTLQDRTRTSYKKTERRFCFEGKRDGDYLLAFVLHKNGVPQPAVIFPTNYSHKRKKACDSVYMVEPICPR
Ga0187784_1111382413300018062Tropical PeatlandPPNTSDCSTLKYLRHKVSCLCGIVNVCSGDLCGRPSDYGLDDDIVVELRDKSGTTLDTQKAVLETREMQGTTQDGTKTSYKQTERRFCFEGKRDGDYRLAFVLHKNGAAQPAVIFPTSYSHKRRKVCDSVYMVEPLCPK
Ga0187773_1001735013300018064Tropical PeatlandMAIKGKVLFMNGALTTTTLLFLLSPFVVCQNASPASDCSTLKYSRHKVSCLCGKVQVCSGDLCGAPLDYNLDDDIRVELRDKAGTTVLDFKKVVVEAGERECTTAVGIKFSCDTSERTFCFEGKRDGDYQLAFVLFKNGVPQPAVKFPTNYSRKRSKRCNSVYMVEPSCPR
Ga0187771_1143139823300018088Tropical PeatlandLTHVTLLLLLSPIAVCQTSYPASDCSTLRGVRHKVSCLRGTVDICSGDICSNPTTYELDDDIVVELRDKRGTTLDAQKVVVETIEEHGITQSGAKTSIKLKVRRFSFEGKRDGNYQLAFILHKNGTPQPAMIFPVNYSHKGNNRGEPTYMVEPSCPK
Ga0187774_1012032213300018089Tropical PeatlandMTIKGKVLTMNGALITTTLLSLLSPFVVCQNASPASDCSTLKYSRHKVSCLCGKVQVCSGDLCGAPLDYNLDDDIRVELRDKAGTTVLDFKKAVVEAGERECTTAVGIKFSCDTSERTFCFEGKRDGDYQLAFVLFKNGVPQPAVKFPTNYSRKRSKRCNSVYMVEPSCPR
Ga0066667_1108549913300018433Grasslands SoilDRTLALIALLLLLTPVVVCQTQSHTSDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDEDIAVELRDKSGTTLDAQKVVVETREKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFALHKKGVPQPAVIFPTNYSHKRSKPCDSVYMVELLCPR
Ga0066662_1018736023300018468Grasslands SoilVVVCQTQSHTSDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDEDIAVELRDKSGTTLDAQKVVVETREKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFALHKKGVPQPAVIFPTNYSHKRSKPCDSVYMVELLCPR
Ga0066669_1019497913300018482Grasslands SoilVIGRKVLSVNRFLRITFLLFMLDAFVFCQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNYSRKRNQSCNSVYMVEPSCPTAVRSW
Ga0182022_126180623300019785FenVNYILTHMALLVLVTPIAVCQTSFRASDCSNLKYVRHKSSCLCGIVQICSGDICGNPLDYELDDDITVELRDKSGMTLDTQKVVVEMSEEQGKTLDGRRISYKHSEREFSFTGKRDGDYLLAFILHKGGDSQSAIVFPTNYSHKRNRLGNAVYMLEPSCPK
Ga0193723_105940613300019879SoilMKGSLIIPSLLLVLRPFAVCQTAPTPSDCSTLKYSRHKVSCLCGTVQVCSGDICGRPSDYNLDDDITVQLRDKSGTAILDSKNVVVEMRDRECTTQAGTKVSCNTTQRTFCFKDKPDGDYQLAFILFKNGAPQPAVKFPANYQARNRRGCRTFCKASAGPRCQR
Ga0193733_115590113300020022SoilMKGSLIIPSLLLVLRPFAVCQTAPTPSDCSTLKYSRHKVSCLCGTVQVCSGDICGRPSDYNLDDDITVQLRDKSGTAILDSKNVVVEMRDRECTTQAGTKVSCNTTQRTFCFKDKPDGDYQLAFILFKNGAPQPAVKFPANYQARNRRGCRTF
