Basic Information | |
---|---|
Family ID | F049480 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 146 |
Average Sequence Length | 39 residues |
Representative Sequence | MRKIFILFALVFALVTTATATVVTTAVTSDAAFALATR |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 146 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 52.74 % |
% of genes near scaffold ends (potentially truncated) | 48.63 % |
% of genes from short scaffolds (< 2000 bps) | 94.52 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (63.699 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (41.781 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.726 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (85.616 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 146 Family Scaffolds |
---|---|---|
PF03734 | YkuD | 36.99 |
PF00753 | Lactamase_B | 2.05 |
PF04116 | FA_hydroxylase | 1.37 |
PF08714 | Fae | 1.37 |
PF00085 | Thioredoxin | 1.37 |
PF02653 | BPD_transp_2 | 1.37 |
PF00440 | TetR_N | 1.37 |
PF05036 | SPOR | 1.37 |
PF02683 | DsbD | 0.68 |
PF00313 | CSD | 0.68 |
PF12697 | Abhydrolase_6 | 0.68 |
PF13561 | adh_short_C2 | 0.68 |
PF00561 | Abhydrolase_1 | 0.68 |
PF02517 | Rce1-like | 0.68 |
PF02175 | 7TM_GPCR_Srb | 0.68 |
PF13899 | Thioredoxin_7 | 0.68 |
COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
---|---|---|---|
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 36.99 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 36.99 |
COG1795 | Formaldehyde-activating enzyme (5,6,7,8-tetrahydromethanopterin hydrolyase) | Energy production and conversion [C] | 1.37 |
COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 1.37 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.70 % |
Unclassified | root | N/A | 36.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig51774 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300001471|JGI12712J15308_10153248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 596 | Open in IMG/M |
3300001867|JGI12627J18819_10018052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2857 | Open in IMG/M |
3300001867|JGI12627J18819_10029341 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
3300004121|Ga0058882_1592664 | Not Available | 620 | Open in IMG/M |
3300005332|Ga0066388_100014500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6464 | Open in IMG/M |
3300005518|Ga0070699_101564761 | Not Available | 604 | Open in IMG/M |
3300005764|Ga0066903_100455726 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
3300005764|Ga0066903_100929708 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
3300005764|Ga0066903_102239484 | Not Available | 1054 | Open in IMG/M |
3300005764|Ga0066903_102276576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1046 | Open in IMG/M |
3300005764|Ga0066903_102518036 | Not Available | 996 | Open in IMG/M |
3300005764|Ga0066903_102739357 | Not Available | 956 | Open in IMG/M |
3300005764|Ga0066903_103683359 | Not Available | 824 | Open in IMG/M |
3300005764|Ga0066903_105023295 | Not Available | 702 | Open in IMG/M |
3300005764|Ga0066903_105799005 | Not Available | 649 | Open in IMG/M |
3300005764|Ga0066903_108935602 | Not Available | 508 | Open in IMG/M |
3300005921|Ga0070766_10255782 | Not Available | 1113 | Open in IMG/M |
3300006052|Ga0075029_100085409 | Not Available | 1875 | Open in IMG/M |
3300006059|Ga0075017_100617734 | Not Available | 829 | Open in IMG/M |
3300006806|Ga0079220_10792167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
