NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049942

Metagenome / Metatranscriptome Family F049942

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049942
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 52 residues
Representative Sequence MDKDIEYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSAGEFN
Number of Associated Samples 108
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.92 %
% of genes near scaffold ends (potentially truncated) 25.34 %
% of genes from short scaffolds (< 2000 bps) 81.51 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (49.315 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(22.603 % of family members)
Environment Ontology (ENVO) Unclassified
(67.808 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(80.137 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.77%    β-sheet: 0.00%    Coil/Unstructured: 69.23%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF06378DUF1071 30.82
PF14090HTH_39 13.01
PF04404ERF 13.01
PF09588YqaJ 8.90
PF01381HTH_3 6.85
PF13730HTH_36 6.16
PF11753DUF3310 2.05
PF08291Peptidase_M15_3 1.37
PF00805Pentapeptide 1.37
PF13443HTH_26 1.37
PF12844HTH_19 0.68
PF00149Metallophos 0.68
PF01507PAPS_reduct 0.68
PF09643YopX 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 1.37

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.97 %
UnclassifiedrootN/A26.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10035703All Organisms → cellular organisms → Bacteria2139Open in IMG/M
3300000116|DelMOSpr2010_c10081691All Organisms → Viruses → Predicted Viral1277Open in IMG/M
3300000116|DelMOSpr2010_c10150373All Organisms → cellular organisms → Bacteria → Proteobacteria798Open in IMG/M
3300000116|DelMOSpr2010_c10153927Not Available784Open in IMG/M
3300000121|TDF_OR_ARG04_113mDRAFT_c1005510Not Available1726Open in IMG/M
3300000121|TDF_OR_ARG04_113mDRAFT_c1030298Not Available634Open in IMG/M
3300000131|TDF_MC_ARG02_113mDRAFT_c1012721All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium625Open in IMG/M
3300000947|BBAY92_10076485Not Available899Open in IMG/M
3300000949|BBAY94_10173147Not Available583Open in IMG/M
3300002483|JGI25132J35274_1032913All Organisms → Viruses → Predicted Viral1170Open in IMG/M
3300002483|JGI25132J35274_1037145All Organisms → Viruses → Predicted Viral1087Open in IMG/M
3300004113|Ga0065183_10298743Not Available733Open in IMG/M
3300004457|Ga0066224_1005006All Organisms → cellular organisms → Bacteria5685Open in IMG/M
3300004460|Ga0066222_1073743All Organisms → cellular organisms → Bacteria2297Open in IMG/M
3300005589|Ga0070729_10245415All Organisms → Viruses → Predicted Viral1023Open in IMG/M
3300005828|Ga0074475_10137977All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium644Open in IMG/M
3300005920|Ga0070725_10353413All Organisms → cellular organisms → Bacteria → Proteobacteria651Open in IMG/M
3300005941|Ga0070743_10003011Not Available6277Open in IMG/M
3300006164|Ga0075441_10130887All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium952Open in IMG/M
3300006467|Ga0099972_12297584Not Available656Open in IMG/M
3300006467|Ga0099972_12336341Not Available750Open in IMG/M
3300006734|Ga0098073_1007409All Organisms → Viruses → Predicted Viral2049Open in IMG/M
3300006752|Ga0098048_1013134All Organisms → cellular organisms → Bacteria → Proteobacteria2879Open in IMG/M
3300006752|Ga0098048_1083374All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium975Open in IMG/M
3300006752|Ga0098048_1092831All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium916Open in IMG/M
3300006793|Ga0098055_1114717All Organisms → cellular organisms → Bacteria → Proteobacteria1048Open in IMG/M
3300006793|Ga0098055_1163376All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium854Open in IMG/M
3300006793|Ga0098055_1167658All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300006802|Ga0070749_10044144All Organisms → Viruses → Predicted Viral2733Open in IMG/M
