NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F049539

Metagenome Family F049539

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049539
Family Type Metagenome
Number of Sequences 146
Average Sequence Length 40 residues
Representative Sequence INRIEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKAQ
Number of Associated Samples 130
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.63 %
% of genes from short scaffolds (< 2000 bps) 96.58 %
Associated GOLD sequencing projects 127
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (42.466 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(8.219 % of family members)
Environment Ontology (ENVO) Unclassified
(35.616 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(35.616 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.31%    β-sheet: 0.00%    Coil/Unstructured: 62.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF00227Proteasome 81.51
PF01494FAD_binding_3 8.90
PF13450NAD_binding_8 2.05
PF05834Lycopene_cycl 1.37
PF13098Thioredoxin_2 0.68
PF00535Glycos_transf_2 0.68
PF13421Band_7_1 0.68
PF01266DAO 0.68
PF00175NAD_binding_1 0.68
PF13211DUF4019 0.68
PF00890FAD_binding_2 0.68
PF02777Sod_Fe_C 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG063820S proteasome, alpha and beta subunitsPosttranslational modification, protein turnover, chaperones [O] 81.51
COG3484Predicted proteasome-type proteasePosttranslational modification, protein turnover, chaperones [O] 81.51
COG5405ATP-dependent protease HslVU (ClpYQ), peptidase subunitPosttranslational modification, protein turnover, chaperones [O] 81.51
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 17.81
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 8.90
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 8.90
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 8.90
COG0605Superoxide dismutaseInorganic ion transport and metabolism [P] 0.68

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.96 %
UnclassifiedrootN/A39.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004048|Ga0055494_10052187Not Available790Open in IMG/M
3300004067|Ga0055485_10071334Not Available834Open in IMG/M
3300004463|Ga0063356_103245860Not Available701Open in IMG/M
3300004782|Ga0062382_10051672All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1514Open in IMG/M
3300005172|Ga0066683_10273847All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1048Open in IMG/M
3300005218|Ga0068996_10081988Not Available697Open in IMG/M
3300005338|Ga0068868_100064956All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2898Open in IMG/M
3300005355|Ga0070671_100168356All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1853Open in IMG/M
3300005456|Ga0070678_101836672All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium572Open in IMG/M
3300005539|Ga0068853_100981326All Organisms → cellular organisms → Bacteria → Proteobacteria813Open in IMG/M
3300005616|Ga0068852_100613985All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1093Open in IMG/M
3300005617|Ga0068859_100527875All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales1275Open in IMG/M
3300005719|Ga0068861_101085392Not Available768Open in IMG/M
3300005841|Ga0068863_100205911All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1893Open in IMG/M
3300005843|Ga0068860_100820488All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300005879|Ga0075295_1064519Not Available512Open in IMG/M
3300005887|Ga0075292_1052871Not Available591Open in IMG/M
3300006056|Ga0075163_10873121All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales936Open in IMG/M
3300006755|Ga0079222_11849538All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri586Open in IMG/M
