NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049254

Metagenome / Metatranscriptome Family F049254

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049254
Family Type Metagenome / Metatranscriptome
Number of Sequences 147
Average Sequence Length 51 residues
Representative Sequence LPAVLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLVIAGWAS
Number of Associated Samples 128
Number of Associated Scaffolds 147

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.04 %
% of genes near scaffold ends (potentially truncated) 91.84 %
% of genes from short scaffolds (< 2000 bps) 95.24 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (55.782 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(23.809 % of family members)
Environment Ontology (ENVO) Unclassified
(14.966 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.898 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 60.53%    β-sheet: 0.00%    Coil/Unstructured: 39.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 147 Family Scaffolds
PF01810LysE 18.37
PF14224DUF4331 5.44
PF07167PhaC_N 2.04
PF04199Cyclase 2.04
PF03706LPG_synthase_TM 2.04
PF01152Bac_globin 1.36
PF00107ADH_zinc_N 1.36
PF13676TIR_2 1.36
PF07690MFS_1 1.36
PF02585PIG-L 0.68
PF00501AMP-binding 0.68
PF00708Acylphosphatase 0.68
PF13578Methyltransf_24 0.68
PF03055RPE65 0.68
PF00535Glycos_transf_2 0.68
PF00908dTDP_sugar_isom 0.68
PF06445GyrI-like 0.68
PF13701DDE_Tnp_1_4 0.68
PF01494FAD_binding_3 0.68
PF02954HTH_8 0.68
PF00356LacI 0.68
PF00652Ricin_B_lectin 0.68
PF00484Pro_CA 0.68
PF07336ABATE 0.68
PF08241Methyltransf_11 0.68
PF12697Abhydrolase_6 0.68
PF10009DUF2252 0.68
PF02577BFN_dom 0.68
PF01474DAHP_synth_2 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 147 Family Scaffolds
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 2.04
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 2.04
COG3243Poly-beta-hydroxybutyrate synthaseLipid transport and metabolism [I] 2.04
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.36
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 1.36
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.68
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.68
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.68
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.68
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 0.68
COG1898dTDP-4-dehydrorhamnose 3,5-epimerase or related enzymeCell wall/membrane/envelope biogenesis [M] 0.68
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.68
COG32003-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase, class IIAmino acid transport and metabolism [E] 0.68
COG3670Carotenoid cleavage dioxygenase or a related enzymeSecondary metabolites biosynthesis, transport and catabolism [Q] 0.68
COG5516Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-bindingGeneral function prediction only [R] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms56.46 %
UnclassifiedrootN/A43.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_101122427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae674Open in IMG/M
3300004629|Ga0008092_11074898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300004635|Ga0062388_100733667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales927Open in IMG/M
3300004635|Ga0062388_101423445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia697Open in IMG/M
3300005181|Ga0066678_10166543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1389Open in IMG/M
3300005329|Ga0070683_100628477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1028Open in IMG/M
3300005435|Ga0070714_100233512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1695Open in IMG/M
3300005436|Ga0070713_101121032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300005468|Ga0070707_100971505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria814Open in IMG/M
3300005561|Ga0066699_10471657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia898Open in IMG/M
3300005602|Ga0070762_10882720All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300005610|Ga0070763_10865081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. AA4537Open in IMG/M
3300005712|Ga0070764_10819325All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300005842|Ga0068858_100195877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1909Open in IMG/M
