NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050285

Metagenome / Metatranscriptome Family F050285

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050285
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 70 residues
Representative Sequence MRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT
Number of Associated Samples 121
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 80.00 %
% of genes near scaffold ends (potentially truncated) 22.76 %
% of genes from short scaffolds (< 2000 bps) 77.24 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (50.345 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(15.172 % of family members)
Environment Ontology (ENVO) Unclassified
(57.241 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.655 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.86%    β-sheet: 24.29%    Coil/Unstructured: 62.86%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF11651P22_CoatProtein 12.41
PF12236Head-tail_con 4.83
PF08291Peptidase_M15_3 0.69
PF13884Peptidase_S74 0.69
PF03237Terminase_6N 0.69
PF11351GTA_holin_3TM 0.69



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.55 %
UnclassifiedrootN/A23.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2236876005|none_p032637All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.527Open in IMG/M
3300000101|DelMOSum2010_c10025690All Organisms → Viruses → Predicted Viral3329Open in IMG/M
3300000101|DelMOSum2010_c10098344All Organisms → Viruses → Predicted Viral1224Open in IMG/M
3300000101|DelMOSum2010_c10147337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.870Open in IMG/M
3300000116|DelMOSpr2010_c10015484All Organisms → Viruses → Predicted Viral3832Open in IMG/M
3300000116|DelMOSpr2010_c10040802All Organisms → Viruses → Predicted Viral2096Open in IMG/M
3300000116|DelMOSpr2010_c10117107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.969Open in IMG/M
3300000928|OpTDRAFT_10214971All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.802Open in IMG/M
3300001348|JGI20154J14316_10108753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.857Open in IMG/M
3300001963|GOS2229_1004312Not Available736Open in IMG/M
3300005825|Ga0074476_1576054All Organisms → Viruses → Predicted Viral2974Open in IMG/M
3300005828|Ga0074475_10328647All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.669Open in IMG/M
3300005837|Ga0078893_10054355All Organisms → Viruses → Predicted Viral1858Open in IMG/M
3300005941|Ga0070743_10032006All Organisms → Viruses → Predicted Viral1815Open in IMG/M
3300006026|Ga0075478_10014946All Organisms → Viruses → Predicted Viral2632Open in IMG/M
3300006027|Ga0075462_10059548All Organisms → Viruses → Predicted Viral1208Open in IMG/M
3300006029|Ga0075466_1101929All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.778Open in IMG/M
3300006789|Ga0098054_1030201All Organisms → Viruses → Predicted Viral2122Open in IMG/M
3300006790|Ga0098074_1043374All Organisms → Viruses → Predicted Viral1275Open in IMG/M
3300006790|Ga0098074_1045656All Organisms → Viruses → Predicted Viral1237Open in IMG/M
3300006790|Ga0098074_1178646All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.534Open in IMG/M
3300006793|Ga0098055_1023999All Organisms → Viruses → Predicted Viral2579Open in IMG/M
3300006810|Ga0070754_10099388All Organisms → Viruses → Predicted Viral1440Open in IMG/M
3300006867|Ga0075476_10109564All Organisms → Viruses → Predicted Viral1057Open in IMG/M
3300006920|Ga0070748_1055462All Organisms → Viruses → Predicted Viral1566Open in IMG/M
3300006922|Ga0098045_1083400Not Available763Open in IMG/M
3300007236|Ga0075463_10032518All Organisms → Viruses → Predicted Viral1703Open in IMG/M
3300007236|Ga0075463_10287242All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.528Open in IMG/M
3300007276|Ga0070747_1197741All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.709Open in IMG/M
3300007344|Ga0070745_1171795All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.812Open in IMG/M
3300007345|Ga0070752_1111019All Organisms → Viruses → Predicted Viral1163Open in IMG/M
3300007539|Ga0099849_1008087All Organisms → Viruses → Predicted Viral4747Open in IMG/M
3300007540|Ga0099847_1078753All Organisms → Viruses → Predicted Viral1016Open in IMG/M