3300006804|Ga0079221_10488435Not Available795Open in IMG/M
3300006903|Ga0075426_10693086All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri764Open in IMG/M
3300006954|Ga0079219_10000587All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria7731Open in IMG/M
3300007258|Ga0099793_10517881All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria593Open in IMG/M
3300009137|Ga0066709_102076916All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri786Open in IMG/M
3300009147|Ga0114129_11985440All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri704Open in IMG/M
3300009176|Ga0105242_10901439Not Available884Open in IMG/M
3300009177|Ga0105248_12753218All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300009551|Ga0105238_11914159All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri626Open in IMG/M
3300010051|Ga0133939_1050047All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales9306Open in IMG/M
3300010373|Ga0134128_12187668All Organisms → cellular organisms → Eukaryota609Open in IMG/M
3300010401|Ga0134121_10781138Not Available915Open in IMG/M
3300010401|Ga0134121_10805795Not Available903Open in IMG/M
3300012200|Ga0137382_11228285All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300012351|Ga0137386_10367162Not Available1036Open in IMG/M
3300012680|Ga0136612_10131700All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1271Open in IMG/M
3300012957|Ga0164303_11187362All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri557Open in IMG/M
3300012984|Ga0164309_11195216Not Available638Open in IMG/M
3300012985|Ga0164308_11237543Not Available675Open in IMG/M
3300013102|Ga0157371_10428530All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria970Open in IMG/M
3300013105|Ga0157369_12587911All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300013297|Ga0157378_12022533All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri626Open in IMG/M
3300013306|Ga0163162_10432017All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1449Open in IMG/M
3300013306|Ga0163162_11765428Not Available707Open in IMG/M
3300013306|Ga0163162_12591411All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri583Open in IMG/M
3300014885|Ga0180063_1245568Not Available573Open in IMG/M
3300014968|Ga0157379_10852771Not Available862Open in IMG/M
3300014968|Ga0157379_11485827Not Available659Open in IMG/M
3300015085|Ga0167632_1005705All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1802Open in IMG/M
3300015373|Ga0132257_101088287Not Available1008Open in IMG/M
3300015374|Ga0132255_103304633Not Available687Open in IMG/M
3300015374|Ga0132255_103634198All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri656Open in IMG/M
3300017659|Ga0134083_10550627Not Available522Open in IMG/M
3300017961|Ga0187778_10096924All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1830Open in IMG/M
3300018074|Ga0184640_10475287All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium553Open in IMG/M
3300018481|Ga0190271_10888894Not Available1015Open in IMG/M
3300018482|Ga0066669_10381415All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1185Open in IMG/M
3300018482|Ga0066669_10601604All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria964Open in IMG/M
3300019879|Ga0193723_1100394All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300021178|Ga0210408_10712890Not Available790Open in IMG/M
3300021405|Ga0210387_11825611All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria512Open in IMG/M
3300021432|Ga0210384_11070902All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri709Open in IMG/M
3300021445|Ga0182009_10314063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae793Open in IMG/M
3300022214|Ga0224505_10264115Not Available654Open in IMG/M