3300009520|Ga0116214_1210902 | Not Available | 732 | Open in IMG/M |
3300009698|Ga0116216_10268003 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300009700|Ga0116217_10157620 | Not Available | 1513 | Open in IMG/M |
3300010046|Ga0126384_10510147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1038 | Open in IMG/M |
3300010048|Ga0126373_12229947 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300010358|Ga0126370_10335906 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300010358|Ga0126370_12623722 | Not Available | 504 | Open in IMG/M |
3300010366|Ga0126379_11577506 | Not Available | 762 | Open in IMG/M |
3300010371|Ga0134125_11969267 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300010379|Ga0136449_103446356 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300010396|Ga0134126_10717387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1135 | Open in IMG/M |
3300010398|Ga0126383_12942199 | Not Available | 556 | Open in IMG/M |
3300011120|Ga0150983_10619813 | Not Available | 535 | Open in IMG/M |
3300011120|Ga0150983_10665035 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300011120|Ga0150983_15629670 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300012177|Ga0153943_1137099 | Not Available | 533 | Open in IMG/M |
3300012951|Ga0164300_10035677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1865 | Open in IMG/M |
3300012955|Ga0164298_10393183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 893 | Open in IMG/M |
3300012960|Ga0164301_10473684 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300015371|Ga0132258_10929862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 2196 | Open in IMG/M |
3300016270|Ga0182036_11417562 | Not Available | 582 | Open in IMG/M |
3300016270|Ga0182036_11667644 | Not Available | 538 | Open in IMG/M |
3300016341|Ga0182035_11738358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
3300016357|Ga0182032_10954510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
3300016371|Ga0182034_11152400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
3300016404|Ga0182037_11297285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
3300016422|Ga0182039_11453527 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300016445|Ga0182038_11209648 | Not Available | 674 | Open in IMG/M |
3300016445|Ga0182038_11419543 | Not Available | 622 | Open in IMG/M |
3300017822|Ga0187802_10054306 | Not Available | 1468 | Open in IMG/M |
3300017822|Ga0187802_10083347 | Not Available | 1193 | Open in IMG/M |
3300017970|Ga0187783_10027185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4239 | Open in IMG/M |
3300017970|Ga0187783_10181291 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
3300017970|Ga0187783_10655787 | Not Available | 758 | Open in IMG/M |
3300017970|Ga0187783_10754448 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300017975|Ga0187782_10561215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 876 | Open in IMG/M |
3300018060|Ga0187765_10846912 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300020581|Ga0210399_10146202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1954 | Open in IMG/M |
3300020582|Ga0210395_10048024 | All Organisms → cellular organisms → Bacteria | 3124 | Open in IMG/M |
3300020582|Ga0210395_10332655 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300020582|Ga0210395_11290207 | Not Available | 535 | Open in IMG/M |