3300007545|Ga0102873_1001607Not Available7261Open in IMG/M
3300007554|Ga0102820_1159157All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.545Open in IMG/M
3300007558|Ga0102822_1008469All Organisms → Viruses → Predicted Viral2629Open in IMG/M
3300007617|Ga0102897_1005991All Organisms → Viruses → Predicted Viral3860Open in IMG/M
3300007630|Ga0102903_1003877All Organisms → Viruses → Predicted Viral4378Open in IMG/M
3300007632|Ga0102894_1008209All Organisms → Viruses → Predicted Viral2506Open in IMG/M
3300007640|Ga0070751_1044665All Organisms → Viruses → Predicted Viral1968Open in IMG/M
3300007642|Ga0102876_1008555All Organisms → Viruses → Predicted Viral2960Open in IMG/M
3300007715|Ga0102827_1174459Not Available500Open in IMG/M
3300007716|Ga0102867_1209035Not Available538Open in IMG/M
3300007981|Ga0102904_1090609Not Available709Open in IMG/M
3300008050|Ga0098052_1285216Not Available626Open in IMG/M
3300008996|Ga0102831_1134190All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.822Open in IMG/M
3300009002|Ga0102810_1262160All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.533Open in IMG/M
3300009079|Ga0102814_10170567All Organisms → Viruses → Predicted Viral1188Open in IMG/M
3300009436|Ga0115008_10894117Not Available656Open in IMG/M
3300009496|Ga0115570_10452327Not Available541Open in IMG/M
3300009507|Ga0115572_10639259All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.584Open in IMG/M
3300009543|Ga0115099_10431582All Organisms → Viruses → Predicted Viral1035Open in IMG/M
3300009608|Ga0115100_10181727All Organisms → Viruses → Predicted Viral1028Open in IMG/M
3300009608|Ga0115100_10254253All Organisms → Viruses → Predicted Viral2213Open in IMG/M
3300009723|Ga0123374_124366All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.607Open in IMG/M
3300009725|Ga0123372_117828Not Available896Open in IMG/M
3300009730|Ga0123359_146517All Organisms → Viruses → Predicted Viral2366Open in IMG/M
3300009739|Ga0123362_1039769All Organisms → Viruses → Predicted Viral1220Open in IMG/M
3300009741|Ga0123361_1131804All Organisms → Viruses → Predicted Viral1328Open in IMG/M
3300009753|Ga0123360_1099217Not Available786Open in IMG/M
3300009756|Ga0123366_1110389All Organisms → Viruses → Predicted Viral1001Open in IMG/M
3300009757|Ga0123367_1088993All Organisms → Viruses → Predicted Viral1277Open in IMG/M
3300009757|Ga0123367_1098775All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.519Open in IMG/M
3300010300|Ga0129351_1116929All Organisms → Viruses → Predicted Viral1065Open in IMG/M
3300010300|Ga0129351_1219765All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.733Open in IMG/M
3300011127|Ga0151665_1012312Not Available698Open in IMG/M
3300011258|Ga0151677_1020638Not Available732Open in IMG/M
3300011258|Ga0151677_1024159All Organisms → Viruses → Predicted Viral1110Open in IMG/M
3300012394|Ga0123365_1042990All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.586Open in IMG/M
3300012525|Ga0129353_1822906All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.511Open in IMG/M
3300012969|Ga0129332_1154870All Organisms → Viruses → Predicted Viral1114Open in IMG/M
3300017697|Ga0180120_10127505All Organisms → Viruses → Predicted Viral1090Open in IMG/M
3300017709|Ga0181387_1029982All Organisms → Viruses → Predicted Viral1066Open in IMG/M
3300017710|Ga0181403_1051960Not Available857Open in IMG/M
3300017725|Ga0181398_1021176All Organisms → Viruses → Predicted Viral1618Open in IMG/M
3300017729|Ga0181396_1021342All Organisms → Viruses → Predicted Viral1289Open in IMG/M
3300017732|Ga0181415_1133285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.557Open in IMG/M
3300017735|Ga0181431_1021431All Organisms → Viruses → Predicted Viral1504Open in IMG/M
3300017735|Ga0181431_1071499Not Available780Open in IMG/M
3300017742|Ga0181399_1102571All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.707Open in IMG/M
3300017744|Ga0181397_1179960Not Available533Open in IMG/M
3300017745|Ga0181427_1182537All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.505Open in IMG/M
3300017746|Ga0181389_1024437All Organisms → Viruses → Predicted Viral1876Open in IMG/M
3300017758|Ga0181409_1052703All Organisms → Viruses → Predicted Viral1251Open in IMG/M
3300017786|Ga0181424_10010969All Organisms → Viruses → Predicted Viral3923Open in IMG/M