Ga0179596_1003525523300021086Vadose Zone SoilVHRSPTTIALLFLLNAHAVCQAPDHGPDCSTLKYLRHKVSCLCGTVEVCSGDLCNSPSGYDLDDDITVELRDKAGTIVDSKKVIVETREKEAATQVGTKVSYKTTERMFCFGGKRDGNYVLAFVLYKKGVSQPAIKFPTNYSRNRRKACDSVYMVEHACPK
Ga0210405_10001274213300021171SoilLQQLRWTEVPDDRKLVPVNRSRTITGLLLLLSSVAVCQTAPHTSDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYDLDDDITVELREKRGSTLDSKKVVIETRERQGTTQGGTKTSYKETERRFCFEGKRDGDYLLAFVLHKNGVSQPAVIFPTNYSHKRSKPCDSVYMVEPSCPK
Ga0210385_1001219423300021402SoilVAPVNRTLTLTAFLLLVTPVVVCQAQSHISDCSTLKYSRRKVSCLCGTVQVCSGDICGSPSAYELDDDIAVELRDKSGTTLDTQKVVLETVEKQGTTQDGTKTSYKQTERRFCFEGKEGGNYLLAFVLHKKGISQPAVIFPTNYSHKRSKPCDAVYMVEPLCPR
Ga0210394_100000081763300021420SoilVIGRKVLIVKRSLTITALLFLLNPLVVSQTPSHGTDCPTLKYSRRHKTSCLCGTVEVCSGDICGRPSDYGLDDDITVELRDKAGATILDSKKAVVEIREKEGTTQDGTKASFKTKDRRFCFEGQADGDYVFAFVLYKNSVPQPAVKFPQNYSRKRRKSCDATYMVEPICPK
Ga0210402_1006663523300021478SoilVIRRRVLIVKRSLAITASLFLLRLLVVAQTPSHGTDCSTLTHPRRHKTSCLCGTVEVCSGDICLRPADYGLDDDITVELRDKAGRTILDSKNVVVETHEKEGTTQDGTKVSYKTNDRMFCFEGKGDGDYVFAFVLYKDGVPQPAVKFHQSYSHKRSKPCDATFMVEPMCPK
Ga0242661_114442013300022717SoilGALLFLLNPLVVSQTPSHGTDCSTLKYSRRHKTSCLCGTVEVCSGDLCGRPSDYGLDDDITVELRDKAGTTTLVSKKAVVEIREKEGTTQDGTKVPLKTKDRMFCFEGQADGDYVFAFVLYKNGVPQPAVKFPQNYSRKRRKPCDAIYMVEPICPK
Ga0224552_104426213300022850SoilAITSLLFVLNPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGDGNYVLAFVMHKHGVPQPAVKFPTNYSSKRRKACDSVYMVEWICPK
Ga0233359_102001413300024049SoilRKVLAVSRLLRISALLFILNAPAISQNPYHGSDCSTLKYARHKVSCLCGTVQVCSGDVCARPSDYGLDEDITVQLRSNTGTALLESKKVAVETRERECTTQVGTKVSCPTTERTFCFDGKRNGDYELVFVLSKNGVPQPAIKFPTNYSPKRRKSCNSIYMVEPSCPATERSWR
Ga0208188_112047413300025507PeatlandMLNAPAISQNPYHGSDCSTLKYARHKVSCLCGTVQVCSGDLCGRPSDYGLDEDITVQLRSKTGATILDSKKAVVETRDRECTTQVGTKVSCPTTERTFCFDGKRDGDYELAFVLSKNGVPQPAIKFPTNYSHKRHKSCNSIYMVE
Ga0208714_105122713300025527Arctic Peat SoilVLTVNRSLTLSGLLFLLSPLVVCQTLQHGPDCSTLKYSGHKVSCLCGTVQVCSGDLCGPLSHYDLDDDITVELQDKAGTTILDSKKVIAETREKEGTTQVGTRVSYKTTERTFCFEGKRDGGYLLSFILYKNGVPQPAVKFPTNYSRKRRKPCNSVYMVEPTCPR