3300022889|Ga0247785_1013974All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria849Open in IMG/M
3300025315|Ga0207697_10043688All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1843Open in IMG/M
3300025893|Ga0207682_10451621All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri608Open in IMG/M
3300025911|Ga0207654_10233250All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1227Open in IMG/M
3300025913|Ga0207695_11680848All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300025919|Ga0207657_10674168Not Available804Open in IMG/M
3300025922|Ga0207646_10860258Not Available806Open in IMG/M
3300025925|Ga0207650_11864827All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria508Open in IMG/M
3300025931|Ga0207644_10557206Not Available949Open in IMG/M
3300025936|Ga0207670_11662139Not Available543Open in IMG/M
3300025936|Ga0207670_11781397All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium524Open in IMG/M
3300025937|Ga0207669_10429096All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1042Open in IMG/M
3300025945|Ga0207679_10881114Not Available818Open in IMG/M
3300025949|Ga0207667_10834273All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria917Open in IMG/M
3300025960|Ga0207651_10015691All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4412Open in IMG/M
3300025981|Ga0207640_12080261All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300026088|Ga0207641_10331397All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1446Open in IMG/M
3300026088|Ga0207641_11135972Not Available780Open in IMG/M
3300026089|Ga0207648_11550665Not Available623Open in IMG/M
3300026121|Ga0207683_10792267Not Available880Open in IMG/M
3300026294|Ga0209839_10245294All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri563Open in IMG/M
3300026537|Ga0209157_1157141All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1014Open in IMG/M
3300027543|Ga0209999_1093528All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri583Open in IMG/M
3300027716|Ga0209682_10051976All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales994Open in IMG/M
3300027783|Ga0209448_10051095Not Available1391Open in IMG/M
3300027871|Ga0209397_10262396Not Available816Open in IMG/M
3300027885|Ga0209450_10703812Not Available733Open in IMG/M
3300027897|Ga0209254_10761951All Organisms → cellular organisms → Eukaryota660Open in IMG/M
3300027902|Ga0209048_10911725All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri567Open in IMG/M
3300028380|Ga0268265_10402308All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1266Open in IMG/M
3300028592|Ga0247822_10960723Not Available704Open in IMG/M
3300028596|Ga0247821_10417586Not Available840Open in IMG/M
3300028596|Ga0247821_10968409All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri569Open in IMG/M
3300028741|Ga0302256_10149751All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → environmental samples → uncultured Ramlibacter sp.630Open in IMG/M
3300028809|Ga0247824_10955181All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri539Open in IMG/M
3300028868|Ga0302163_10061858Not Available903Open in IMG/M
3300028869|Ga0302263_10337432All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium597Open in IMG/M
3300029984|Ga0311332_10540702All Organisms → cellular organisms → Bacteria → Proteobacteria917Open in IMG/M
3300029999|Ga0311339_11124149All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri725Open in IMG/M
3300030047|Ga0302286_10190232All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1037Open in IMG/M
3300030114|Ga0311333_10582659Not Available924Open in IMG/M
3300030114|Ga0311333_10732492Not Available826Open in IMG/M
3300030294|Ga0311349_10888781Not Available837Open in IMG/M