3300006802|Ga0070749_10229611All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300006802|Ga0070749_10334374All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium844Open in IMG/M
3300006802|Ga0070749_10678662Not Available552Open in IMG/M
3300006916|Ga0070750_10149940All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1055Open in IMG/M
3300006916|Ga0070750_10272598Not Available729Open in IMG/M
3300006919|Ga0070746_10005924All Organisms → cellular organisms → Bacteria7134Open in IMG/M
3300006920|Ga0070748_1094209All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300006920|Ga0070748_1118522Not Available999Open in IMG/M
3300006922|Ga0098045_1044509All Organisms → Viruses → Predicted Viral1111Open in IMG/M
3300006922|Ga0098045_1133116Not Available577Open in IMG/M
3300006924|Ga0098051_1085938All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium849Open in IMG/M
3300006924|Ga0098051_1150472Not Available615Open in IMG/M
3300006925|Ga0098050_1113896All Organisms → cellular organisms → Bacteria → Proteobacteria688Open in IMG/M
3300006925|Ga0098050_1124201All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium655Open in IMG/M
3300007234|Ga0075460_10241918Not Available604Open in IMG/M
3300007276|Ga0070747_1199451All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300007346|Ga0070753_1226353All Organisms → cellular organisms → Bacteria → Proteobacteria684Open in IMG/M
3300007540|Ga0099847_1136683All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300007543|Ga0102853_1008448All Organisms → cellular organisms → Bacteria → Proteobacteria1601Open in IMG/M
3300007550|Ga0102880_1079875Not Available863Open in IMG/M
3300007555|Ga0102817_1054092All Organisms → cellular organisms → Bacteria → Proteobacteria877Open in IMG/M
3300007715|Ga0102827_1131855All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium571Open in IMG/M
3300007955|Ga0105740_1045274All Organisms → cellular organisms → Bacteria → Proteobacteria684Open in IMG/M
3300007963|Ga0110931_1056425All Organisms → cellular organisms → Bacteria → Proteobacteria1186Open in IMG/M
3300008651|Ga0103623_1005441Not Available715Open in IMG/M
3300008961|Ga0102887_1011510All Organisms → Viruses → Predicted Viral3308Open in IMG/M
3300009059|Ga0102830_1244391Not Available524Open in IMG/M
3300009423|Ga0115548_1067706All Organisms → Viruses → Predicted Viral1221Open in IMG/M
3300009423|Ga0115548_1152460Not Available728Open in IMG/M
3300009426|Ga0115547_1244075Not Available561Open in IMG/M
3300009428|Ga0114915_1131499All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium722Open in IMG/M
3300009436|Ga0115008_10169731All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1578Open in IMG/M
3300009496|Ga0115570_10475987Not Available523Open in IMG/M
3300009599|Ga0115103_1128421All Organisms → Viruses → Predicted Viral1155Open in IMG/M
3300010149|Ga0098049_1028932All Organisms → Viruses → Predicted Viral1806Open in IMG/M
3300010149|Ga0098049_1060827All Organisms → Viruses → Predicted Viral1198Open in IMG/M
3300010150|Ga0098056_1046135All Organisms → Viruses → Predicted Viral1511Open in IMG/M
3300010150|Ga0098056_1279398All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium551Open in IMG/M
3300010368|Ga0129324_10166628All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium909Open in IMG/M
3300010392|Ga0118731_112909948All Organisms → Viruses → Predicted Viral1542Open in IMG/M
3300010392|Ga0118731_115400983Not Available575Open in IMG/M
3300010430|Ga0118733_108454475All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium532Open in IMG/M
3300011125|Ga0151663_1037715All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium656Open in IMG/M
3300011253|Ga0151671_1004106All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium653Open in IMG/M
3300011253|Ga0151671_1070163Not Available557Open in IMG/M