Ga0207693_1056294023300025915Corn, Switchgrass And Miscanthus RhizosphereVIARSRQSSWIQIPNGCKVAPVNCTLTALMLVLTPIAVCQMHTHASDCSTLKYSRHKVSCLCGTVQVCSGDICGRPSDYELDDDIAVELRDRSGTTLATQKVVVETSEKHGTTQDGTKTSYKQTERRFCFEGKGDGDYLLAFVLHKKGVSQPAVIFPTNYSHKRSKPCDSMYVVEPLCPR
Ga0207663_1120498013300025916Corn, Switchgrass And Miscanthus RhizosphereQPSWIQIPNGCKVARVNRTLTLTALLLLLTPVVVCQTQSHASDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDDDIAVELRDRSGTTLATQKVVVETSEKHGTTQDGTKTSYKQTERRFCFEGKGDGDYLLAFVLHKKGVSQPAVIFPTNYSHKRSKPCDSMYVVEPLCPR
Ga0207664_1111601813300025929Agricultural SoilVTGVTSPFHSKPSLRGSKRVIARSRQSSWIQIPNGCKVAPVNCTLTALMLVLTPIAVCQMHTHASDCSTLKYSRHKVSCLCGTVQVCSGDICGRPSDYDLDDDMAVELRDKSGTTLDTQKVVVETREKHGTTQDGTKTSYKQTERKFCFEGKRDGDYLLAFVLQKKGIPQPAVIFPTKYSHKGSKPCDSVYMVEPLCPR
Ga0209890_1001144823300026291SoilVNCTPTQIVLLLLLSPIAVCQTSHSASDCSTLKYLRHKVSCLCGTVQICSGDICGRPSDYDLDDNITVELRNKRGTTLDTQKVVVEMIEEQGTTQDGRRTSFKQAVRRFSFEGKRDGEYLLAFILHKNGIAQPAVIFPTNYSHKRNKPCNSVYMVEPICPR
Ga0209690_113922713300026524SoilRKVLSVNRFLRITFLLFMLDAFVFCQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNYSRKRNQSCNSVYMVEPSCPTAVRSW
Ga0209157_105514313300026537SoilVIGRKVLSVNRFLRITFLLFMLDAFVFCQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNY
Ga0209056_1016380513300026538SoilVAPVNRTLALIALLLPLTPVVVCQTQSHASDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDEDIAVELRDKSGTTLDAQKVVVETREKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFALHKKGVPQPAVIFPTNYSHKRSKPCDSVYMVELLCPR
Ga0209474_1058696613300026550SoilQTRYNGSDCSTLKYARHKVSCLCGTVQVCSGDVCGRPSDYSLDDDITVQLRNRAGTTILDSKKVVVEKRERECTTQVGTKVSCPTTERTFCFDGKGDGDYQLAFIVSKNGVPQPAVKFPTNYSRKRNQSCNSVYMVEPSCPTAVRSW
Ga0209117_102954723300027645Forest SoilMNRSLAFAALLFLLNPLVICQTPYHGPDCSTLKYSRHKVSCLCGKVQVCSGDICGRPSNYDLDDDITVELRDKAGTTILDSKKVIAETNEKEGTTQVGTKVSYKTTERTFCFEGKGDGDYLLAFVLYKNGVPQPAVKFPTNYSHKRRKPCDSVYMVEPTCPR