3300017786|Ga0181424_10012876All Organisms → Viruses → Predicted Viral3616Open in IMG/M
3300017951|Ga0181577_10159481All Organisms → Viruses → Predicted Viral1530Open in IMG/M
3300017951|Ga0181577_10561976All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.707Open in IMG/M
3300017951|Ga0181577_10933100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.515Open in IMG/M
3300018415|Ga0181559_10052079All Organisms → Viruses → Predicted Viral2759Open in IMG/M
3300018416|Ga0181553_10290875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.912Open in IMG/M
3300018416|Ga0181553_10600912All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.581Open in IMG/M
3300018417|Ga0181558_10607348All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.562Open in IMG/M
3300018420|Ga0181563_10734988Not Available543Open in IMG/M
3300018876|Ga0181564_10088582All Organisms → Viruses → Predicted Viral1964Open in IMG/M
3300019459|Ga0181562_10338009Not Available740Open in IMG/M
3300019751|Ga0194029_1000828All Organisms → Viruses → Predicted Viral3883Open in IMG/M
3300020185|Ga0206131_10223374Not Available903Open in IMG/M
3300021085|Ga0206677_10085471All Organisms → Viruses → Predicted Viral1525Open in IMG/M
3300021085|Ga0206677_10283827All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.669Open in IMG/M
3300021087|Ga0206683_10210454All Organisms → Viruses → Predicted Viral1017Open in IMG/M
3300021347|Ga0213862_10074787All Organisms → Viruses → Predicted Viral1198Open in IMG/M
3300021347|Ga0213862_10099811All Organisms → Viruses → Predicted Viral1021Open in IMG/M
3300021356|Ga0213858_10001912Not Available9957Open in IMG/M
3300021373|Ga0213865_10000687Not Available22836Open in IMG/M
3300021373|Ga0213865_10272300Not Available801Open in IMG/M
3300021375|Ga0213869_10012191All Organisms → cellular organisms → Bacteria5082Open in IMG/M
3300021375|Ga0213869_10323318Not Available651Open in IMG/M
3300021378|Ga0213861_10193265All Organisms → Viruses → Predicted Viral1115Open in IMG/M
3300021378|Ga0213861_10257360All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.918Open in IMG/M
3300021389|Ga0213868_10011397Not Available7398Open in IMG/M
3300021389|Ga0213868_10056546All Organisms → Viruses → Predicted Viral2691Open in IMG/M
3300021389|Ga0213868_10716500All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.509Open in IMG/M
3300021957|Ga0222717_10051159All Organisms → Viruses → Predicted Viral2676Open in IMG/M
3300022072|Ga0196889_1001801Not Available5671Open in IMG/M
3300022187|Ga0196899_1014979All Organisms → Viruses → Predicted Viral2967Open in IMG/M
3300022218|Ga0224502_10433166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.511Open in IMG/M
3300022308|Ga0224504_10080433All Organisms → Viruses → Predicted Viral1312Open in IMG/M
3300022923|Ga0255783_10364193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.557Open in IMG/M
(restricted) 3300023109|Ga0233432_10242751Not Available867Open in IMG/M
(restricted) 3300023276|Ga0233410_10228163Not Available601Open in IMG/M
(restricted) 3300024059|Ga0255040_10003928All Organisms → Viruses → Predicted Viral4658Open in IMG/M
(restricted) 3300024059|Ga0255040_10146776All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.946Open in IMG/M
3300024346|Ga0244775_10422078All Organisms → Viruses → Predicted Viral1095Open in IMG/M
3300025151|Ga0209645_1034017All Organisms → Viruses → Predicted Viral1860Open in IMG/M
3300025645|Ga0208643_1156972Not Available571Open in IMG/M
3300025671|Ga0208898_1096829All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.907Open in IMG/M
3300025806|Ga0208545_1071633All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.966Open in IMG/M
3300025874|Ga0209533_1033366All Organisms → Viruses → Predicted Viral3326Open in IMG/M
3300027192|Ga0208673_1016691All Organisms → Viruses → Predicted Viral1273Open in IMG/M
3300027217|Ga0208928_1036402All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Gramella → unclassified Gramella → Gramella sp.765Open in IMG/M
3300027226|Ga0208309_1001331All Organisms → Viruses → Predicted Viral2961Open in IMG/M
3300027238|Ga0208808_1005444All Organisms → Viruses → Predicted Viral1883Open in IMG/M
3300027525|Ga0208437_1001619Not Available6440Open in IMG/M