3300030294|Ga0311349_10917136Not Available823Open in IMG/M
3300030294|Ga0311349_11135088All Organisms → cellular organisms → Bacteria → Proteobacteria730Open in IMG/M
3300030294|Ga0311349_11691110Not Available585Open in IMG/M
3300030838|Ga0311335_11211861Not Available542Open in IMG/M
(restricted) 3300031248|Ga0255312_1115578Not Available659Open in IMG/M
3300031707|Ga0315291_11047974Not Available682Open in IMG/M
3300031746|Ga0315293_11300624All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium500Open in IMG/M
3300031751|Ga0318494_10827563All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium542Open in IMG/M
3300031777|Ga0318543_10142107All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1051Open in IMG/M
3300031777|Ga0318543_10188308Not Available915Open in IMG/M
3300031819|Ga0318568_10816298All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri578Open in IMG/M
3300031820|Ga0307473_10290709All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1023Open in IMG/M
3300031824|Ga0307413_10352477All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1136Open in IMG/M
3300031873|Ga0315297_10589511Not Available934Open in IMG/M
3300031893|Ga0318536_10671578Not Available516Open in IMG/M
3300031903|Ga0307407_11424384All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium546Open in IMG/M
3300031954|Ga0306926_11110898All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300031954|Ga0306926_12657584All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria545Open in IMG/M
3300031995|Ga0307409_101075504Not Available825Open in IMG/M
3300031997|Ga0315278_11976324Not Available545Open in IMG/M
3300032008|Ga0318562_10722958All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri572Open in IMG/M
3300032025|Ga0318507_10407271All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri592Open in IMG/M
3300032053|Ga0315284_11593420Not Available687Open in IMG/M
3300032075|Ga0310890_11457751All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium563Open in IMG/M
3300032143|Ga0315292_10899344Not Available738Open in IMG/M
3300032163|Ga0315281_10452271All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1375Open in IMG/M
3300032163|Ga0315281_11660298All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri621Open in IMG/M
3300032177|Ga0315276_10149601All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2422Open in IMG/M
3300032205|Ga0307472_101473495Not Available663Open in IMG/M
3300032516|Ga0315273_11140882All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300032828|Ga0335080_12410999All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria501Open in IMG/M
3300032955|Ga0335076_10683821Not Available908Open in IMG/M
3300033004|Ga0335084_11829985All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri594Open in IMG/M
3300033413|Ga0316603_12067732All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri538Open in IMG/M
3300033482|Ga0316627_102754032Not Available522Open in IMG/M
3300033521|Ga0316616_102002444Not Available767Open in IMG/M
3300033557|Ga0316617_102343852All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium552Open in IMG/M
3300033805|Ga0314864_0171889All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri558Open in IMG/M
3300034354|Ga0364943_0052593All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1350Open in IMG/M