Ga0209060_10000025123300027826Surface SoilLDAIPNGFKVAPVNRTLTHAALLLLVSPVMVCQTQGHAPDCSTLKYSRHKVSCLCGTVQVCSGDICGPPSVYELDDDIAVELRAKNGTILDTQKLVVETREMQGATQDGTKTSYKQTERRFCFEGKQDGDYVLAFVLHKKGIPQPAVIFPTNYAHKRRKSCDSIYMVEPLCPR
Ga0209579_1034258013300027869Surface SoilVAPVNRTLTLTALLLLLTPVVVCQTQSHASDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDDIAVELRDKSGTTLDTQKVVVETSEKQGTTQDGTKTSYKQTERRFCFEGKGDGDYLLAFVLHKKGVPQPAVIFPTNYSYKRSKPCDSVYMVEPLCAR
Ga0209415_1020683023300027905Peatlands SoilVIGRKVLTVKRSLTTTALLFLFNPLVVCQTPYHGADCSTLKYSRRKVSCLCGTVQVCSGDICGRPSVYGLDDDITVELRRKDGTTILDSKKVVVETREEEGTTQVGTKVSYKKTERKFCFEGKGDGGYQLAFVLYKNGVPQPAVKFPTNYSRKPSKPCNSVYMVEPTCPR
Ga0209006_1066367323300027908Forest SoilLLLSPIAVCQSSSQTLDCSTLKYSRHKVSCLCGTVAVCAGDICGRPSDYGLDDDIVVELRDKGGTTLDTQKVVVETREMQGTTQGGSKTSYKQTDRRFCFEGKRDGDYLLAFILHKNGIAQPAVIVPRNYSHKRSKTCDSVYMVEPLCPK
Ga0209006_1085379323300027908Forest SoilCSTLKYVRHKVSCLCGIVQICSGDICGSPSDYELDDDIVVELRDKSGTTLDTQKVVVEMREEQGTAQDGTKISYKRGERRFSFEEKRDGDYLLAFILHKNGVSLPPVIFPTNYSHKRDKLGNSLYPVEPICPR
Ga0209698_1104007813300027911WatershedsCKVAPVNRTLTLPALLLLLSPIVVCQTPSHASNCSTLKYLRHNVSCLCGTVQVCSGDICGRPSDYELDDDIAVELRDKSGTTLDTQKVVVETRDKQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFVLHKNGVPQPAVVFPTNYSHKRSKPCDSVYMVEPICPK
Ga0209168_1002541223300027986Surface SoilLGVKCSSVNCFLVSSTLLFLLNALALCQTPNLGPDCSTLKHSRHKVSCLCGKVDVCAGDICGPPSTYGLDDDITVELRDKAGRTVLDSKKVIEETRKNEGTTQAGTRTSYKTTERRFCFEGKGDGDYLLEFIFFKNGVPQLAVKFPTNYSRKRRKSCDSVYMVDPTCPK
Ga0302269_112582813300028766BogMGCSPQLAWIHAVIGSKVLTVNRSLAITSLLFVLNPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGDGNYVLAFVMHKHGVPQPAVKFPTNYSSKR
Ga0265338_1079108213300028800RhizosphereTALLLTVMGEVLLLSPFVLSQTPPHGSDCSSLKYLRHKVSCLCGTVQVCSGDICVGPAAFDLDDNITVELRDKSGTTLDTRKAVVETREMQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFVLHKNGDAQPAVIFPTNYSHKRNKACDSMYMVEPVCPK
Ga0311327_1030312723300029883BogDCTSLRYLRHKVSCLCGSVEICSGDICGTPSVYGLDDDITVELRDKSGMTLDTQKVVLEISEKKGTTLDGTKTSFKQSERRFSFEGKRDGNYLLAFTLRKNGVAQPAIVFPTNYSHKRNKPHDSVYMVEPTCPN
Ga0311326_1013295723300029917BogMGCSPQLAWIHAVIGSKVLTVNRSLAITSLLFVLNPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGYGNYVLAFVMHKHGVPQPAVKFPTNYSSKRRKACDSVYMVEWICPK