3300011258|Ga0151677_1038894All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-51794Open in IMG/M
3300011261|Ga0151661_1024802All Organisms → Viruses → Predicted Viral3396Open in IMG/M
3300012969|Ga0129332_1333171All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium627Open in IMG/M
3300017706|Ga0181377_1004812All Organisms → cellular organisms → Bacteria3661Open in IMG/M
3300017709|Ga0181387_1131572Not Available516Open in IMG/M
3300017724|Ga0181388_1073659Not Available816Open in IMG/M
3300017733|Ga0181426_1001286All Organisms → Viruses → Predicted Viral4973Open in IMG/M
3300017742|Ga0181399_1006462All Organisms → Viruses → Predicted Viral3574Open in IMG/M
3300017744|Ga0181397_1121022All Organisms → cellular organisms → Bacteria → Proteobacteria680Open in IMG/M
3300017746|Ga0181389_1021035All Organisms → Viruses → Predicted Viral2046Open in IMG/M
3300017749|Ga0181392_1007141All Organisms → cellular organisms → Bacteria3774Open in IMG/M
3300017749|Ga0181392_1043109All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300017752|Ga0181400_1186061Not Available577Open in IMG/M
3300017762|Ga0181422_1041156All Organisms → Viruses → Predicted Viral1496Open in IMG/M
3300017762|Ga0181422_1048607All Organisms → Viruses → Predicted Viral1364Open in IMG/M
3300017772|Ga0181430_1000781All Organisms → cellular organisms → Bacteria13527Open in IMG/M
3300017782|Ga0181380_1037807All Organisms → Viruses → Predicted Viral1754Open in IMG/M
3300017786|Ga0181424_10293828All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium675Open in IMG/M
3300020165|Ga0206125_10064321All Organisms → Viruses → Predicted Viral1695Open in IMG/M
3300020165|Ga0206125_10357068All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium537Open in IMG/M
3300020166|Ga0206128_1007432All Organisms → cellular organisms → Bacteria7608Open in IMG/M
3300020169|Ga0206127_1075028Not Available1546Open in IMG/M
3300020169|Ga0206127_1154423All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300021087|Ga0206683_10419766All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium667Open in IMG/M
3300021365|Ga0206123_10023924All Organisms → cellular organisms → Bacteria3558Open in IMG/M
3300021389|Ga0213868_10168342All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300021389|Ga0213868_10312029All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300021389|Ga0213868_10682496All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium526Open in IMG/M
3300022072|Ga0196889_1081137Not Available604Open in IMG/M
3300022178|Ga0196887_1094316Not Available678Open in IMG/M
3300022200|Ga0196901_1052449All Organisms → Viruses → Predicted Viral1518Open in IMG/M
3300022206|Ga0224499_10035253Not Available1615Open in IMG/M
(restricted) 3300022913|Ga0233404_10036790All Organisms → Viruses → Predicted Viral1113Open in IMG/M
(restricted) 3300023089|Ga0233408_10102734All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium603Open in IMG/M
(restricted) 3300023112|Ga0233411_10266731Not Available572Open in IMG/M
(restricted) 3300023210|Ga0233412_10072339Not Available1423Open in IMG/M
(restricted) 3300023276|Ga0233410_10179340All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium676Open in IMG/M
(restricted) 3300024059|Ga0255040_10031459All Organisms → Viruses → Predicted Viral1884Open in IMG/M
(restricted) 3300024059|Ga0255040_10324739All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium646Open in IMG/M
3300024343|Ga0244777_10010999Not Available5750Open in IMG/M
3300024343|Ga0244777_10051256All Organisms → Viruses → Predicted Viral2639Open in IMG/M
3300024343|Ga0244777_10219336All Organisms → Viruses → Predicted Viral1216Open in IMG/M
3300024346|Ga0244775_10044268All Organisms → Viruses → Predicted Viral3905Open in IMG/M
3300024346|Ga0244775_10500766Not Available992Open in IMG/M
3300024433|Ga0209986_10022246All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium4254Open in IMG/M