(restricted) 3300027837|Ga0255041_10075001All Organisms → Viruses → Predicted Viral1088Open in IMG/M
(restricted) 3300027861|Ga0233415_10487881Not Available595Open in IMG/M
(restricted) 3300028045|Ga0233414_10650481Not Available502Open in IMG/M
3300028115|Ga0233450_10155279All Organisms → Viruses → Predicted Viral1127Open in IMG/M
3300031519|Ga0307488_10205100All Organisms → Viruses → Predicted Viral1332Open in IMG/M
3300032088|Ga0315321_10242821All Organisms → Viruses → Predicted Viral1167Open in IMG/M
3300032254|Ga0316208_1022136All Organisms → Viruses → Predicted Viral2478Open in IMG/M
3300032255|Ga0316209_1067133All Organisms → Viruses → Predicted Viral1058Open in IMG/M
3300032257|Ga0316205_10251389Not Available636Open in IMG/M
3300032258|Ga0316191_10871844Not Available652Open in IMG/M
3300034418|Ga0348337_122027Not Available797Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.17%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.10%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine12.41%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater11.72%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.28%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh8.28%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine4.14%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.76%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.76%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat2.07%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.07%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.07%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.07%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.38%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.38%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.38%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.38%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.38%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.69%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.69%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.69%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.69%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.69%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine0.69%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.69%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.69%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.69%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2236876005Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15mEnvironmentalOpen in IMG/M
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001348Pelagic Microbial community sample from North Sea - COGITO 998_met_04EnvironmentalOpen in IMG/M
3300001963Marine microbial communities from Nags Head, North Carolina, USA - GS013EnvironmentalOpen in IMG/M
3300005825Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBBEnvironmentalOpen in IMG/M
3300005828Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBIEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007617Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007632Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009723Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_233_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009725Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_229_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009730Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_177_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009739Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_194_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009753Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_190_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009756Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_202_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009757Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_205_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300011127Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, 0.02EnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012394Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022923Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025874Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027217Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027226Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027238Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032254Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyriteEnvironmentalOpen in IMG/M
3300032255Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyriteEnvironmentalOpen in IMG/M
3300032257Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyriteEnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
none_03263712236876005Marine EstuarineMFDFKCDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESH
DelMOSum2010_1002569033300000101MarineMRRLYDFQCDNGHVNEFLRSSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
DelMOSum2010_1009834423300000101MarineMRRMYDFQCDNGHVNEFLRASDVEEVDCPDCELMARKIVTPVKVNREKNSWKEVRRWSKQRESQVKHERKQGVTL*
DelMOSum2010_1014733713300000101MarineMRRLYDFQCDNGHVNEFLRGSDVEEVDCPNCELKARKIVTPVKVNGGKDSWKETRKWARQRESHMNANKT*
DelMOSpr2010_1001548433300000116MarineMRFMFDFKCDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMKATKA*
DelMOSpr2010_1004080253300000116MarineMRRMYDFRCDNGHTNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWVKQRESHMNSNKT*
DelMOSpr2010_1011710733300000116MarineMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
OpTDRAFT_1021497113300000928Freshwater And MarineMRRMFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
JGI20154J14316_1010875333300001348Pelagic MarineMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETQKWVRQRESHMNANKT*
GOS2229_100431223300001963MarineMRRLFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRE
Ga0074476_157605433300005825Sediment (Intertidal)MRRMYDFRCDNGHTNDFLRYSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
Ga0074475_1032864723300005828Sediment (Intertidal)MRRLYDFQCDNGHVNEFLRGSDVEEVDCPDCKLKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS*
Ga0078893_1005435543300005837Marine Surface WaterMRRMYDFRCDNGHTNEFLRDPDVEEVDCPECELKARKIVTPVKVNREKNSWKEVRKWSKQRESQVKHERKHGVTL*
Ga0070743_1003200613300005941EstuarineMRRMYDFRCDNGHTNDFLRYSDVEEVDCPDCGLKARKIVTPVKVNGGKDSWKETRKWARQRESHMNANKT*
Ga0075478_1001494633300006026AqueousMRRMFDFKCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
Ga0075462_1005954823300006027AqueousMRRLFDFKCDNGHVNEFFRDVEVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESQIKHERKHGVTL*
Ga0075466_110192923300006029AqueousMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS*
Ga0098054_103020113300006789MarineTRRLGRMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
Ga0098074_104337433300006790MarineGHVNEKFVDTETTEVQCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHMKSNKA*
Ga0098074_104565633300006790MarineMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKINREKNSWKEVRRWSKQRESHMKSNKA*
Ga0098074_117864613300006790MarineMRRLFDFKCDNGHVNEKFVDVETNEVQCPDCELKARKIVTPVTINGGDSWKETRKWVKKR
Ga0098055_102399923300006793MarineMRFMFDFKCDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMRATKA*
Ga0070754_1009938823300006810AqueousMFEFRCDNGHTNDKLVDTETTEIDCPDCELKARKIVTPVKLKREKNSWKEVRRWSKQRESHIKHERKQGITL*
Ga0075476_1010956413300006867AqueousRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
Ga0070748_105546233300006920AqueousMRRLFDFKCDNGHVNEFFRDVEVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHMKTNKA*
Ga0098045_108340013300006922MarineMFDFKCDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMRATKA*
Ga0075463_1003251813300007236AqueousMFEFRCDNGHTNDKLVDTETTEIDCPDCELKARKIVTPVKLKREKNSWKEVRRWSKQRESHM
Ga0075463_1028724223300007236AqueousMRRLFDFKCDNGHVNEFFRDVEVEEVDCPDCELKARKIVTPVKINREKNSWKEVRRWSKQRESHMK
Ga0070747_119774113300007276AqueousMRRLYDFKCDNGHVNDFLRYSDEEEVDCPDCELKARKIITPVKVNRGKDSWKETRKWVKQRESHMNSNKT*
Ga0070745_117179523300007344AqueousMRFMFDFKCDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMRANKA*
Ga0070752_111101923300007345AqueousMRRMYDFRCDNGHTNEFLRDSDVEEVDCPDCELTARKIVTPVKVNRGKDSWKETRKWVKQRESHMNANKT*
Ga0099849_100808723300007539AqueousMRRLFDFKCDNGHVNEFLRDVDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHMKTNKA*
Ga0099847_107875323300007540AqueousMRRLYDFQCDNGHVNEFLRASDVEEVDCPDCELKARKIVTPVKIQRDMNSPAGKERWAKQRDKQIKHERKHGVTL*
Ga0102873_100160743300007545EstuarineMRRLYDFQCDNGHVNEFLRGSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS*
Ga0102820_115915723300007554EstuarineMRRMYDFRCDNGHTNEFLRDSDVEEVDCPDCELTARKIVTPVKVNRGKDSWKETRKWARQ