3300020583|Ga0210401_10319460 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1414 | Open in IMG/M |
3300021088|Ga0210404_10192325 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300021171|Ga0210405_10701266 | Not Available | 782 | Open in IMG/M |
3300021178|Ga0210408_11425933 | Not Available | 521 | Open in IMG/M |
3300021404|Ga0210389_10265706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1343 | Open in IMG/M |
3300021404|Ga0210389_10909076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 685 | Open in IMG/M |
3300021405|Ga0210387_10734349 | Not Available | 874 | Open in IMG/M |
3300021405|Ga0210387_10958875 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300021405|Ga0210387_11687350 | Not Available | 537 | Open in IMG/M |
3300021406|Ga0210386_10396928 | Not Available | 1188 | Open in IMG/M |
3300021406|Ga0210386_11074805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 684 | Open in IMG/M |
3300021433|Ga0210391_10431843 | Not Available | 1034 | Open in IMG/M |
3300021433|Ga0210391_11244501 | Not Available | 575 | Open in IMG/M |
3300021560|Ga0126371_12940314 | Not Available | 577 | Open in IMG/M |
3300021860|Ga0213851_1781571 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300022498|Ga0242644_1016198 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300022499|Ga0242641_1017911 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300022499|Ga0242641_1033911 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300022505|Ga0242647_1032214 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300022506|Ga0242648_1035810 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300022506|Ga0242648_1054854 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300022506|Ga0242648_1080718 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300022509|Ga0242649_1047788 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300022510|Ga0242652_1019193 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300022512|Ga0242676_1012972 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300022513|Ga0242667_1039918 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300022522|Ga0242659_1060062 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300022523|Ga0242663_1093685 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300022523|Ga0242663_1106269 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300022523|Ga0242663_1131977 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300022523|Ga0242663_1138981 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300022523|Ga0242663_1146140 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300022525|Ga0242656_1068253 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300022527|Ga0242664_1133526 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300022528|Ga0242669_1126201 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300022530|Ga0242658_1010427 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
3300022530|Ga0242658_1040266 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300022530|Ga0242658_1120039 | Not Available | 650 | Open in IMG/M |
3300022530|Ga0242658_1181677 | Not Available | 561 | Open in IMG/M |
3300022530|Ga0242658_1208022 | Not Available | 535 | Open in IMG/M |
3300022531|Ga0242660_1050335 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300022533|Ga0242662_10227047 | Not Available | 597 | Open in IMG/M |
3300022533|Ga0242662_10232116 | Not Available | 592 | Open in IMG/M |