(restricted) 3300024517|Ga0255049_10551059All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium536Open in IMG/M
(restricted) 3300024519|Ga0255046_10609993All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium526Open in IMG/M
3300025057|Ga0208018_100516Not Available9860Open in IMG/M
3300025070|Ga0208667_1011838All Organisms → Viruses → Predicted Viral1947Open in IMG/M
3300025070|Ga0208667_1027095All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300025070|Ga0208667_1044538All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium737Open in IMG/M
3300025070|Ga0208667_1049538All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium683Open in IMG/M
3300025083|Ga0208791_1016759All Organisms → Viruses → Predicted Viral1565Open in IMG/M
3300025108|Ga0208793_1123570All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300025128|Ga0208919_1056928All Organisms → Viruses → Predicted Viral1326Open in IMG/M
3300025151|Ga0209645_1115483All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300025151|Ga0209645_1139407All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300025276|Ga0208814_1030052All Organisms → Viruses → Predicted Viral1729Open in IMG/M
3300025543|Ga0208303_1038236All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300025759|Ga0208899_1075191All Organisms → Viruses → Predicted Viral1336Open in IMG/M
3300025759|Ga0208899_1157925Not Available767Open in IMG/M
3300025769|Ga0208767_1011965Not Available5269Open in IMG/M
3300025889|Ga0208644_1082235All Organisms → Viruses → Predicted Viral1644Open in IMG/M
3300027828|Ga0209692_10167424All Organisms → Viruses → Predicted Viral1027Open in IMG/M
3300027833|Ga0209092_10015667All Organisms → cellular organisms → Bacteria5301Open in IMG/M
(restricted) 3300027837|Ga0255041_10016080All Organisms → cellular organisms → Bacteria2051Open in IMG/M
(restricted) 3300027861|Ga0233415_10118460All Organisms → Viruses → Predicted Viral1180Open in IMG/M
3300028284|Ga0257120_1013549All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-53045Open in IMG/M
3300032277|Ga0316202_10134473All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300032277|Ga0316202_10180398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptostreptococcaceae → Peptoanaerobacter → Peptoanaerobacter stomatis980Open in IMG/M
3300032373|Ga0316204_11318016All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium501Open in IMG/M
3300033742|Ga0314858_160621Not Available578Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.60%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.07%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater12.33%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.16%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.79%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater4.11%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine2.74%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment2.74%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.74%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.74%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat2.05%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.05%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.05%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine2.05%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.05%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.37%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.37%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.37%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.37%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.37%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.68%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.68%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.68%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.68%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.68%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.68%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.68%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.68%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.68%
North SeaEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000121Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3mEnvironmentalOpen in IMG/M
3300000131Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 02_11.3mEnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300004113Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005589Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2EnvironmentalOpen in IMG/M
3300005828Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBIEnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008651Microbial communities of saline water collected from the North Sea in Germany - HE327_13EnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011125Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, permeateEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300011261Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022206Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024433Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024517 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027828Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300028284Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1003570333300000115MarineMNLETSTYLNDIDRGDMDCKVGNEAPSDETEAYYIGYGARYVFEQMKSAGEFN*
DelMOSpr2010_1008169133300000116MarineQSIEFLNDLDRGDFDCRNGYPHKEGQSEAYDIGYGARYVFEQMQSAGVIE*
DelMOSpr2010_1015037333300000116MarineQSIEFLNDLDRGDFDCRNGYPHKEGQSEAYDIGYGARYVFEQMQSAGAIE*
DelMOSpr2010_1015392733300000116MarineMDKDIEYLNDLDRGDYDCRKGYPHKEGESEAYDIGYGARYVFEQMQSAGAIE*VIKNPYG
TDF_OR_ARG04_113mDRAFT_100551053300000121MarineMDIDYLNDLDRGDFDCREGYPHKEGQSNAYDIGYGARYVLEQMQSA
TDF_OR_ARG04_113mDRAFT_103029833300000121MarineMNLETSTYLDDIDRGDLDCKNGYEAPSDESEAYYIGYGARYVFEQMKSAGEFN*
TDF_MC_ARG02_113mDRAFT_101272123300000131MarineMDIDYLNDLDRGDFDCREGYPHKEGQSNAYDIGYGARYVLEQMQSAGEIK*
BBAY92_1007648533300000947Macroalgal SurfaceMDKDIDMNDLDRGDFDCRNGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE*
BBAY94_1017314713300000949Macroalgal SurfaceMDKDIEYLNDLDRGDFDCRNGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE*
JGI25132J35274_103291313300002483MarineMDKDIDFLNDLDRGDFDCRKGYPHKEGESEAYDIGYGARYVYEQMQSVGAIE*
JGI25132J35274_103714533300002483MarineMDQSIEFLNDLDRGDFDCRNGYPHKEGQSEAYDIGYGARYVFEQMQSAGVIE*
Ga0065183_1029874313300004113Pelagic MarineMDKDIEYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE*
Ga0066224_100500643300004457MarineMNLETSTYLNDIDRGDMDCKVGNEAPSDESEAYYIGYGARYVFEQMKSAGEFN*
Ga0066222_107374323300004460MarineMNLETSTYLNDIDRGDMDCKRGYEAPSDETEAYYIGYGARYVFEQMKSAGEFN*
Ga0070729_1024541513300005589Marine SedimentDLDRGEDDCRKGHPHKEGQSHAYDIGYGSRYVFEQMKSAGEFN*
Ga0074475_1013797723300005828Sediment (Intertidal)MDKDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVLEQMQLAGAIE*
Ga0070725_1035341323300005920Marine SedimentMDKDVEYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVLEQMQSAGAIE*
Ga0070743_10003011153300005941EstuarineMSVDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGSRYVLEQMQSAGVIND*
Ga0075441_1013088723300006164MarineMNLETSTYLNDIDRGDLDCKRGYEAPSDENEAYYIGYGARYVFEQMKSAGEFN*
Ga0099972_1229758433300006467MarineMDKDIEYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVFEQMQSAGEFN*
Ga0099972_1233634123300006467MarineMDKDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE*
Ga0098073_100740943300006734MarineMDKDIDFLNDLDRGDYDCRKGYPHKEGESEAYDIGYGARYVYEQMKSAGEFN*
Ga0098048_101313443300006752MarineMDKDIEYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVLEQMQSAGAIE*
Ga0098048_108337423300006752MarineMEKDIEFLNDLDRGDYDCRKGYPHKEGQSQAYDIGYGARYVFEQMQSVGEYN*
Ga0098048_109283123300006752MarineMEQDIEFLNDLDRGDYDCRKGYPHKEGQSQAYDIGYGARYVFDQMQSAGEYN*
Ga0098055_111471733300006793MarineLNDLDRGDYDASKGYPHKEGESQAYDMGYGFRYMIEQMETARSEK*