3300034965|Ga0370497_0150375All Organisms → cellular organisms → Eukaryota583Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen8.22%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment6.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.42%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.74%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.05%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.05%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.05%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.05%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.05%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.05%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.05%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.05%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.37%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.37%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.37%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.37%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.37%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.37%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.68%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.68%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.68%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.68%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.68%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.68%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.68%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.68%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.68%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.68%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.68%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.68%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Industrial WastewaterEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater0.68%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004048Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2EnvironmentalOpen in IMG/M
3300004067Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005879Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301EnvironmentalOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300006056Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNAEngineeredOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010051Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196EngineeredOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015085Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022889Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027716Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028741Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034965Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0055494_1005218723300004048Natural And Restored WetlandsINRIEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKAQ*
Ga0055485_1007133413300004067Natural And Restored WetlandsLLNLINRIEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKAQ*
Ga0063356_10324586013300004463Arabidopsis Thaliana RhizosphereNAITRIETLGKAVQITGATPIVRALLLLIGISPRHFVKKVD*
Ga0062382_1005167233300004782Wetland SedimentLLNTINRIEKQRRSVQIVGASPIVRALLLLIGISPRHFVKKSE*
Ga0066683_1027384713300005172SoilLNSISNTESQRKTVQIMGASPIIRALLLLIGISPRHFIKKAQ*
Ga0068996_1008198823300005218Natural And Restored WetlandsLNAINRVEAQRKAVQILGVSPIVRALLLLIGISPRHFLKKAQ*
Ga0068868_10006495613300005338Miscanthus RhizosphereAIGRVEQQRKAVQIMGASPIIRALLLLIGISPRHFLKKPQ*
Ga0070671_10016835613300005355Switchgrass RhizosphereLLNLIGRIESQHKSVQIIGASPIIRALLLLIGVSPRHFLKKAQ*
Ga0070678_10183667223300005456Miscanthus RhizosphereMLNTINRIEAQRKSVQISGASPIIRALLLLIGISPRHFVRKAA*
Ga0068853_10098132633300005539Corn RhizosphereALFNTISRVEAQGKAVQIVGASPIVRALLLLIGISPRHFVKKGE*
Ga0068852_10061398513300005616Corn RhizosphereINRIEGQRKSVQISGASPIIRALLLLIGISPRHFVRKAA*
Ga0068859_10052787533300005617Switchgrass RhizosphereRIELQRKTVQIVGASPIIRALLLLIGVSPRHFVKKPQ*
Ga0068861_10108539223300005719Switchgrass RhizosphereLLNAITRIETLGKAVQITGTSPIVRALLLLIGISPRHFVKKVD*