3300022709|Ga0222756_1017646 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300022714|Ga0242671_1040793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 739 | Open in IMG/M |
3300022714|Ga0242671_1128946 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300022715|Ga0242678_1085717 | Not Available | 507 | Open in IMG/M |
3300022716|Ga0242673_1081676 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300022717|Ga0242661_1108789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 587 | Open in IMG/M |
3300022717|Ga0242661_1151278 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300022724|Ga0242665_10104028 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300022726|Ga0242654_10108551 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300022726|Ga0242654_10123878 | Not Available | 837 | Open in IMG/M |
3300022726|Ga0242654_10314961 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300022726|Ga0242654_10318491 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300027497|Ga0208199_1057050 | Not Available | 830 | Open in IMG/M |
3300027505|Ga0209218_1051060 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300027545|Ga0209008_1076576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 752 | Open in IMG/M |
3300027545|Ga0209008_1103079 | Not Available | 637 | Open in IMG/M |
3300027817|Ga0209112_10168864 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300027817|Ga0209112_10230832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
3300027895|Ga0209624_10249302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1181 | Open in IMG/M |
3300027895|Ga0209624_10406762 | Not Available | 907 | Open in IMG/M |
3300027898|Ga0209067_10292363 | Not Available | 894 | Open in IMG/M |
3300029701|Ga0222748_1126867 | Not Available | 519 | Open in IMG/M |
3300030969|Ga0075394_11886452 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300031128|Ga0170823_14401222 | Not Available | 503 | Open in IMG/M |
3300031231|Ga0170824_103562721 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300031231|Ga0170824_109912375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
3300031446|Ga0170820_16807435 | Not Available | 552 | Open in IMG/M |
3300031640|Ga0318555_10506851 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300031708|Ga0310686_112131943 | Not Available | 1423 | Open in IMG/M |
3300031719|Ga0306917_10672966 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300031719|Ga0306917_11082379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 625 | Open in IMG/M |
3300031910|Ga0306923_12474658 | Not Available | 513 | Open in IMG/M |
3300031954|Ga0306926_12905034 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300031962|Ga0307479_10624749 | Not Available | 1059 | Open in IMG/M |
3300031962|Ga0307479_11905162 | Not Available | 545 | Open in IMG/M |
3300032059|Ga0318533_10748928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 717 | Open in IMG/M |
3300032076|Ga0306924_10812629 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300032261|Ga0306920_101000124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 1218 | Open in IMG/M |