Ga0102822_100846943300007558EstuarineMRRMYDFRCDNGHTNDFLRYSDVEEVDCPDCGLMPRKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
Ga0102897_100599133300007617EstuarineMRRLYDFQCDNGHVNEFLRGSDVEEVDCPDCELKARKSVTPVKVNRGKDSWKETRKWARQRESHMNANKS*
Ga0102903_100387733300007630EstuarineMRRLYDFQCDNGHVNEFLRGSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
Ga0102894_100820973300007632EstuarineMRRLYDFQCDNGHVKEFLRGSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS*
Ga0070751_104466513300007640AqueousMFDFKCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
Ga0102876_100855543300007642EstuarineRMRRLYDFQCDNGHVNEFLRGSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS*
Ga0102827_117445923300007715EstuarineMYDFRCDNGHTNEFLRDSDVEEVDCPDCELTARKIVTPVKVNRGKDSWKETRKWVKQRESHMNANKT*
Ga0102867_120903523300007716EstuarineMRRMYDFRCDNGHTNDFLRYPDVEEVDCPDCELKARKIITPVKVNRGKDSWKETRKWVKQRESHMNANKT*
Ga0102904_109060923300007981EstuarineMRRMYDFRCDNGHTNEFLRDSDVEEVDCPDCELTARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
Ga0098052_128521613300008050MarineNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMRATKA*
Ga0102831_113419033300008996EstuarineMRRMYDFRCDNGHTNDFLRYSDVEEVDCPDCGLKARKIVTPVKVNGGKDSWKETRKW
Ga0102810_126216023300009002EstuarineMRRLYDFQCDNGHVNEFLRGSDVEGVDCPNCELKARKIVTPVKVNGGKDSWKETRK
Ga0102814_1017056723300009079EstuarineMRFMFDFKCDNGHVYEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMKATKA*
Ga0115008_1089411723300009436MarineMRRLYDFQCDNGHVNEFLRSSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETQKWVRQRESHMNANKT*
Ga0115570_1045232713300009496Pelagic MarineDNGHVNEFLRSSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETQKWVRQRESHMNANKT*
Ga0115572_1063925923300009507Pelagic MarineMRRLYDFQCDNGHVNEFLRDSDAEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANK
Ga0115099_1043158223300009543MarineMRRMYDFRCDNGHTNEFLRDPDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRKWSKQRESQVKHERKHGVTL*
Ga0115100_1018172723300009608MarineMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCGLKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS*
Ga0115100_1025425333300009608MarineMRRMYDFRCDNGHTNEFLRDPDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRQWSKQREAQVKHERKHGVTL*
Ga0123374_12436623300009723MarineMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKINREKNSWKEVRQWARNRESHMKYERKQGISD*
Ga0123372_11782823300009725MarineMRRLFDFKCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKINREKNSWKEVRQWARNRESHMKYERKQGISD*
Ga0123359_14651733300009730MarineMRRLFDFKCDNGHVNEFLRDVDVEEVDCPDCELKARKIVTPVKINREKNSWKEVRQWARNRESHMKYERKQGISD*
Ga0123362_103976933300009739MarineMRRLFDFKCDNGHVNEFLRDVDVEEVDCPDCELKARKIVTPVKINREKNSWKEVRRWSKQRESQIKHERKHGVTL*
Ga0123361_113180433300009741MarineGRMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKINREKNSWKEVRQWARNRESHMKYERKQGISD*
Ga0123360_109921723300009753MarineMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKINREKNSWKEVRRWSKQRESHIKHERKHGVTL*
Ga0123366_111038923300009756MarineMRRLFDFKCDNGHVNEFLRDVDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHIKHERKHGVTL*
Ga0123367_108899323300009757MarineMRRLFDFKCDNGHVNEFLRDVDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESQIKHERKHGVTL*
Ga0123367_109877523300009757MarineMRRLFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESQIKHERKHGVTL*
Ga0129351_111692923300010300Freshwater To Marine Saline GradientMRRLFDFKCDNGHVNEKFVDIETNEVQCPDCELKARKIVTPVTINGGDSWKETRKWVKKRESHMRANKA*
Ga0129351_121976523300010300Freshwater To Marine Saline GradientMRRMFDFKCDNGHVNEFLRDVEVEEVDCPDCDLKARKIVTPVKVNREKNSWKEVRKWSKQRESHIKHERKQGVTL*
Ga0151665_101231213300011127MarineMFEFRCDNGHTNDKLVDTETTEIDCPDCELKARKIVTPVKLKREKNSWKEVRNWSKQRESHIKHERKQDITL*
Ga0151677_102063823300011258MarineMRRMYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT*
Ga0151677_102415943300011258MarineMRRMYDFRCDNGHTNEFLRDSDVEEVDCPDCELTARKIVTPVKVNRGKDSWKETRKW
Ga0123365_104299023300012394MarineMRRLFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHMKSNKA*
Ga0129353_182290623300012525AqueousMRRLFDFKCDNGHVNEFLRDVDVKEVDCPDCELKARKIVTPIKVKREKNSWKEVRRWSKQRESQIK
Ga0129332_115487023300012969AqueousMRRMYDFQCDNGHVNEFLRASDVEEVDCPDCELKARKIVTPVKIQRDMNSPAGKERWAKQRDKQIKHERKHGVTL*