Ga0098055_116337623300006793MarineMEKDIEFLNDLDRGDYDCRHGYDHKEGQSQAYDIGYGARYVLEQMQSAGEIN*
Ga0098055_116765823300006793MarineMDDREFLNDLDRGDYDASKGYPHKEGESQAYDMGYGFRYMIEQMETARSEQ*
Ga0070749_1004414453300006802AqueousMDKDIEYLNDLDRGDYDCREGYPHKEGQSHAYDIGYGARYVFEQMKSAGEFN*
Ga0070749_1022961153300006802AqueousMDKDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSAGE
Ga0070749_1033437413300006802AqueousELHLTDLDRGDDDCRKGHPHKEGQSHAYDIGYGSRYVFEQMKSAGEFN*
Ga0070749_1067866223300006802AqueousMDKDIDYLNDLDRGDYDCRKGFPHKEGQSHAYDIGYGARYVLEQMQSAGAIE*
Ga0070750_1014994043300006916AqueousMDKDIEYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVLEQMQSAGEFN*
Ga0070750_1027259833300006916AqueousMDQSIEFLNDLDRGDFDCRNGYPHKEGQSEAYDIGYGARYVFEQMQSAGAIE*
Ga0070746_10005924103300006919AqueousVDKDIDFLNDLDRGDYDCRKGYPHKEGESEAYDIGYGARYVYEQMKSAGEFN*
Ga0070748_109420913300006920AqueousMDKDIDYLNDLDRGDYDCRNGHPHKEGQSHAYDIGYGARYVLEQMQSAGEFN*
Ga0070748_111852213300006920AqueousMDKDVEYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVLEQMQSAGEFN*
Ga0098045_104450933300006922MarineMDDKEFLNDLDRGDYDASKGYPHKEGESQAYDMGYGFRYMIEQMETARSEQ*
Ga0098045_113311613300006922MarineMDDREFLNDLDRGDYDASKGYPHKEGESQAYDMGYGCRYMIEQMETARSEQ*
Ga0098051_108593823300006924MarineMSYINNITWYSKMEKDIEFLNDLDRGDYDCRHGYDHKEGQSQAYDIGYGARYVLEQMQSAGEIN*
Ga0098051_115047223300006924MarineMEKDIEFLNDLDRGDYDCHKGYPHKEGQSQAYDIGYGARYVFEQMQSVGEYN*
Ga0098050_111389623300006925MarineMDKDIEYLNDLDRGDYDCRNGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE*
Ga0098050_112420113300006925MarineSKMEKDIEFLNDLDRCDYDCRKGYPHKEGQSQAYDIGYGARYVFEQMQSVGEYN*
Ga0075460_1024191833300007234AqueousMDKDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSAGEYND*
Ga0070747_119945113300007276AqueousMDKDIEYLNDLDRGDFDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE*
Ga0070753_122635313300007346AqueousMDKDIEYLNDLDRGDYDCREGYPHKEGQSHAYDIGYGARYVLEQMKSSGEFN*
Ga0099847_113668313300007540AqueousNQEFLNDLDRGDFDCRHGYPHREGESEAYDIGYGARYVFEQMQSAGAIE*
Ga0102853_100844833300007543EstuarineMDKDIDYLNDLDRGEFDCREGYPHKEGQSQAYDIGYGARYVLEQMQLAGAIE*
Ga0102880_107987533300007550EstuarineMDKDIDYLNDLDRGDFDSREGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE*
Ga0102817_105409223300007555EstuarineMMDKDIDYLNDLDRGEFDCREGYPHKEGQSQAYDIGYGARYVLEQMQSAGAIE*
Ga0102827_113185523300007715EstuarineYVKAAWFGARIMSVDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGSRYVLEQMQSAGVIND*
Ga0105740_104527413300007955Estuary WaterNDLDRGEFDCREGYPHKEGQSQAYDIGYGARYVLEQMQSAGAIE*
Ga0110931_105642533300007963MarineMLRKKKMDDKEFLNDLDRGDYDASKGYPHKEGESQAYDMGYGFRYMIEQNETARSEQ*
Ga0103623_100544123300008651North SeaMNDKDFLNDLDRGDYDASKGYPHQEGESQAYDMGYAFRYMIEQMETARSEQ*
Ga0102887_101151083300008961EstuarineDLERGDIDCKNGDPAPDNQSEAYYIGYGARYVYEQTKSAGEFN*
Ga0102830_124439113300009059EstuarineMKEVQGIEYLNDLDRGDIDCKNGDPAPDNQSEAYYIGYGARYVYEQTKSAGEFN*
Ga0115548_106770643300009423Pelagic MarineMNLETSTYLNDIDRGDMDCKMGNEAPSDETEAYYIGYGARYVFEQMKSAG
Ga0115548_115246013300009423Pelagic MarineMDKDIEYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGSRYVFEQMKSAGE
Ga0115547_124407533300009426Pelagic MarineMDKDIEYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGSRYVFEQMKSAGEFN*
Ga0114915_113149923300009428Deep OceanMDKDIDYLNDLDRGECDCREGYPHKEGQSNAYDIGYGARYVLEQMQSAGEIK*
Ga0115008_1016973133300009436MarineMNLETSTYLDDIDRGDLDCKSGYEAPSDESEAYYIGYGARYVFEQMKSAGEFN*
Ga0115570_1047598733300009496Pelagic MarineMDADTEYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGSRYVFEQMKSAGEFN*
Ga0115103_112842133300009599MarineMNDKEFLNDLDRGDYDASKGYPHKEGESQAYDMGYAFRYMIEQMETARSEQ*
Ga0098049_102893213300010149MarineREFLNDLDRGDYDASKGYPHKEGESQAYDMGYGFRYMIEQNETARSEQ*
Ga0098049_106082713300010149MarineMEKDIEFLNDLDRGDYDCRKGYPHKEGQSQAYDIGYGARYVFEQMQSAGEYN*
Ga0098056_104613523300010150MarineMDDREFLNDLDRGDYDASKGYPHKEGESQAYDMGYGFRYMIEQNETARSEQ*
Ga0098056_127939823300010150MarineMEQDIEFLNDLDRGDYDCRHGYDHKEGQSQAYDIGYGARYVLEQMQSAGEIN*