3300005950|Ga0066787_10103762Not Available608Open in IMG/M
3300006028|Ga0070717_10726590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia902Open in IMG/M
3300006028|Ga0070717_11957000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300006052|Ga0075029_101299024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Acidipropionibacterium → Acidipropionibacterium acidipropionici510Open in IMG/M
3300006163|Ga0070715_10516163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300006172|Ga0075018_10412469All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300006358|Ga0068871_101223483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300006755|Ga0079222_10883187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia747Open in IMG/M
3300006804|Ga0079221_10200460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1093Open in IMG/M
3300006804|Ga0079221_10374765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia870Open in IMG/M
3300006804|Ga0079221_10456231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia813Open in IMG/M
3300006806|Ga0079220_11347410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia601Open in IMG/M
3300006854|Ga0075425_101024234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria942Open in IMG/M
3300006904|Ga0075424_102452529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300009089|Ga0099828_10272191Not Available1521Open in IMG/M
3300009174|Ga0105241_10629611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300009521|Ga0116222_1030327Not Available2401Open in IMG/M
3300009525|Ga0116220_10081058All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300009665|Ga0116135_1099688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1050Open in IMG/M
3300009698|Ga0116216_10310429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus961Open in IMG/M
3300010320|Ga0134109_10043645Not Available1466Open in IMG/M
3300010379|Ga0136449_102441491Not Available752Open in IMG/M
3300010876|Ga0126361_10526443Not Available1227Open in IMG/M
3300010876|Ga0126361_11282334Not Available1128Open in IMG/M
3300010880|Ga0126350_12441462Not Available565Open in IMG/M
3300010937|Ga0137776_1596727Not Available645Open in IMG/M
3300012285|Ga0137370_10804336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300014201|Ga0181537_10952352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300014325|Ga0163163_11404608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300014838|Ga0182030_10979166All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300014969|Ga0157376_13062744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300017926|Ga0187807_1060904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-021172Open in IMG/M
3300017932|Ga0187814_10095180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1098Open in IMG/M
3300017932|Ga0187814_10451587Not Available504Open in IMG/M
3300017934|Ga0187803_10411117Not Available549Open in IMG/M
3300017937|Ga0187809_10238345Not Available655Open in IMG/M
3300017955|Ga0187817_10777966Not Available611Open in IMG/M
3300017961|Ga0187778_11115204Not Available550Open in IMG/M
3300017973|Ga0187780_10370660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1013Open in IMG/M
3300017974|Ga0187777_10869686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae647Open in IMG/M
3300018034|Ga0187863_10369072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia799Open in IMG/M
3300018043|Ga0187887_10025173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB83795Open in IMG/M
3300018044|Ga0187890_10134566Not Available1421Open in IMG/M
3300018046|Ga0187851_10279426Not Available972Open in IMG/M
3300018085|Ga0187772_10481949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300018090|Ga0187770_10954499Not Available689Open in IMG/M
3300020581|Ga0210399_10087598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana2534Open in IMG/M
3300020583|Ga0210401_10939022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia724Open in IMG/M
3300021178|Ga0210408_10724704Not Available782Open in IMG/M
3300021374|Ga0213881_10600659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300021432|Ga0210384_10181180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1893Open in IMG/M
3300021474|Ga0210390_10725937All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300021478|Ga0210402_10849992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium839Open in IMG/M