Ga0180120_1012750543300017697Freshwater To Marine Saline GradientMRRLYDFQCDNGHVNEFLRASDVEEVDCPDCELKARKIVTPVKIQRDMNSPAGKERWAKQRDKQIKHERKHGVTL
Ga0181387_102998243300017709SeawaterMRRMFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT
Ga0181403_105196023300017710SeawaterMRRMYDFRCDNGHTNEFLRDSDVEEVDCPDCELTARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT
Ga0181398_102117623300017725SeawaterMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCGLKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT
Ga0181396_102134213300017729SeawaterRARGRRRADGIRVMRRMYDFRCDNGHTNEFLRDPDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRKWSKQRESQVKHERKHGVTL
Ga0181415_113328523300017732SeawaterMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRK
Ga0181431_102143123300017735SeawaterMRRLYDFQCDNGHVNEFLRGSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT
Ga0181431_107149913300017735SeawaterLMRFMFDFKCDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMKATKA
Ga0181399_110257123300017742SeawaterMFDFKCDKGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMRATKA
Ga0181397_117996023300017744SeawaterRADGIRVMRRMYDFRCDNGHTNEFLRDPDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRKWSKQRESQVKHERKHGVTL
Ga0181427_118253723300017745SeawaterMRFMFDFKCDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMKA
Ga0181389_102443753300017746SeawaterMRFMFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT
Ga0181409_105270323300017758SeawaterMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCGLKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS
Ga0181424_1001096953300017786SeawaterMRRMFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESQVKHERKQGVTL
Ga0181424_1001287633300017786SeawaterMFDFKRDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMKATKA
Ga0181577_1015948123300017951Salt MarshMFEFRCDNGHTNDKLVDTETTEIDCPDCELKARKIVTPVKLKREKNSWKEVRRWSKQRESHIKHERKQGITL
Ga0181577_1056197623300017951Salt MarshMRRLYDFKCDNGHVNEFLRDVDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESQIKHERKHGVTL
Ga0181577_1093310023300017951Salt MarshMRRLFDFKCDNGHVNEFLRDVEVKEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESQIKHERKHGVTL
Ga0181559_1005207963300018415Salt MarshMRRLFDFKCDNGHVNEFFRDVEVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHMKTNKA
Ga0181553_1029087523300018416Salt MarshMRRLFDFKCDNGHVNEKFVDVETNEVQCPDCELKARKIVTPVTINGGDSWKETRKWVKKRESHMRANKA
Ga0181553_1060091223300018416Salt MarshMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKINREKNSWKEVRRWSKQRESHMKTNKA
Ga0181558_1060734823300018417Salt MarshMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHMKTNKA
Ga0181563_1073498823300018420Salt MarshLGRMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKINREKNSWKEVRRWSKQRESHMKSNKA
Ga0181564_1008858233300018876Salt MarshMRRLFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKIVTPVKINREKNSWKEVRRWSKQRESHMKSNKA
Ga0181562_1033800923300019459Salt MarshMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHMKSNKA
Ga0194029_100082833300019751FreshwaterMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCKLKARKIVTPVKINREKNSWKEVRRWSKQRESHMKSNKA
Ga0206131_1022337423300020185SeawaterMRRLYDFQCDNGHVNEFLRASDVEEVDCPDCELMARKIVTPVKVNREKNSWKEVRRWSKQRESQVKHERKQGVTL
Ga0206677_1008547133300021085SeawaterMRRMYDFRCDNGHTNEFLRDPDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRQWSKQREAQVKHERKHGVTL
Ga0206677_1028382723300021085SeawaterMRRMYDFRCDNGHTNEFLRDSDVEEVDCPDCELTARKIVTPVKVNRGKDSWKETRKWVKQRESHMNANKT
Ga0206683_1021045423300021087SeawaterMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT
Ga0213862_1007478723300021347SeawaterMRRMFDFKCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS
Ga0213862_1009981123300021347SeawaterMRRLFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKTVTPVKINREKNSWKEVRRWSKQRESQIKHERKHGVTL
Ga0213858_10001912123300021356SeawaterMRRLFDFKCDNGHVNEFLRDVDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHMKTNKA
Ga0213865_1000068773300021373SeawaterMRRLFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESQIKHERKHGVTL
Ga0213865_1027230023300021373SeawaterMRRLYDFQCDNGHVNEFLRDSDVEEVACPDCELKARKIVTPVKVNRGKNSWKETRKWARQRESHMNANKT
Ga0213869_1001219173300021375SeawaterMRRMYDFRCDNGHTNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWVKQRESHMNSNKT
Ga0213869_1032331823300021375SeawaterMFDFKCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESQVKHERKHDVTL
Ga0213861_1019326523300021378SeawaterMYDFRCDNGHTNEFLRDSDVEEVDCPDCELTARKIVTPVKVNRGKDSWKETRKWVKQRESHMNANKT
Ga0213861_1025736033300021378SeawaterMRRLYDFKCDNGHVNEFFRDVEVEEVDCPDCELKARKTVTPVKVNREKNSWKEVRRWSKQRESHMKTNKA
Ga0213868_10011397123300021389SeawaterMRRLYDFKCDNGHVNDFLRYSDVEEVDCPDCELKARKIITPVKVNRGKDSWKETRKWVKQRESHMNANKT
Ga0213868_1005654623300021389SeawaterMRRLYDFKCDNGHVNEFFRDVEVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHMKTNKA
Ga0213868_1071650013300021389SeawaterMRRLYDFRCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNAN
Ga0222717_1005115913300021957Estuarine WaterMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS
Ga0196889_100180173300022072AqueousMRRMYDFQCDNGHVNEFLRASDVEEVDCPDCELMARKIVTPVKVNREKNSWKEVRRWSKQRESQVKHERKQGVTL
Ga0196899_101497933300022187AqueousMRRMFDFKCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT
Ga0224502_1043316623300022218SedimentMFDFKCDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMKATKA
Ga0224504_1008043313300022308SedimentMRFMFDFKCDKGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMKATKA
Ga0255783_1036419313300022923Salt MarshMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKINREKNSWKEVRRWSKQRESHMKSNKA
(restricted) Ga0233432_1024275123300023109SeawaterMRRLYDFQCDNGHVNEFLRGSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS
(restricted) Ga0233410_1022816323300023276SeawaterYDFRCDNGHTNDFLRYSDVEEVDCPDCELKARKIITPVKVNGGKDSWKETRKWARQRESHMNANKS
(restricted) Ga0255040_1000392843300024059SeawaterMRFMFDFKCDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMKATKA
(restricted) Ga0255040_1014677633300024059SeawaterMRRMYDFRCDNGHTNDFLRYSDVEEVDCPDCELKARKIVTPVKVNGGKDSWKETRKWARQRESHMNANKT
Ga0244775_1042207813300024346EstuarineMRRMYDFRCDNGHTNDFLRYSDVEEVDCPDCGLKARKIVTPVKVNGGKDSWKETRKWARQRESHMNANKT
Ga0209645_103401723300025151MarineMRRMFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHMKTNKA
Ga0208643_115697223300025645AqueousRMRRLFDFKCDNGHVNEFFRDVEVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRRWSKQRESHMKTNKA
Ga0208898_109682943300025671AqueousMRRMFDFKCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRE
Ga0208545_107163333300025806AqueousMRRMFDFKCDNGHVNEFLRDVEVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS
Ga0209533_103336623300025874Pelagic MarineMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETQKWVRQRESHMNANKT
Ga0208673_101669123300027192EstuarineMRRMYDFRCDNGHTNDFLRYSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT
Ga0208928_103640213300027217EstuarineMRRLYDFQCDNGHVNEFLRGSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHM
Ga0208309_100133143300027226EstuarineRTRRLRRMRRLYDFQCDNGHVNEFLRGSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS
Ga0208808_100544413300027238EstuarineMRRLYDFQCDNGHVNEFLRGSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQ
Ga0208437_100161983300027525EstuarineMRRMYDFRCDNGHTNDFLRYSDVEEVDCPDCGLKARKIVTPVKVNGGKDSWKETRKWARQRESHMNANKS
(restricted) Ga0255041_1007500123300027837SeawaterMRRMYDFRCDNGHTNDFLRYSDVEEVDCPDCELKARKIITPVKVNRGKDSWKETRKWVKQRESHMNANKT
(restricted) Ga0233415_1048788123300027861SeawaterMRRMYDFRCDNGHTNEFLRDPDVEEVDCPDCELKARKIVTPVKVNREKNSWKEVRKWSKQRESQVKHERKHGVTL
(restricted) Ga0233414_1065048113300028045SeawaterMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCGLKARKIVTPVKVNGGKDSWKETRKWARQRESHMNANKT
Ga0233450_1015527923300028115Salt MarshMRRLFDFKCDNGHVNEFFRDVEVEEVDCPDCELKARKIVTPVKINREKNSWKEVRRWSKQRESHMKSNKA
Ga0307488_1020510023300031519Sackhole BrineMRRLYDFQCDNGHVNEFLRGSDVEEVDCPDCELKARKIVTPVKVNGGKDSWKETRKWARQRESHMNANKT
Ga0315321_1024282123300032088SeawaterRVTDRNSQTTTRRRLGRMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS
Ga0316208_102213633300032254Microbial MatMRFMFDFKCDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMRATKA
Ga0316209_106713323300032255Microbial MatMFDFKCDNGHVNEKFVDSETTEVQCPDCSLIARKIVTPVTINGGDSWKETRKWVKKRESHMRATKA
Ga0316205_1025138923300032257Microbial MatGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS
Ga0316191_1087184423300032258Worm BurrowATSTRRRLGRMRRLYDFQCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKS
Ga0348337_122027_557_7603300034418AqueousMFDFKCDNGHVNEFLRDSDVEEVDCPDCELKARKIVTPVKVNRGKDSWKETRKWARQRESHMNANKT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.