Ga0311340_1000793523300029943PalsaVNRTLTLTALLVLLSPIVVCQTPSHASNCSTLKHLRHKVSCLCGTVQVCSGDICGRPSTYERDDDISVELRDKTGAILDTQKVVVKTQEKEGTTQDGTITSYKATERRFGFEGKPDGDHKLAFVLHKNGVPQPAVTFPETYSHKRTKPCDPVFMVESVCPR
Ga0311371_1011953633300029951PalsaVNLLVLFSPVAVCQTAPRPPDCSTLKYLRHKVSCLCGAVEICSGDICGSPSVYDLDDDITVELRTKSGTILDTQKVGFEVSEQQGTKLDGTAITFEQKERRFSFNDKRDGEYLLAFILHKNGVAQPAVIFPTNYSHKRKKLSNSIYMVGPTCPR
Ga0302281_1010825123300030044FenMGCSPQLAWIHAVIGSKVHTVNRSLAITSLLFVLNPFLVCQTPHHGSDCSTLKYLRHKVSCLCGTVDVCAGDICGRPSDYDLDDDITVELRDKGGTTIIDSKKVIVETREEEGTTQIGTKISYEKTERRFCFDGRGDGNYVLAFVMHKHGVPQPAVKFPTNYSSKRRKACDSVYMVEWICPK
Ga0311353_1001297273300030399PalsaVNRTLTLTALLVLLSPIVVCQTPSHASNCSTLKHLRHKVSCLCGTVQVCSGDICGRPSTYELDDDISVELRDKTGAILDTQKVVVKTQEKEGTTQDGTITSYKATERRFGFEGKPDGDHKLAFVLHKNGVPQPAVTFPETYSHKRTKPCDPVFMVESVCPR
Ga0311372_1019394723300030520PalsaMNATLSQVVLLVLFSPVAVCQTAPRPPDCSTLKYLRHKVSCLCGAVEICSGDICGSPSVYDLDDDITVELRTKSGTILDTQKVGFEVSEQQGTKLDGTAITFEQKERRFSFNDKRDGEYLLAFILHKNGVAQPEVIFPTNYSHKRKKLSNSIYMVGPTCPR
Ga0311355_1011930743300030580PalsaVNRTLTLTALLVLLSPIVVCQTPSHASNCSTLKHLRHKVSCLCGTVQVCSGDICGRPSTYELDDDISVELRDKTGAILDTQKVVVKTQEKEGTTQDGTITSYKATERRFGFEGKPDGDYKLAFVLHKNGVPQPAVTFPETYSHKRTKPCDPVFMVESVCPR
Ga0311354_1001859533300030618PalsaVNRTLTLTALLVLLSPIVVCQTPSHASNCSTLKHLRHKVSCLCGTVQVCSGDICGRPSTYERDDDISVELRDKTGAILDTQKVVVKTQEKEGTTQDGTITSYKATERRFGFEGKPDGDYKLAFVLHKNGVPQPAVTFPETYSHKRTKPCDPVFMVESVCPR
Ga0302309_1050056313300030687PalsaFSPVAVCQTAPRPPDCSTLKYLRHKVSCLCGAVEICSGDICGSPSVYDLDDDITVELRTKSGTILDTQKVGFEVSEQQGTKLDGTAITFEQKERRFSFNDKRDGEYLLAFILHKNGVAQPAVIFPTNYSHKRKKLSNSIYMVGPTCPR
Ga0302314_1198155813300030906PalsaMNATLSQVVLLVLFSPVAVCQTAPRPPDCSTLKYLRHKVSCLCGAVEICSGDICGSPSVYDLDDDITVELRTKSGTILDTQKVGFEVSEQQGTKLDGTAITFEQKERRFSFNDKRDGEYLLAFILHKNGVAQPEVIFPTNYSHKRKKLSN
Ga0170824_12702136113300031231Forest SoilVNRTLTLTALLFLLSPIVICQTPSHASNCSTLKYLRHKVSCLCGTVPVCSGDICGRPSDYDLDDNITVELREKSGTTLDSKKVVVETREKQGTTQDGTKTAYKQTERRFCFEGKRDGDYLLAFVLYKKGVPQPAVIFPTNYSHKRSKPCDSVYMVEPFCPR