3300032515|Ga0348332_12613011 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300032828|Ga0335080_12023356 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300032898|Ga0335072_10087582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4022 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 41.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.27% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.53% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.79% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.11% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.74% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.74% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.05% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.37% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.37% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.37% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.37% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.68% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.68% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0774.00003680 | 2166559005 | Simulated | VRKIFILFALVFALVTTATATVVTTAVTSDAALALATR |
JGI12712J15308_101532482 | 3300001471 | Forest Soil | MRRLFILFAIVFALVSTGTATVVTTALTSDTAMALAVR* |
JGI12627J18819_100180524 | 3300001867 | Forest Soil | MRKLFILVAIVFALVSAGAATVVTTALTSDAAMALAAR* |
JGI12627J18819_100293414 | 3300001867 | Forest Soil | MRKLFILVAVVFALVTTGAATVVTTALTSDAAMALAVR* |
Ga0058882_15926642 | 3300004121 | Forest Soil | EPPPIRTTGNGGSIMRNLFILVAVVFALVSVGAATVVTTALTSDAAIALGVR* |
Ga0066388_1000145008 | 3300005332 | Tropical Forest Soil | VQWKWGIIMRKLFILFAVVFALVSGATVTVVTTAMTSDAAFAWATR* |
Ga0070699_1015647611 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIMRKLFILFALVFALVTTATAVAVTTAVTSDAAIAQAVR* |
Ga0066903_1004557262 | 3300005764 | Tropical Forest Soil | MRKLFILFAVVFALVSGATATVVTTALTSDAALALATR* |
Ga0066903_1009297084 | 3300005764 | Tropical Forest Soil | MRKLFILFAVVFALVSGATVTVVTTAMTSDAAFAWATR* |
Ga0066903_1022394842 | 3300005764 | Tropical Forest Soil | MRKIFILFALVFALVTAGTAAVVTTAMTSDAAFALATR* |
Ga0066903_1022765763 | 3300005764 | Tropical Forest Soil | MRNLFILFAVVFALVSGTTATVVTTAMTSDAAFARATR* |
Ga0066903_1025180362 | 3300005764 | Tropical Forest Soil | MRKIFILFALVFALVTATTATVVTTAMTSDAAFAQATR* |
Ga0066903_1027393572 | 3300005764 | Tropical Forest Soil | MSKIFILFALVFALVTTATATVVTTAMTSDAAFALATR* |
Ga0066903_1036833591 | 3300005764 | Tropical Forest Soil | MRKIFILFALVFALVTTATATVVTTAMTSDAAFALATR* |
Ga0066903_1050232951 | 3300005764 | Tropical Forest Soil | MRKIFILFASVFALVTTATATVVTTAMTSDAAFALATLR* |
Ga0066903_1057990052 | 3300005764 | Tropical Forest Soil | MRQLFILFALVFALVTTATATVVTTDVISDSAIAQQASR* |
Ga0066903_1089356021 | 3300005764 | Tropical Forest Soil | QGKRGTIMRKIFILFALVLALVTTALATVVATAMTSDAAFALATR* |
Ga0070766_102557821 | 3300005921 | Soil | MRKLFILVAVTFALVSTGAATVVTTALTSDAAMALALR* |
Ga0075029_1000854093 | 3300006052 | Watersheds | MRKIFILFALVFALVTGATATMVTTAVTSDAALALATR* |
Ga0075017_1006177342 | 3300006059 | Watersheds | MRKIFILFALVFALVSGATATVVTTAVTSDAALALATR* |
Ga0079220_107921672 | 3300006806 | Agricultural Soil | MRKLFILFAVVFALVSGATATVVTAALTSDAALALATR* |
Ga0116214_12109021 | 3300009520 | Peatlands Soil | MRKIFILFAIVFALVTTGTATVVVTAVSSDAAMTYVQGTV* |
Ga0116216_102680032 | 3300009698 | Peatlands Soil | MRKIFVLFALVFALVTTATATVVTTAVTSDAALALATR* |
Ga0116217_101576202 | 3300009700 | Peatlands Soil | MRKIFILFAIVFALVTTGTATVVVTAVPSDAAMTYVQGTV* |
Ga0126384_105101472 | 3300010046 | Tropical Forest Soil | MRQLFILFALVFALVTTATATVVTTDVISDSTIAQQASR* |
Ga0126373_122299472 | 3300010048 | Tropical Forest Soil | MRQLFILFALVFALVTTAAATVVTSDVISDSAIAQQVSR* |
Ga0126370_103359062 | 3300010358 | Tropical Forest Soil | VQWKWGIIMRKLFIMFAVVFALVSGATVTVVTTAMTSDAAFAWATR* |