Ga0068863_10020591113300005841Switchgrass RhizosphereLNLIGRIESQHKSVQIVGASPIIRALLLLIGVSPRHFVKKPQ*
Ga0068860_10082048813300005843Switchgrass RhizosphereALLNLINRIESQRKAVQIVGASAIIRALLLLIGVSPRHFVKKPQ*
Ga0075295_106451923300005879Rice Paddy SoilITRIEAQGKAVQIAGASPIVRALLLLIGISPRHFVKKTG*
Ga0075292_105287113300005887Rice Paddy SoilNTITRIEAQGKAVQIAGASPIVRALLLLIGISPRHFVKKTG*
Ga0075163_1087312113300006056Wastewater EffluentLLNAISRVEAQRKAVQIVGAAPIVRALLMLIGISPRHFLKKPQ*
Ga0079222_1184953823300006755Agricultural SoilALANAISRIESQGKGVQIFGATPIVRALLLLIGISPRHFVKKTA*
Ga0079221_1048843533300006804Agricultural SoilEGQRKTVQIIGASPILRALLLLIGISPRHFVKKAA*
Ga0075426_1069308613300006903Populus RhizosphereLLNTINRIEAQRKTVQLMGASPIIRALLLLIGISPRHFVKKAE*
Ga0079219_1000058713300006954Agricultural SoilNAITRIEGQGKAVQILGATPIVRALLLLIGISPRHFVKKAG*
Ga0099793_1051788123300007258Vadose Zone SoilRAESQRKGVQIIGASPIIRALLLLIGISPRHFVKKSQ*
Ga0066709_10207691623300009137Grasslands SoilNAIIRAEGQRKTVQIAGATPIIRALLLLIGISPRHFIKKPQ*
Ga0114129_1198544023300009147Populus RhizosphereLNAVIRAEGQRKTVQIAGASPIIRALLLLIGISPRHFIKKPQ*
Ga0105242_1090143933300009176Miscanthus RhizosphereALLNAITRIETLGKAVQITGATPIVRALLLLIGISPRHFVKKVD*
Ga0105248_1275321823300009177Switchgrass RhizosphereLNAIDKIESQRKTVHIVGASPIIRALLLLIGISPRHFVKSSA*
Ga0105238_1191415923300009551Corn RhizosphereLLNAITRIETLGKAVQIIGATPIVRALLLLIGISPRHFVKKAD*
Ga0133939_105004793300010051Industrial WastewaterXRVEGQRKAVQIVGASPIIRALLLLIGISPRHFLKKPQ*
Ga0134128_1218766813300010373Terrestrial SoilITRIEGQRKTVQIIGASPILRALLLLIGISPRHFVKKAA*
Ga0134121_1078113813300010401Terrestrial SoilNKLENQRKVVQIFGATPIICGILLLIGVPPGHFVKKPA*
Ga0134121_1080579513300010401Terrestrial SoilNAINRVEAQRKAVQFLGVSPIVRALLLLIGISPRHFLKKAQ*
Ga0137382_1122828523300012200Vadose Zone SoilIEGQRKTVQIIGASPIVRALLLLIGISPRHFVKKPA*
Ga0137386_1036716213300012351Vadose Zone SoilTESQRKTVQIAGASPIIRALLLLIGISPRHFIKTAQ*
Ga0136612_1013170033300012680Polar Desert SandNRIEAQRKAVQVLGASPIIRALLLLIGLSPRHFVKKVG*
Ga0164303_1118736223300012957SoilAIGRIEAQGRAVQIVGATPIVRALLLLIGISPRHFVKKSE*
Ga0164309_1119521623300012984SoilAMLNTITRIESQRKSVQISGASPIIRALLLLIGISPRHFVKKSD*
Ga0164308_1123754313300012985SoilNRIESQRKAVQIIGASPIIRALLLLIGISPRHFLKRAT*
Ga0157371_1042853013300013102Corn RhizosphereSRAETQRKSIQIVGASPIIRALLLLIGISPRHFIKKAT*
Ga0157369_1258791123300013105Corn RhizosphereITRIETLGKAVQITGATPIVRALLLLIGISPRHFVKKVD*
Ga0157378_1202253313300013297Miscanthus RhizosphereIEAQRKAVQIVGVTPIIRALLLLLGVSPRHFVKKAE*
Ga0163162_1043201733300013306Switchgrass RhizosphereNAIDKIESQRKTVHIVGASPIIRALLLLIGISPRHFVKSSA*
Ga0163162_1176542813300013306Switchgrass RhizosphereRIESQRKAVQIVGASAIIRALLLLIGVSPRHFVKKPQ*
Ga0163162_1259141123300013306Switchgrass RhizosphereLFNAISRVEGQGKAVQILGASPIVRALLLLIGISPRHFVKKAD*
Ga0180063_124556813300014885SoilRVESQRKSVQIFGATPIIRALLLLIGISPRHFVKKPQ*
Ga0157379_1085277133300014968Switchgrass RhizosphereRIELQHKSVQLVGASPIIRALLLLIGVSPRHFVKKPQ*
Ga0157379_1148582713300014968Switchgrass RhizosphereNPINRIESQRKAVQIVGASPIIRALLLLIGISPRHFLKKLQ*
Ga0167632_100570513300015085Glacier Forefield SoilAESQRKGVQIIGASPIIRALLLLIGISPRHFVKKSQ*
Ga0132257_10108828713300015373Arabidopsis RhizosphereNRIEAQRKTVQFVGASPIIRALLLLIGISPRHFVKKAQ*
Ga0132255_10330463313300015374Arabidopsis RhizosphereALFNVISRVEAQGKGVQILGASPIVRALLLLIGISPRHFVKKAD*
Ga0132255_10363419813300015374Arabidopsis RhizosphereNLIGRIESQHKSVQIVGASPIIRALLLLIGVSPRHFVKKPQ*
Ga0134083_1055062713300017659Grasslands SoilTINRIEAQRKTVQFMGASPIIRALLLLIGISPRHFVKKAD
Ga0187778_1009692413300017961Tropical PeatlandNLISRTESQHKTVQIIGASPIVRALLMLIGISPRHFIKKAE
Ga0184640_1047528723300018074Groundwater SedimentIIRAEGQRKTVQIAGASPIIRALLLLLGISPRHFIKKPQ
Ga0190271_1088889413300018481SoilNVIGRIESQHKSVQIVGASPIIRALLLLIGVSPRHFVKKPA
Ga0066669_1038141533300018482Grasslands SoilGQIVEAQRKAVQFLGVSPIVRALLLLIGISPRHFLKKAQ