Ga0129324_1016662823300010368Freshwater To Marine Saline GradientMMDKDIDFLNDLDRGDYDCRKGYPHKEGESEAYDIGYGARYVYEQMKSAGEFN*
Ga0118731_11290994843300010392MarineEYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVLEQMQSAGEFN*
Ga0118731_11540098333300010392MarineMDKDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVFEQMQSAGEFN*
Ga0118733_10845447533300010430Marine SedimentYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVLEQMQSAGEFN*
Ga0151663_103771523300011125MarineVNKDIDYLNDLDRGDFDCREGYPHKEGQSHAYDIGYGARYVLEQMLSAGGIEE*
Ga0151671_100410623300011253MarineMDKDIEYLNDLDRGDFDSRKGYPHKEGQSHAYDIGYGARYVLEQILSEGGIEE*
Ga0151671_107016323300011253MarineMDKDIDYLNDLDRGDFDCREGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE*
Ga0151677_103889423300011258MarineMDKDIEYLNDLDRGDFDSRKGYPHKEGQSHAYDIGYGARYVFEQILSEGVIEE*
Ga0151661_102480273300011261MarineMDKDIEYLNDLDRGDYDSRKGYPHQEGQSHAYDIEYGARYVLEQILSEGGIKE*
Ga0129332_133317113300012969AqueousETSTYLNDIDRGDMDCKVGNEAPSDETEAYYIGYGARYVFEQMKSAGEFN*
Ga0181377_100481263300017706MarineMDKDIDYLNDLDRGDFDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE
Ga0181387_113157213300017709SeawaterMDKDIEYLNDLDRGDYDCRKVYPHKEGQSHAYDIGYGARYVFEQMQSAGAIE
Ga0181388_107365913300017724SeawaterMDKDIEYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE
Ga0181426_100128673300017733SeawaterMDKDIEYLNDLDRGDFDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE
Ga0181399_1006462103300017742SeawaterKIVLSLNTISESSQMDKDIEYLNDLDRGDYDCRKGYPHKEGESEAYDIAYGARYVYEQMQSPEEFN
Ga0181397_112102223300017744SeawaterMDKDIEYLNDLDRGDYDCREGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE
Ga0181389_102103553300017746SeawaterMDKDIEYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGSRYVFEQMQSAGEFN
Ga0181392_100714143300017749SeawaterMDKDIEYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYIFEQMQSAGEFN
Ga0181392_104310933300017749SeawaterMDKDIDYLNDLDRGDFDCREGYPHKEGQSHAYDIGYGARYVLEQMQSSGAIE
Ga0181400_118606113300017752SeawaterMDKDIDYLNDLDRGDYDCRNGYPHKEGQSHAYDIGYGARYVLEQMQSAGEFN
Ga0181422_104115623300017762SeawaterMDKDIEYLNDLDRGDYDCREGYPHKEGQSHAYDIGYGARYVFEQMQSAGEIE
Ga0181422_104860733300017762SeawaterIDYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVLEQMQSAGEIE
Ga0181430_1000781163300017772SeawaterMSDKEFLNDLDRGDYDASKGYPHKEGESQAYDMGYAFRYMIEQMETARSEQ
Ga0181380_103780733300017782SeawaterMNDKEFLNDLDRGDYDASKGYPHKEGESQAYDMGYAFRYMIEQMETARSEQ
Ga0181424_1029382823300017786SeawaterVDKDIDYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVFEQMQSAGAIE
Ga0206125_1006432133300020165SeawaterMDKDIEYLNDLDRGDYDCRNGYPHKEGQSHAYNIGYGARYVLEQMQSAGAIE
Ga0206125_1035706813300020165SeawaterTDLDRGDDDCRKGHPHKEGQSNAYDIGYGSRYVFEQMKSAGEFN
Ga0206128_1007432153300020166SeawaterMNLETSTYLNDIDRGDMDCKVGNEAPSDETEAYYIGYGARYVFEQMKSAGEFN
Ga0206127_107502813300020169SeawaterMDDREFLNDIDRGDYDASKGYPHKEGESPAYDMGYGFRYMIEQMETARSEK
Ga0206127_115442323300020169SeawaterMDDREFLNDIDRGDYDASKGYPHKEGESPAYDMGYGFRYMIEQMETARSEQ
Ga0206683_1041976613300021087SeawaterMNEVQGIEYLNDLDRGDIDCKNGDPAPDNQSEAYYIGYGARYVYEQTKSAGEFN
Ga0206123_1002392483300021365SeawaterMDKDIEYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSAGEFN
Ga0213868_1016834243300021389SeawaterMNLETSTYLDDIDRGDMDCKVGNEAPSDETEAYYIGYGARYVFEQMKSAGEFN
Ga0213868_1031202943300021389SeawaterMNIEAATFLSDIDRGDMDCKKGYEAPSDETEAYYIGYGARYVFEQMKSAGEFN
Ga0213868_1068249623300021389SeawaterMDKDIEYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVFEQMKSAGEFN
Ga0196889_108113733300022072AqueousMDKDIDYLNDLDRGDYDCRNGHPHKEGQSHAYDIGYGARYVLEQMQSAGEFN
Ga0196887_109431633300022178AqueousMDKDVEYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVLE
Ga0196901_105244943300022200AqueousMDKDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSAGEYND
Ga0224499_1003525353300022206SedimentMKEVQGIEYLNDLDRGDIDCKNGDPAPDNQSEAYYIGYGARYVYEQTKSAGEFN
(restricted) Ga0233404_1003679043300022913SeawaterMSVDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGSRYVLEQMQSAGVIND
(restricted) Ga0233408_1010273423300023089SeawaterLESSQMDKDIDYLNDLDRGDYDCRNGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE
(restricted) Ga0233411_1026673123300023112SeawaterVDKDIDYLNDLDRGDYDCREGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE
(restricted) Ga0233412_1007233913300023210SeawaterMDKDIDYLNDLDRGDYDCREGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE
(restricted) Ga0233410_1017934013300023276SeawaterNDLERGDIDCKNGDPAPDNQSEAYYIGYGARYVYEQTKSAGEFN
(restricted) Ga0255040_1003145933300024059SeawaterMDKDIEFLSDLDRGDYDCRKGYPHKEGQSQAYDIGYGARYVFEQMQSAGEYN
(restricted) Ga0255040_1032473933300024059SeawaterRMMSKDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSSQTEAGAIE
Ga0244777_10010999103300024343EstuarineMDKDIDYLNDLDRGEFDCREGYPHKEGQSQAYDIGYGARYVLEQMQLAGAIE
Ga0244777_1005125663300024343EstuarineNDLERGDIDCKNGDPAPDNQSEAYYIGYGARYVYEQTKSAGELN
Ga0244777_1021933633300024343EstuarineMDKDIDYLNDLDRGDFDSREGYPHKEGQSHAYDIGYGARYVLEQMQSAGAIE
Ga0244775_1004426883300024346EstuarineMMDKDIDYLNDLDRGEFDCREGYPHKEGQSQAYDIGYGARYVLEQMQSAGAIE
Ga0244775_1050076623300024346EstuarineMDDKEFLNDLDRGDYDASKGYPHKEGESQAYDMGYAFRYMIEQMETARSEQ
Ga0209986_1002224693300024433Deep SubsurfaceMDKDIDFLNDLDRGDYDCRKGYPHKEGESEAYDIGYGARYVYEQMQSAGEFN
(restricted) Ga0255049_1055105923300024517SeawaterIMSVDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGSRYVLEQMQSAGVIND
(restricted) Ga0255046_1060999323300024519SeawaterARIMSVDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGSRYVLEQMQSAGVIND
Ga0208018_100516173300025057MarineVMDKDIDFLNDLDRGDYDCRKGYPHKEGESEAYDIGYGARYVYEQMKSAGEFN
Ga0208667_101183843300025070MarineMDDREFLNDLDRGDYDASKGYPHKEGESQAYDMGYGFRYMIEQNETARSEQ
Ga0208667_102709533300025070MarineMDDREFLNDLDRGDYDASKGYPHKEGESQAYDMGYGFRYMIEQMETARSEQ
Ga0208667_104453823300025070MarineMDKDIEYLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVLEQMQSAGAIE
Ga0208667_104953813300025070MarineYINNITWYSKMEKDIEFLNDLDRGDYDCRHGYDHKEGQSQAYDIGYGARYVLEQMQSAGEIN
Ga0208791_101675923300025083MarineMEKDIEFLNDLDRGDYDCRKGYPHKEGQSQAYDIGYGARYVFEQMQSVGEYN
Ga0208793_112357013300025108MarineMDDREFLNDLDRGDYDASKGYPHKEGESQAYDMGYGFRYMIEQMETARSEK
Ga0208919_105692823300025128MarineMDDKEFLNDLDRGDYDASKGYPHKEGESQAYDMGYGFRYMIEQNETARSEQ
Ga0209645_111548323300025151MarineMDKDIDFLNDLDRGDFDCRKGYPHKEGESEAYDIGYGARYVYEQMQSVGAIE
Ga0209645_113940723300025151MarineMDQSIEFLNDLDRGDFDCRNGYPHKEGQSEAYDIGYGARYVFEQMQSAGVIE
Ga0208814_103005233300025276Deep OceanMNLETSTYLNDIDRGDLDCKRGYEAPSDENEAYYIGYGARYVFEQMKSAGEFN
Ga0208303_103823613300025543AqueousLETSTYLNDIDRGDMDCKVGNEAPSDETEAYYIGYGARYVFEQMKSAGEFN
Ga0208899_107519143300025759AqueousMDKDIDFLNDLDRGDYDCRKGYPHKEGESEAYDIGYGARYVYEQMKSAGEFN
Ga0208899_115792533300025759AqueousMDQSIEFLNDLDRGDFDCRNGYPHKEGQSEAYDIGYGARYVFEQMQSAGAIE
Ga0208767_1011965123300025769AqueousVDKDIDFLNDLDRGDYDCRKGYPHKEGESEAYDIGYGARYVYEQMKSAGEFN
Ga0208644_108223543300025889AqueousMDKDIEYLNDLDRGDYDCREGYPHKEGQSHAYDIGYGARYVFEQMKSAGEFN
Ga0209692_1016742433300027828Marine SedimentTDLDRGEDDCRKGHPHKEGQSHAYDIGYGSRYVFEQMKSAGEFN
Ga0209092_1001566753300027833MarineMNLETSTYLDDIDRGDLDCKSGYEAPSDESEAYYIGYGARYVFEQMKSAGEFN
(restricted) Ga0255041_1001608033300027837SeawaterMKEVQGIEYLNDLDRGDIDCKNGDPAPDNQSEAYYIGYGARYVYEQTKSAGELN
(restricted) Ga0233415_1011846023300027861SeawaterMNDEEFLNDLDRGDYDASKGYPHKEGESQAYDMGYAFRYMIEQMETARSEQ
Ga0257120_101354933300028284MarineVDKDIDYLNDLDRGDYDCRKGYPHKEGQSHAYDIGYGARYVLEQMQSSQTETGEIE
Ga0316202_1013447313300032277Microbial MatNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVLEQMQSAGEFN
Ga0316202_1018039813300032277Microbial MatMEQDIEFLNDLDRGDYDCRKGYPHKEGQSQAYDIGYGARYVLEQMQSAG
Ga0316204_1131801613300032373Microbial MatLNDLDRGDYDCRKGHPHKEGQSHAYDIGYGARYVLEQMQSAGAIE
Ga0314858_160621_165_3203300033742Sea-Ice BrineMNDKDFLNDLDRGDYDASRGYPHKEGESQAYDMGYAFRYMIEQMETARSEQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.