Ga0126370_126237221 | 3300010358 | Tropical Forest Soil | MRKIFILFALVFALVTTATATVATTAMTSDAAFALATR* |
Ga0126379_115775061 | 3300010366 | Tropical Forest Soil | MRKIFILFALVFALVTTATATVVTTAMTSDAAFAQATR* |
Ga0134125_119692672 | 3300010371 | Terrestrial Soil | KWGTIMRKLFILFAVVFALVSGATATVVTTALTSDAALALATR* |
Ga0136449_1034463562 | 3300010379 | Peatlands Soil | MRKIFILFALVFALVTTATATVVTMAVTSDAALALATR* |
Ga0134126_107173873 | 3300010396 | Terrestrial Soil | MRKLFILFAIVFALVSGATATVVTTAVTSDAALALATR* |
Ga0126383_129421991 | 3300010398 | Tropical Forest Soil | MIMRKIFILFALVFALVTTATATVVTTAMTSDAAFALATR* |
Ga0150983_106198131 | 3300011120 | Forest Soil | FILVAVAFALVSTGAATVVTTALTSDAAMALALR* |
Ga0150983_106650352 | 3300011120 | Forest Soil | SIMRKLFILFAIVFALVSTGTATVVTTALTSDTAMALAVR* |
Ga0150983_156296702 | 3300011120 | Forest Soil | MRKIFILFALVFALVTAATATVVTTAVTSDAAQALATR* |
Ga0153943_11370991 | 3300012177 | Attine Ant Fungus Gardens | MRKIFILFALVFALVTGATANVVATAVTSDDVLALATR* |
Ga0164300_100356772 | 3300012951 | Soil | VRKIFILFALVFALVTTATATVVTTAVTSDAALALATR* |
Ga0164298_103931832 | 3300012955 | Soil | VRKIFILFALVFALVTTATATVGTTAVTSDAAPALATR* |
Ga0164301_104736841 | 3300012960 | Soil | VRKIFVLFALVFALVTTATATVVTTAVTSDAAALATR* |
Ga0132258_109298622 | 3300015371 | Arabidopsis Rhizosphere | MRTLFILVTVVFALVSIGTATVVTTALTSNAAMAQAIR* |
Ga0182036_114175622 | 3300016270 | Soil | MRKLFILFAVVFALVSGATVTVVTTEMTSDAAFAWATR |
Ga0182036_116676441 | 3300016270 | Soil | MRKIFILFALVFALVTTATATVVTTAVTSDAAFALAT |
Ga0182035_117383582 | 3300016341 | Soil | MRKIFILFALVFALVTTATATVVTTAVTSDAAIALQVSR |
Ga0182032_109545101 | 3300016357 | Soil | DDDMRQLFILFALVFALVTTATATVVTTDVISDSAIAQQASR |
Ga0182034_111524001 | 3300016371 | Soil | MRKIFVLFALVFALVMTATATVVTTAVTSDTAVALATR |
Ga0182037_112972852 | 3300016404 | Soil | VMRKIFILFALVFALVMTATATVVTTAVTSDTAVALATR |
Ga0182039_114535273 | 3300016422 | Soil | VQWKWGIIMRKLFILFAVVFALVSGATVTVVTTAMTSDAAFAWATR |
Ga0182038_112096481 | 3300016445 | Soil | MRQLFILFALVFALVTTATATVVTTDVISDSEIAQQASR |
Ga0182038_114195431 | 3300016445 | Soil | MRKIFILFALVFALVTTATATAVTTAMTSDAAFALATR |
Ga0187802_100543064 | 3300017822 | Freshwater Sediment | MRKIFILFALVFALVTTATATVVTTAMTSDAAFALATR |
Ga0187802_100833471 | 3300017822 | Freshwater Sediment | MRKIFILFALVFALVTGATATMVTTAVTSDAALALATR |
Ga0187783_100271854 | 3300017970 | Tropical Peatland | MRQLFILFALVFALVTTATATVVTTDVISDGTIAQQASR |
Ga0187783_101812913 | 3300017970 | Tropical Peatland | MRKIFILFAIVFALVTTATATVVVTAVSSDAAMALATR |
Ga0187783_106557872 | 3300017970 | Tropical Peatland | MRKIFILFTIVFTLVTAVTGTVVVTAVSSDAAMALATR |
Ga0187783_107544482 | 3300017970 | Tropical Peatland | MGDDMRKIFILFALVFALVSGATATVVTTALTSDAALALATR |
Ga0187782_105612151 | 3300017975 | Tropical Peatland | MRKIFILFAIVFALVTTATATVVVTAVSSDSAMALATR |
Ga0187765_108469121 | 3300018060 | Tropical Peatland | MRKLFILFAVVFALVSGATATVVTTALTSDAALALATR |
Ga0210399_101462021 | 3300020581 | Soil | WGTNVRKIFVLFALVFALVTTATATVVTTAVTSDAALALATR |
Ga0210395_100480243 | 3300020582 | Soil | MRKLFILVAVTFALVSTGAATVVTTALTSDAAMALALR |
Ga0210395_103326551 | 3300020582 | Soil | MRKLFILFAIVFALVSTGTATVVTTALTSDTAMALAVR |
Ga0210395_112902071 | 3300020582 | Soil | MRKLFILVAVVFALVSTGTATVVTTALTSDAAMALAVR |
Ga0210401_103194602 | 3300020583 | Soil | MRNLFILVAVVFALVSVGAATVVTTALTSDAAIALGVR |
Ga0210404_101923252 | 3300021088 | Soil | VRKIFVLFALVFALVTTATATVVTTAVTSDAALALATR |
Ga0210405_107012661 | 3300021171 | Soil | MRKIFILFALVFALVTGATANVVATAVTSDAVLALATR |
Ga0210408_114259331 | 3300021178 | Soil | MRKIFILFALVFALVTTATATVVTTAVTSDAAIAQQAAR |