3300021478|Ga0210402_11624358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300021479|Ga0210410_10282539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1489Open in IMG/M
3300021559|Ga0210409_10710395Not Available876Open in IMG/M
3300021559|Ga0210409_11602686Not Available527Open in IMG/M
3300025527|Ga0208714_1088072Not Available625Open in IMG/M
3300025898|Ga0207692_10040718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2295Open in IMG/M
3300025922|Ga0207646_10514181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1078Open in IMG/M
3300025922|Ga0207646_10924010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria773Open in IMG/M
3300025928|Ga0207700_10228152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1582Open in IMG/M
3300025928|Ga0207700_10724660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria888Open in IMG/M
3300025928|Ga0207700_11901938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300026088|Ga0207641_12054432Not Available572Open in IMG/M
3300026326|Ga0209801_1239361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300027568|Ga0208042_1127070Not Available642Open in IMG/M
3300027725|Ga0209178_1291353Not Available598Open in IMG/M
3300027884|Ga0209275_10402132All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300028716|Ga0307311_10015581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1851Open in IMG/M
3300028742|Ga0302220_10354115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300028747|Ga0302219_10077005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1251Open in IMG/M
3300028759|Ga0302224_10400355Not Available557Open in IMG/M
3300028773|Ga0302234_10243747Not Available774Open in IMG/M
3300028780|Ga0302225_10369993Not Available675Open in IMG/M
3300028801|Ga0302226_10016082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae4145Open in IMG/M
3300028806|Ga0302221_10493813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300028877|Ga0302235_10199937Not Available881Open in IMG/M
3300028879|Ga0302229_10084509All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300029882|Ga0311368_10493324Not Available882Open in IMG/M
3300029882|Ga0311368_10539571Not Available832Open in IMG/M
3300029943|Ga0311340_10760376Not Available822Open in IMG/M
3300029944|Ga0311352_10143222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2073Open in IMG/M
3300029944|Ga0311352_11186474Not Available580Open in IMG/M
3300029993|Ga0302304_10269067Not Available626Open in IMG/M
3300029999|Ga0311339_10248880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1957Open in IMG/M
3300029999|Ga0311339_10927672Not Available823Open in IMG/M
3300029999|Ga0311339_11352810Not Available642Open in IMG/M
3300030007|Ga0311338_11149963Not Available740Open in IMG/M
3300030056|Ga0302181_10157158Not Available1081Open in IMG/M
3300030058|Ga0302179_10205108Not Available870Open in IMG/M
3300030399|Ga0311353_11212306Not Available622Open in IMG/M
3300030503|Ga0311370_10323429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1981Open in IMG/M
3300030509|Ga0302183_10233627Not Available715Open in IMG/M
3300030509|Ga0302183_10373158All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300030520|Ga0311372_11780979Not Available736Open in IMG/M
3300030520|Ga0311372_12416228Not Available594Open in IMG/M
3300030580|Ga0311355_10593554All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300030580|Ga0311355_11155804Not Available686Open in IMG/M
3300030586|Ga0265393_1179019Not Available547Open in IMG/M
3300030618|Ga0311354_10292524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-25271688Open in IMG/M
3300030627|Ga0210269_10307244Not Available554Open in IMG/M
3300030687|Ga0302309_10351367Not Available723Open in IMG/M
3300031028|Ga0302180_10653258Not Available502Open in IMG/M
3300031234|Ga0302325_12399333Not Available633Open in IMG/M
3300031236|Ga0302324_102144649Not Available695Open in IMG/M
3300031525|Ga0302326_11511743Not Available899Open in IMG/M
3300031720|Ga0307469_11678758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae612Open in IMG/M
3300031723|Ga0318493_10702834Not Available567Open in IMG/M
3300031744|Ga0306918_11500408Not Available515Open in IMG/M
3300031751|Ga0318494_10825829Not Available543Open in IMG/M
3300031753|Ga0307477_10919688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300031765|Ga0318554_10392733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae788Open in IMG/M