Ga0302325_1006774313300031234PalsaCQTPSHASNCSTLKHLRHKVSCLCGTVQVCSGDICGRPSTYERDDDISVELRDKTGAILDTQKVVVKTQEKEGTTQDGTITSYKATERRFGFEGKPDGDYKLAFVLHKNGVPQPAVTFPETYSHKRTKPCDPVFMVESVCPR
Ga0302320_1196923813300031524BogVNHRLTYSALLFLLGPVALCQSSYRSSDCSTLKYIRHKVSCLCGTVEICSGDICGSPSVYEVDGDISVEFRDKNGTTVDTQKVVVETIEEQGTTQDGRKTSFKRAVRRFSFQGKLDGDYLLAFTLHKNGVSQPALIFPARYSHKRKKLSETIYMLEPTCPK
Ga0302326_1047577223300031525PalsaMGADCSVNHRLTYSALLFLLGPVALCQSSYRSSDCSTLKYIRHKVSCLCGTVEICSGDICGSPSVYEVDGDISVELRDKNGTTVDTQKVVVETIEEQGTTQDGRKTSFKRAVRRFSFQGKLDGDYLLAFTLHKNGVSQPALIFPARYSHKRKKLSETIYMLEPTCPK
Ga0307474_1026665323300031718Hardwood Forest SoilVVTPVINCTRAFARGLGVESVAVDSSLNVAVLLFFFCPLVVCQTAPKPPDCTTLKYLRHKVACLCGTVQVCSGDICGRPSNYDLDDDIKVELRDRAGATTLDARTVGIETRERMCTTQAGTRVSCNTTERTFCFEGKRDGKYQLAFILFKNGTPQPAVRFPTNYSRNSGKSCNPVYMVEPSCPR
Ga0307469_1129867923300031720Hardwood Forest SoilRTLTLTALLLLLTPVVVCQSQSHASDCSTLKYLRHKVSCLCGAVQVCSGDICGRPSDYELDDDIAVELRDKSGTTLDTQKVVVETREKQGTTQDGTKTSYHQTERRFCFEGKRDGDYLLAFVLQKKGVPQPAVIFPTKYSHKRSKPCDSVYMVEPLCPR
Ga0316217_1008447123300031813FreshwaterSVNYTLTHIALLLLLSPIAVCQTSYRASDCTTLKYIRHKVSCLCGTVKICSGDICGRPSDYDLDDDITVELRDKKGTTLDTQKVVFEISEKQGTTQDGTRISFKQAERRFSFEGKRDGDYLLAFILHKNGVEQPAVIFPTNYSRKRGRMSNAVYMVEPDCPR
Ga0316220_110968313300031884FreshwaterVNYTLTHIALLLLLSPIAVCQTSYRASDCTTLKYIRHKVSCLCGTVKICSGDICGRPSDYDLDDDITVELRDKKGTTLDTQKVVFEISEKQGTTQDGTRISFKQAERRFSFEGKRDGDYLLAFILHKNGVEQPAVIFPTNYSRKRGRMSNAVYMVEPDCPR
Ga0306921_1073186523300031912SoilMTRALILTALLLLVTPVVCQAPSHASDCSSLKYLRHKVSCLCGSVAVCSGDICGSPSTYGLDDDIVVELRDKRGTTLDTQMAALETREMQGTTQEGSKTTYKQTERRFCFDGKRDGEYQLAFVLHKNCIAQPAVVFPTNYSHKRSKPCDSMYMV
Ga0308175_10061773233300031938SoilVAKIHIQATNGFWNREALRSKVLEVNSFLQITLLSCMVSVFVHSQTPSRTSDCSTLKYKLHKVSCLCGTVQVCAGDICGTPSNYGLDDDIIVQLRDRARAVILDSKKVIVGKRERECTTQIGTKVACSTTERAFCFDKQKDGDYELAFVLSKKGVAQPAIKFPTNYSHTRRKSCDSVYMVEPSCPTVEPGSQEK
Ga0310912_1084872123300031941SoilDCSSLKYLRHKVSCLCGSVAVCSGDICGSPSTYGLDDDIVVELRDKRGTTLDTQMAALETREMQGTTQEGSKTTYKQTERRFCFDGKRDGEYQLAFVLHKNCIAQPAVVFPTNYSHKRSKPCDSMYMVEPLCPK