Ga0210389_102657063 | 3300021404 | Soil | MRKIFILFALVFASVTTATATVVTTAVTSDAALALATR |
Ga0210389_109090761 | 3300021404 | Soil | MRRLFILFAIVFALVSTGTATVVTAALTSDTAMALAVR |
Ga0210387_107343492 | 3300021405 | Soil | GKGVQIMRKLFILVAVTFALVSTGAATVVTTALTSDAAMALALR |
Ga0210387_109588752 | 3300021405 | Soil | MRKIFILFALVFALVTTATATVVTTAVTSDAAFALATR |
Ga0210387_116873502 | 3300021405 | Soil | MRKLFILFALVFALVTTATATVVTTAVTSDAAMALASAKL |
Ga0210386_103969281 | 3300021406 | Soil | IMRKLFIFVAVVFALVSIGAGTVVTTALTSDGALAQAIR |
Ga0210386_110748051 | 3300021406 | Soil | MRKLFILFAIAFALVSTGAATVVTTALTSDAAMALAVR |
Ga0210391_104318431 | 3300021433 | Soil | TRGTGKGVQIMRKLFILVAVTFALVSTGAATVVTTALTSDAAMALALR |
Ga0210391_112445011 | 3300021433 | Soil | PIRTTGNGGSIMRNLFILVAVVFALVSVGAATVVTTALTSDAAIALGVR |
Ga0126371_129403142 | 3300021560 | Tropical Forest Soil | MRKIFILFALVFALVTTATAAVVTTAMTSDAAFALATR |
Ga0213851_17815711 | 3300021860 | Watersheds | IMRKIFIFFALVFALVTTATATVVTTAVTSDAALALATR |
Ga0242644_10161982 | 3300022498 | Soil | GTNVRKIFVLFALVFALVTTATATVVTTAVTSDAALALATR |
Ga0242641_10179112 | 3300022499 | Soil | DMRKGFIRFARVVALVSGATATVVTTALTSDAALALATR |
Ga0242641_10339112 | 3300022499 | Soil | MREILVLFALVFALVTTATATVVTTAVTSDAALALATR |
Ga0242647_10322142 | 3300022505 | Soil | GTNVRKIFILFALVFALVTTATATVVTTAVTSDAAPALATR |
Ga0242648_10358101 | 3300022506 | Soil | VMRKIFVLFALVFALVTTATATVVTTAVTSDAAFALATR |
Ga0242648_10548541 | 3300022506 | Soil | SIMRRLFILFAIVFALVSTGTATVVTTALTSDTAMALAVR |
Ga0242648_10807182 | 3300022506 | Soil | GDDMRKIFILFALVFALVSGGTATVVTTALTSDAALALATR |
Ga0242649_10477881 | 3300022509 | Soil | GDDMRKIFILFALVFALVSGATATVVTTALTSDAALALATR |
Ga0242652_10191932 | 3300022510 | Soil | VRKIFILFALVFALVTTATATVVTTAVTSDAGLALATR |
Ga0242676_10129722 | 3300022512 | Soil | GTIVRKIFILFALVFALVTTATATVVTTAVTSDAALALATR |
Ga0242667_10399182 | 3300022513 | Soil | GINMRKIFILFALVFGLVTTATATVVTTAVTSDAALALATR |
Ga0242659_10600622 | 3300022522 | Soil | DDMRRIFILFALVFALVSGATATVVTTALTSDAALALATR |
Ga0242663_10936852 | 3300022523 | Soil | RKIFILFALVFALVSGATATVVTTALTSDAALALATR |
Ga0242663_11062691 | 3300022523 | Soil | MRKIFVLFALVFALVTTATATVVTTAVTSDAAFALATR |
Ga0242663_11319771 | 3300022523 | Soil | IFILFALVFAFVTTATATVVTTAVTSDAAIAQQAAR |
Ga0242663_11389812 | 3300022523 | Soil | GSIMRKLFILFAIVFALVSTGTATVVTTALTSDTAMALAVR |
Ga0242663_11461402 | 3300022523 | Soil | REIFILFALVFAFVTAATATVVTTAVTSNAALALATR |
Ga0242656_10682531 | 3300022525 | Soil | GTIMRKIFILFALVFALVTTATATVVTTAVTSDAAMALATR |
Ga0242664_11335262 | 3300022527 | Soil | GTNVRKIFILFALVFALVTTATATVVTTAVTSDAALALATR |
Ga0242669_11262012 | 3300022528 | Soil | VMRKIFILFALVFALVTTATATVVTTAVTSDAAIAQQAAR |
Ga0242658_10104271 | 3300022530 | Soil | NVRKIFILFALVFALVTTATATVVTTAVTSDAALALATR |
Ga0242658_10402663 | 3300022530 | Soil | TVMRKIFILFALVFALVTTATATVVTTAVTSDAAFALATR |
Ga0242658_11200391 | 3300022530 | Soil | KLFILVAVVFALVSTGTATVVTTALTSDAAMALAVR |
Ga0242658_11816771 | 3300022530 | Soil | KIFILFAMVFALVTTATATVVTTAVTSDAALALATR |
Ga0242658_12080222 | 3300022530 | Soil | SIMRKLFILVAIVFALVSAGAATVVTTALTSDAAMALVVR |
Ga0242660_10503351 | 3300022531 | Soil | TNVRKIFVLLALVFALVTTATATVVTTAVTSDAALALATR |
Ga0242662_102270473 | 3300022533 | Soil | VHMRKIFILFALVFALVTMATATVVTTAVSSDTAMALATR |
Ga0242662_102321162 | 3300022533 | Soil | RKLFILFALVFALVTTATAVVVTTAVTSDAAIAQAVR |
Ga0222756_10176463 | 3300022709 | Soil | GTNVRKIFILFARVFALVTTATATVVTTAVTSDAALALATR |