3300031782|Ga0318552_10328068Not Available779Open in IMG/M
3300031795|Ga0318557_10095122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1313Open in IMG/M
3300031859|Ga0318527_10505794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300031890|Ga0306925_12219538Not Available510Open in IMG/M
3300031897|Ga0318520_10633267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300031912|Ga0306921_11035854Not Available924Open in IMG/M
3300031939|Ga0308174_10963251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300031939|Ga0308174_11330660Not Available614Open in IMG/M
3300031946|Ga0310910_10757838Not Available766Open in IMG/M
3300032065|Ga0318513_10197003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria970Open in IMG/M
3300032067|Ga0318524_10158190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1148Open in IMG/M
3300032089|Ga0318525_10222093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300032090|Ga0318518_10671612Not Available527Open in IMG/M
3300032261|Ga0306920_101939546Not Available827Open in IMG/M
3300032770|Ga0335085_11950038Not Available597Open in IMG/M
3300032828|Ga0335080_12183261Not Available532Open in IMG/M
3300032892|Ga0335081_10273960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2256Open in IMG/M
3300033824|Ga0334840_062574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis algeriensis1084Open in IMG/M
3300034124|Ga0370483_0037591Not Available1493Open in IMG/M
3300034163|Ga0370515_0072117Not Available1503Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa23.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.48%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.08%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.08%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.40%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.40%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.04%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.04%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.04%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.36%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.36%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.36%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.36%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.36%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.68%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.68%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.68%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.68%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.68%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.68%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.68%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.68%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.68%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030586Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030687Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10112242723300002245Forest SoilTAWSLTERIPVYLHVYTLAVAFVAFGISANWLSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYVLIIAGWAS*
Ga0008092_1107489813300004629Tropical Rainforest SoilTSANWISSKPRFILPAVLLALPVARLVAPLRTAVLVPLIGVLAVATTWFGLYLAIIAKWTP*
Ga0062388_10073366733300004635Bog Forest SoilLPAFLLALPLARLLAPVRTSVLVPLIMVLAAASTWFGLYLLAIGGWAP*
Ga0062388_10142344523300004635Bog Forest SoilRYFLPAVLLALPVARLLASLRTSVLVPLIVVFALASTWIGVYLVVIAGWAS*
Ga0066678_1016654333300005181SoilVLLALPVARLLAPLRAAVLIPLVGVLTVATTWFGLYVTVIAKWTP*
Ga0070683_10062847713300005329Corn RhizosphereMLLALPVARLLTPLRTSVLVPLVGVLAVATTWFGLYLAVIARWTP*
Ga0070714_10023351233300005435Agricultural SoilPVARLLAPLRAAVLVPLVGVLTVATTWFGLYVTVIAKWTP*
Ga0070713_10112103213300005436Corn, Switchgrass And Miscanthus RhizospherePAILLALPVARLLAPVRTAVLVPLIVVLTVLSTWYGLYLVAIAGWVP*
Ga0070707_10097150533300005468Corn, Switchgrass And Miscanthus RhizosphereNWVSSKPRFFLPAVLLALPLARLLASLRTSVLVPLIVVLAALSTWVGVYLVVIARWAP*
Ga0066699_1047165723300005561SoilPAVLLALPLARLLAPVRTWVLVPLTGALAVVSTWFGLYLVVIGHWAP*
Ga0070762_1088272013300005602SoilVYTVMVALVSFGISANWLSEKPRYFLPAFLLALPVARLLAPLRTSVLIPLIFVFTLASTWIGVYLLVIAHWAS*
Ga0070763_1086508113300005610SoilPRFMLPAVLLALPLARLLAPLRTSVLVPLIGVLAVATTWFGVYLPVIARWTP*
Ga0070764_1081932513300005712SoilLLALPVARLLAPLRTSVLIPLIFVFTLASTWIGVYLLVIAHWAS*
Ga0068858_10019587723300005842Switchgrass RhizosphereVLLALPVARLLAPLRTAVLVPLVGVLAVATTWFGLYVTVIAKWTP*