Ga0066669_1060160413300018482Grasslands SoilITRIEGQRKTVQIIGASPIVRALLLLIGISPRHFVRKAA
Ga0193723_110039423300019879SoilAFSNAIIRAESQRKGVQIIGASPIIRALLLLIGISPRHFVKKAQ
Ga0210408_1071289023300021178SoilNAIVRAESQRKGVQIIGASPIIRALLLLIGISPRHFVKKSQ
Ga0210387_1182561113300021405SoilALSNAIIRAESQRKGVQIVGASPIIRALLLLIGISPRHFVKKPQ
Ga0210384_1107090213300021432SoilGAFSNAIIRAESQRKGVQIIGASPIIRALLLLIGISPRHFVKKAQ
Ga0182009_1031406333300021445SoilNRIEGQRKSVQITGASPIIRALLLLIGISPRHFVRKAS
Ga0224505_1026411523300022214SedimentEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKAQ
Ga0247785_101397413300022889SoilLLNAINRVEAQRKAVQFLGVSPIVRALLLLIGISPRHFLKKAQ
Ga0207697_1004368813300025315Corn, Switchgrass And Miscanthus RhizosphereGALLNLIGRIESQHKSVQIVGASPIIRALLLLIGVSPRHFVKKPQ
Ga0207682_1045162113300025893Miscanthus RhizosphereLNAINRVEQQRKAVQIQGASPIIRALLTLIGISPRHFLKKPQ
Ga0207654_1023325033300025911Corn RhizosphereNAISRAESQRKSIQIIGASPIIRALLLLIGISPRHFIKKAT
Ga0207695_1168084813300025913Corn RhizosphereNAITRIEGQGKAVQILGATPIVRALLLLIGISPRHFVKKAG
Ga0207657_1067416813300025919Corn RhizosphereRVEGQGKAVQIVGASPIVRALLLLIGISPRHFVKKAD
Ga0207646_1086025813300025922Corn, Switchgrass And Miscanthus RhizosphereARTESQRKTVQIAGASPIIRALLLLIGISPRHFIKTAQ
Ga0207650_1186482713300025925Switchgrass RhizosphereRAESQRKSIQIIGASPIIRALLLLIGISPRHFIKKAT
Ga0207644_1055720613300025931Switchgrass RhizosphereKIESQRKTVHIVGASPIIRALLLLIGISPRHFVKSSA
Ga0207670_1166213923300025936Switchgrass RhizosphereNNVEKQRKVVEIFGATPIIVAILLLIGLTPGHFVKKAP
Ga0207670_1178139723300025936Switchgrass RhizosphereEQQRKAVQIAGATPIIRALLLLIGISPRHFVKKPT
Ga0207669_1042909633300025937Miscanthus RhizosphereEQQRKAVQIQGASPIIRALLTLIGISPRHFLKKPQ
Ga0207679_1088111423300025945Corn RhizosphereNAITRIATLGKAVQITGATPIVRALLLLIGISPRHFVKKVD
Ga0207667_1083427313300025949Corn RhizosphereFNAISRVEGQGKAVQILGASPIVRALLLLIGISPRHFVKKAD
Ga0207651_1001569113300025960Switchgrass RhizosphereINRVESQRKAVQIVGASPIIRALLLLIGISPRHFLKKSF
Ga0207640_1208026113300025981Corn RhizosphereIEGQRKTVQIIGASPILRALLLLIGISPRHFVKKAA
Ga0207641_1033139713300026088Switchgrass RhizosphereNAINRVEQQRKAVQITGASPIIRALLLLIGISPRHFLKKPQ
Ga0207641_1113597223300026088Switchgrass RhizosphereGALLNTINRVESQRKAVQIVGASPIVRALLLLIGISPRHFLKKPQ
Ga0207648_1155066513300026089Miscanthus RhizosphereAINRIEAQRKAVQIVGVSPIVRALLLLIGISPRHFLKKAQ
Ga0207683_1079226713300026121Miscanthus RhizosphereAIGRVEQQRKAVQIMGASPIIRALLLLIGISPRHFLKKPQ
Ga0209839_1024529423300026294SoilNGISRAESQRKSVQIVGATPIVRVLLLLIGISPRHFIKKAQ
Ga0209157_115714113300026537SoilNAIGRTEAQHKTVQIAGASPIVRVLLLLIGISPRHFIKQAQ
Ga0209999_109352813300027543Arabidopsis Thaliana RhizosphereLLNAINRIEAQRKAVQIVGVSPIVRALLLLIGISPRHFLKKAQ
Ga0209682_1005197613300027716Wetland SedimentAINRVESQRKSVQIFGATPIIRALLLLIGISPRHFVKKPQ
Ga0209448_1005109523300027783Bog Forest SoilLNVIIRAEAQRKTVQIAGASPIIRALLLLIGISPRHFIKKTQ
Ga0209397_1026239623300027871WetlandEAQRKSVQIVGATPIIRALLLLIGLPPRHFVKKNV
Ga0209450_1070381223300027885Freshwater Lake SedimentTRVEAQRKAVQIVGASPIIRALLLLIGISPRHFLKKPQ
Ga0209254_1076195113300027897Freshwater Lake SedimentEQQRKSVQIVGATPIVRALLLLIGISPRHFVKKAD
Ga0209048_1091172513300027902Freshwater Lake SedimentIETQRKSVQIVGATPIVRALLLLIGISPRHFVKRAQ
Ga0268265_1040230833300028380Switchgrass RhizosphereRLESQRKAVQIVGASPIIRALLLLIGISPRHFLKKLQ
Ga0247822_1096072313300028592SoilVEGQGKAVQIVGASPIVRALLLLIGISPRHFVKKGE
Ga0247821_1041758613300028596SoilHRFPLTLNTITRVEGQGKAVQIVGASPIVRALLLLIGISPRHFVKKGE
Ga0247821_1096840913300028596SoilLLNAITRIETLGKAVQITGTSPIVRALLLLIGISPRHFVKKVD
Ga0302256_1014975113300028741FenSLLNTINRIEAQRKAVQIMGASPIIRALLLLIGISPRHFLKRTP
Ga0247824_1095518113300028809SoilTITRVEGQGKAVQIVGASPIVRALLLLIGISPRHFVKKGE
Ga0302163_1006185823300028868FenEAQRKAVQIMGASPIIRALLLLIGISPRHFLKRSP