Ga0310916_1036102113300031942SoilMTRALILTALLLLVTPVVCQAPSHASDCSSLKYLRHKVSCLCGSVAVCSGDICGSPSTYGLDDDIVVELRDKRGTTLDTQMAALETREMQGTTQEGSKTTYKQTERRFCFDGKRDGEYQLAFVLHKNCIAQPAVVFPTNYSHKRS
Ga0306926_1018410123300031954SoilMTRALILTALLLLVTPVVCQAPSHASDCSSLKYLRHKVSCLCGSVAVCSGDICGSPSTYGLDDDIVVELRDKRGTTLDTQMAALETREMQGTTQEGSKTTYKQTERRFCFDGKRDGEYQLAFVLHKNCIAQPAVVFPTNYSHKRSKPCDSMYMVEPLCPK
Ga0306924_1052057613300032076SoilTPVVCQAPSHASDCSSLKYLRHKVSCLCGSVAVCSGDICGSPSTYGLDDDIVVELRDKRGTTLDTQMAALETREMQGTTQEGSKTTYKQTERRFCFDGKRDGEYQLAFVLHKNCIAQPAVVFPTNYSHKRSKPCDSMYMVEPLCPK
Ga0335079_1126471913300032783SoilMKLLLNIAALIFLFGPPVVCQTAAHASDCSTLKYLRHKVSCLCGTVQVCSGDVCGRPSDYGLDDDITVQLRNKLGTTLLASKKVGVEKRERECTTQIGTKISCPTTERTFCFDSQRDGDYQLAFVVSKNGVPQAAVKFPTNYSHSRRKSCNSVYVVEPSCPTSVRSWR
Ga0335070_1001176123300032829SoilMQIPNGCKVSSVNRRLTLTALLLFLTPVVVSQTQFHASDCPTLKYLRHKVSCLCGTVQVCSGDVCGSPSDYELDDDIAVELRDRSGTTLDRQKVVVETREMQGTTQDGTNTSYKQTERRFCFEGRRDGDYLLAFVLYKKGAPQPAVLFPANYSHKRSKACNSAYLVEPVCPR
Ga0335074_1022793623300032895SoilVIGRKLLTVNRTLTMTALLLTVMGEVLLLNPLALSQTPPHGSDCSTLKYLRHKVSCLCGTVQVCSGDICVGPAAFDLDDNITVELRDKSGTTLDTRKAVVETREMQGTRQDGTKTSYKQTERRFCFEGKRDGDYLLAFVLHKDGIAQPAVIFPTNYSHKQNKACDSMYVVEPVCPK
Ga0335072_1048209413300032898SoilLLLTVMGEVLLLNPLALSQTPPHGSDCSTLKYLRHKVSCLCGTVQVCSGDICVGPADFDLDDNSTVELRDKSGTTLDTRKAVVETREMQGTRQDGTKTSYKQTERRFCFEGKRDGDYLLAFVLHKDGIAQPAVIFPTNYSHKQNKACDSMYVVEPVCPK
Ga0335073_1034596213300033134SoilMTALLLTVMGEVLLLNPLALSQTPPHGSDCSTLKYLRHKVSCLCGTVQVCSGDICVGPAAFDLDDNITVELRDKSGTTLDTRKAVVETREMQGTRQDGTKTSYKQTERRFCFEGKRDGDYLLAFVLHKDGIAQPAVIFPTNYSHKQNKACDSMYVVEPVCPK
Ga0326728_1050989323300033402Peat SoilVAPVNRTLTLAALLLLLTPVVLCQTQSHAPDCSTLKYLRHKVSCLCGTVQVCSGDICGRPSDYELDDDIAVELRDKSGTTLDTQKVVVETREMQGTTQDGTKTSYKQTERRFCFEGKRDGDYLLAFVLHKKGIPQPAVIFPTNYAHKRSKPCDSVYMVEPLCPR
Ga0371490_102409233300033561Peat SoilTIASLLFVLSPSLVCQTPHSGSNCSTLKYLRHKVSCLCGAVDVCTGDICGSPSNYDLDDDITVELRDKAGTMIIDSKKVIVETREEEGTTQVGTKVSYKRTERKFCFDGKHDGDYVLAFVLRKNGVPQPAVKFPTSYSSKRRKPCDSVYMVEPICPK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.