Ga0242671_10407931 | 3300022714 | Soil | IVRKIFILFALVFALVTTATATVVTTAVTSDAALALATR |
Ga0242671_11289462 | 3300022714 | Soil | LIMRKLFILVAVAFALVSAGAATVVTTALTSDAAMALAVR |
Ga0242678_10857171 | 3300022715 | Soil | SIMRKLFILVAVVFALVSTGTATVVTTALTSDAAMALAVR |
Ga0242673_10816762 | 3300022716 | Soil | KIFILFALVFGLVTTATATVVTTDVTFDAALALATR |
Ga0242661_11087892 | 3300022717 | Soil | KIFILFALVFALVTTATATVVTTAVTSDAALALATR |
Ga0242661_11512781 | 3300022717 | Soil | EGQLGFGMRKIFILFALVFALVTMATATVVTTAMTSDAAIAQQAAR |
Ga0242665_101040282 | 3300022724 | Soil | GDDMRRIFILFALVFALVSGATATVVTTALTSDAALALATR |
Ga0242654_101085512 | 3300022726 | Soil | AIMRKIFILFALLFALVTTATAAVVTTAVTSDAAFALATR |
Ga0242654_101238782 | 3300022726 | Soil | KIFILFALVFALVTTATAMVVTTAVTSDTAFALATR |
Ga0242654_103149611 | 3300022726 | Soil | RKIFILFALVFALVTTATATVVTTAATSDAAMALATR |
Ga0242654_103184912 | 3300022726 | Soil | RKIFVLFALVFALVTTATATVVTTAVTSDAAFALATR |
Ga0208199_10570501 | 3300027497 | Peatlands Soil | MRKIFILFAIVFALVTTGTATVVVTAVSSDAAMTYVQGTV |
Ga0209218_10510602 | 3300027505 | Forest Soil | PLPGNGGSIMRRLFILFAIVFALVSTGTATVVTAALTSDTAMALAVR |
Ga0209008_10765762 | 3300027545 | Forest Soil | MRRLFILFAIVFALVSTGTATVVTTALTSDTAMALAVR |
Ga0209008_11030791 | 3300027545 | Forest Soil | KLFIFVAVVFALVSIGAGTVVTTALTSDGALAQAIR |
Ga0209112_101688642 | 3300027817 | Forest Soil | MRKLFILVAVVFALVTTGAATVVTTALTSDAAMALAVR |
Ga0209112_102308322 | 3300027817 | Forest Soil | MRKLFILFAVVFALVSTGTATVVVTALTSDAAMALAVR |
Ga0209624_102493024 | 3300027895 | Forest Soil | MRKLFILVAIVFALVSAGAATVVTTALTSDAAMALAVR |
Ga0209624_104067621 | 3300027895 | Forest Soil | MRKLFILVAVTFALVSTGAATVVTTALTSDAAMALAL |
Ga0209067_102923631 | 3300027898 | Watersheds | MRKIFILFALVFALVSGATATVVTTAVTSDAALALATR |
Ga0222748_11268671 | 3300029701 | Soil | TIMRKIFILFALVFALVTTATATVVTTAITSHAAFALATR |
Ga0075394_118864521 | 3300030969 | Soil | KIFILFALVFALVTTATAAVVTTAVTSDAALALATR |
Ga0170823_144012221 | 3300031128 | Forest Soil | MGTIMRKIFILFALVFALVTGATATMVTTAVTSDAALALATR |
Ga0170824_1035627213 | 3300031231 | Forest Soil | GTNMRKIFILFALVFALVTTATAAVVTTAVTSDAALALATR |
Ga0170824_1099123751 | 3300031231 | Forest Soil | TERGTIMRKIFILFALVFALVTTATAAVVTTAVTSDAALALATR |
Ga0170820_168074352 | 3300031446 | Forest Soil | MRKLFILVAVVFALVSVGAATVVTTALTSDAAMALATR |
Ga0318555_105068513 | 3300031640 | Soil | MRKLFILFAVVFALVSGATVTVVTTAMTSDAAFAWATR |
Ga0310686_1121319433 | 3300031708 | Soil | MRKIFLLFALVFALVTGATATVVTTAVTSDAALALATR |
Ga0306917_106729662 | 3300031719 | Soil | MRKIFILFALVFALVTTATATVVTTAVTSDAAIAQQVSR |
Ga0306917_110823792 | 3300031719 | Soil | LFILFALVFALVTTATATVVTTDVISDSAIAQQASR |
Ga0306923_124746581 | 3300031910 | Soil | MRKIFILFALVFALVTTATATVVTTAETSDAAIAQQVSR |
Ga0306926_129050342 | 3300031954 | Soil | IFILFALVFALVTTATATVVTTAVTSDAAIAQQVSR |
Ga0307479_106247492 | 3300031962 | Hardwood Forest Soil | MRKIFIPFALVFALVTTATATVVTTAMTSDGAFARATR |
Ga0307479_119051621 | 3300031962 | Hardwood Forest Soil | MRKIFILFALVFALVTGATATMVTTAVTSDAALAPATR |
Ga0318533_107489281 | 3300032059 | Soil | FILFALVFALVTTATATVVTTAVTSDAAIAQQVSR |
Ga0306924_108126292 | 3300032076 | Soil | KIFILFALVFALVTTATATVVTTAVTSDAAIAQQVSR |
Ga0306920_1010001241 | 3300032261 | Soil | MHKIFILFAIVFALVTTATATVVVTAVCSDAAMALATR |
Ga0348332_126130112 | 3300032515 | Plant Litter | GDSIMRKLFILVAVAFALVSTGAATVVTTALTSDAAMALAVR |
Ga0335080_120233562 | 3300032828 | Soil | AQRKWGTIMRKLFILFAVVFALVSGATATVVTTALTSDAAFALATR |
Ga0335072_100875825 | 3300032898 | Soil | MRKLFILFAIVFALVSTATATVVTTALTSDTAMALAVR |
⦗Top⦘ |