Ga0302263_1033743223300028869FenAINRIETQRKAVQIVGASPIIRALLLLIGISPRHFLKRAQ
Ga0311332_1054070213300029984FenLNAINRVESQRKAVQIVGASPIIRALLLLIGISPRHFLKRAP
Ga0311339_1112414923300029999PalsaALLNAIIRAEGQRKTVQIAGASPIIRVLLLLIGISPRHFIKKAQ
Ga0302286_1019023213300030047FenIEAQRKAVQIMGASPIIRALLLLIGISPRHFLKRTP
Ga0311333_1058265923300030114FenLNAINRIEAQRKAVQIMGASPIIRALLLLIGISPRHFLKRSP
Ga0311333_1073249213300030114FenGSLLNTINRIEAQRKAVQILGASPIIRALLLLIGISPRHFLKRAP
Ga0311349_1088878123300030294FenLNTLSRIEGQRKAVQFVGATPIIRALLLLIGISPRHFVKKAH
Ga0311349_1091713613300030294FenEAQRKAVQILGASPIIRALLLLIGISPRHFLKRAP
Ga0311349_1113508823300030294FenVESQRKAVQIVGASPIIRALLLLIGISPRHFLKRAP
Ga0311349_1169111023300030294FenLLNTLNRIEGQRKAVQFVGATPIIRALLLLIGISPRHFIKKAQ
Ga0311335_1121186113300030838FenIESQRKKVEIIGASPIIKALLLILGVAPQSFVKKAQ
(restricted) Ga0255312_111557813300031248Sandy SoilGRVEGQRKNVQIVGASPIIRALLLLIGVSPRNFVKKTG
Ga0315291_1104797423300031707SedimentIEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKPQ
Ga0315293_1130062423300031746SedimentLLNHINRIEAQRKVVQIVGASPIIRALLLLIGVSPRHFVKKPQ
Ga0318494_1082756313300031751SoilRAESQRKTVQIAGATPIIRALLLLIGISPRHFVKKAQ
Ga0318543_1014210733300031777SoilALLNAIGRAESQRKTVQIAGATPIIRALLLLIGISPRHFVKKAQ
Ga0318543_1018830823300031777SoilNMINRIEMQRKSVQISGATPIVRALLLLIGISPRHFVRKNS
Ga0318568_1081629813300031819SoilVESQRKTVQISGATPIIRALLLLIGISPRHFVKKAP
Ga0307473_1029070913300031820Hardwood Forest SoilIGRAESQRKTVQISGATPIIRALLLLIGISPRHFVKKAQ
Ga0307413_1035247713300031824RhizosphereLNAVTRVEGQRKAVQVLGASPIIRALLLLIGLSPRHFVKKVV
Ga0315297_1058951123300031873SedimentTRIEAQRKAIQIVGASPIIRALLLLIGVSPRHFVKKSQ
Ga0318536_1067157823300031893SoilNHISRIEAQRKAVQIVGVTPIIRALLLLLGVSPRHFVKKAE
Ga0307407_1142438423300031903RhizosphereEGQRKAVQVLGASPIIRALLLLIGLSPRHFVKKAA
Ga0306926_1111089813300031954SoilAIGRVEGQRKSVQIVGASPIVRALLLLIGVSPRHFVKKSV
Ga0306926_1265758413300031954SoilLNSISRIEAQQTAVQIVGASPIIRALLLLIGVSPRQFVKK
Ga0307409_10107550413300031995RhizosphereTINRVEGQRKSVQISGASPIIRALLLLIGISPRHFVRKAA
Ga0315278_1197632423300031997SedimentHINRIEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKPQ
Ga0318562_1072295823300032008SoilSRIEAQQTAVQIVGASPIIRALLLLIGVSPRQFVKK
Ga0318507_1040727113300032025SoilAESQRKTVQIAGATPIIRALLLLIGISPRHFVKKAQ
Ga0315284_1159342013300032053SedimentALLNLINRIESQKKAIQIVGASPIIRALLLLIGVSPRHFVKKPQ
Ga0310890_1145775123300032075SoilNRIEQQRKAVQIAGATPIIRALLLLIGISPRHFVKKPT
Ga0315292_1089934423300032143SedimentEEHRKAVQIFGATPIIRAMLLLIGIPSGHFYKKSQ
Ga0315281_1045227113300032163SedimentEGQRKAVQIVGASPIIRALLLLIGVSPRHFVKKPQ
Ga0315281_1166029823300032163SedimentGALLNLINRIESQRKAIQIVGASPIIRALLLLIGVSPRHFVKKPQ
Ga0315276_1014960113300032177SedimentNHINRIEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKPQ
Ga0307472_10147349523300032205Hardwood Forest SoilISRAESQRKTVQIVGASPIIRALLLLIGISSRHFIRKEQ
Ga0315273_1114088233300032516SedimentMNAIYRVESQRKAVQIVGASPIIRALLLLIGISPRHFLKRTT
Ga0335080_1241099913300032828SoilNRVEAQRRAVQIIGASPIIRALLLLIGISPRHFVKKTQ
Ga0335076_1068382133300032955SoilTRAETQRKTVQIAGASPIIRALLLLIGISPRHFIKKVQ
Ga0335084_1182998513300033004SoilEGQRKSVQIIGASPMIRALLLLIGVSPRHFVKKSA
Ga0316603_1206773223300033413SoilTRIEGQRKSVQIVGATPIIRALLLLIGLPPRHFVKKNA
Ga0316627_10275403213300033482SoilNRIEAQRKAVQIGGASPIIRALLLLIGVSPRHFVKKPQ
Ga0316616_10200244413300033521SoilEAQRKAVQIVGASPIIRALLLLIGISPRHFLKKPQ
Ga0316617_10234385213300033557SoilLLNVINRIEKQRKSVQIVGASPIIRSLLLLIGVSPRHFVKKS
Ga0314864_0171889_449_5563300033805PeatlandESQHKTVQIIGASPIIRALLMLIGITPRHFIKKAQ
Ga0364943_0052593_1228_13503300034354SedimentSIIRAEGQRKTVQIAGASPIIRALLLLLGISPRHFIKKPQ
Ga0370497_0150375_1_1353300034965Untreated Peat SoilALFNVINRVEQQRKAVQIVGASPIIRALLLLIGISPRHFLKKPQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.