Ga0066787_1010376213300005950SoilRLLAPLRTSVLVPLVVSLALASGWLGLYLEVIARWAP*
Ga0070717_1072659013300006028Corn, Switchgrass And Miscanthus RhizosphereMTFATSANWISSKPRFVLPAMLLALPVARLLAPLRTSVLVPLVGVLAVATTWFGLYLAVI
Ga0070717_1195700023300006028Corn, Switchgrass And Miscanthus RhizosphereHERQLDQLQAALPAARVLLALPVARLLVPLVGVLTVATTWFCLYVTVIAKWTP*
Ga0075029_10129902413300006052WatershedsPAVLLALPMARLLAPLRTSVLVPLLAVLTAASTWFGLYLAIIAKWAP*
Ga0070715_1051616323300006163Corn, Switchgrass And Miscanthus RhizosphereAPLRTSVLVPLVGVLAVATTWFGLYLAVIVRWTP*
Ga0075018_1041246923300006172WatershedsLAPLRTSVLVPLIAVLTALSTWFGLYLIVIGRWAP*
Ga0068871_10122348323300006358Miscanthus RhizosphereLPAMLLALPVARLLAPLRTSVLVPLVGVLAVATTWFGLYLAVIARWTP*
Ga0079222_1088318713300006755Agricultural SoilVMAFTSSANWVSSKPRFFLPAVLLALPLARLLASLRTSVLVPLVVVLTVLSTWVGVYLGVIARWAP*
Ga0079221_1020046033300006804Agricultural SoilPRFVLPAMLLALPVARLLAPLRTSVLVPLVGVLAVATTWSGLYLAVIARWAP*
Ga0079221_1037476523300006804Agricultural SoilANWVSSKPRFFLPAVLLALPLARLLASLRTSVLVPLIVVLTVLSTWAGVYIGVIARWAP*
Ga0079221_1045623113300006804Agricultural SoilMTFATSANWISSKPRFVLPAMLLALPVARLLAPLRTAALVPLVGVLAVAATWFGLYLTIIARWTP*
Ga0079220_1134741013300006806Agricultural SoilVLLALPVARLLAPLRTSVLVPLIVVLTLASTWFGLYLLVIARLAS*
Ga0075425_10102423413300006854Populus RhizosphereVARLLAPLRTSVLVPLVGVLAVATTWFGLYLAVIARWTP*
Ga0075424_10245252923300006904Populus RhizospherePAMLLALPVARLLAPLRTSVLVPLVGVLAVAAAWFGLYLTIIARWTP*
Ga0099828_1027219143300009089Vadose Zone SoilLPAVLLALPVARLLAPLRTSVLVPLIVVLTAATTWFGLYLAVIARWTP*
Ga0105241_1062961113300009174Corn RhizosphereMLLALPVARLLAPLRTAALVPLVGVLAVAATWFGLYLTIIARWTP*
Ga0116222_103032713300009521Peatlands SoilALPVARLLAPLRTSVLVPLIAILAVATTWFGLYLTVIAHWTP*
Ga0116220_1008105833300009525Peatlands SoilLAPLRTSVVVPLLAVLTAASTWFGLYLLVIAKWAS*
Ga0116135_109968833300009665PeatlandLAAPLRTPVLVGLIAVLAVVSTWFGLYLLVLTGWAP*
Ga0116216_1031042913300009698Peatlands SoilLAPLRTSVLIPLLVVLTVASTWFGLYLAIIAQWAP*
Ga0134109_1004364523300010320Grasslands SoilFLLPAVLLALPVARLLAPLRTAVLVPLIGVLTVATTWFGLYLTVIQRWAP*
Ga0136449_10244149113300010379Peatlands SoilPLARLLAPLRTSVLVPLIGVLAVATTWFGLYLTVIARWTP*
Ga0126361_1052644323300010876Boreal Forest SoilLLAPLRTSVLVPLIGVLAVATTWFGVYLTVIARWTP*
Ga0126361_1128233423300010876Boreal Forest SoilLARLLAPLRTSVLVTLIAVLTAASTWFPMYLMIIAKWAP*
Ga0126350_1244146213300010880Boreal Forest SoilTTGANWLSEKPRYFLPAVLLALPVARLLAPLRTSVLIPLIIAITLATTWMGVYLLVIARLAS*
Ga0137776_159672723300010937SedimentAFTTSANWLSAKPRYFLPAVLLALPVARLLTPLRTSVLVPLIVVLTLASTWIGLYLLVIARLAS*
Ga0137370_1080433613300012285Vadose Zone SoilLPAVLLALPLARLLASLRTSVLVPLIVVLTVLSTWVGVYIGVIARWAP*
Ga0181537_1095235223300014201BogALGISANWLSEKPRYFLPAVLLALPVARLLAPVRTSVLVPLIAVFTVVSTWIGVYVLIIAGWAS*
Ga0163163_1140460813300014325Switchgrass RhizosphereMLLALPVARLLTPLRTSVLVPLVGVLAVAATWFGLYLTIIARWTP*
Ga0182030_1097916613300014838BogLPAVLLALPLARLLAPLRTSVLVSLIAVLTAASTWFGMYLIIIAKWAP*
Ga0157376_1306274423300014969Miscanthus RhizosphereAVLLALPVARLLAPLRAAVLVPLVGVLTVATTWFGLYVTVIAKWTP*
Ga0187807_106090423300017926Freshwater SedimentMLPACLLTLPVARLLAPFRTWLLVPLIVVLTLASTWMGVYLLVIAGLAS
Ga0187814_1009518033300017932Freshwater SedimentVARRLAPLRTSVLVPLIIVLTVATTWMGVYLLAVAGLAS
Ga0187814_1045158723300017932Freshwater SedimentLMLVLAILAAVALTAWSLTELIPVYLHVYTVMVAVMAFGTSASWLSVKPRFFLPAFLLALPVARRLAPLRTSVLVPLIIVLTLASTWMGIYLLAIAGMAS
Ga0187803_1041111713300017934Freshwater SedimentMLPACLLTLPVARLLAPFRTWLLVPLIVVLTLASTWMGVYLLAVAGLAS
Ga0187809_1023834523300017937Freshwater SedimentVAFGTSAILLSVKPRFFLPAFLLALPVARRLAPLRTSVLVPLIIVLTLASTWMGIYLLAIAGMAS
Ga0187817_1077796613300017955Freshwater SedimentPRFVLPAVLLALPVARLLAPLRTSVLVPLIGVLAVATTWFGLYLTVIARWTP
Ga0187778_1111520423300017961Tropical PeatlandLLARVRTPVLVLLIGVLAAASTWFGLYLLAIVGWAP
Ga0187780_1037066013300017973Tropical PeatlandRFLLPAVLLALPLARLLAPVRTSVLVPLIGVLAAATTWFGLYLTVIAKWTP
Ga0187777_1086968623300017974Tropical PeatlandVVMALMSSANWIGSKPRFILPAILLALPVARLLAPVRTSVLVPLIGVLTVLSTWFSLYLNVIARWAP
Ga0187863_1036907213300018034PeatlandANWISSKPRFVLPAMLLALPVARLLAPLRTSVLVPLIGVLAVATTWFGLYLAIIARWTP
Ga0187887_1002517313300018043PeatlandSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIVMFTLASTWIGVYLVIIAGWAS
Ga0187890_1013456633300018044PeatlandALPLARLAAPLRTPVLVGLIAVLTVVSTWFGLYLLVITGWAP
Ga0187851_1027942613300018046PeatlandLPLARLAAPLRTPVLVGLIAALTVVSTWFGLYLLVICGWVP
Ga0187772_1048194923300018085Tropical PeatlandVLLALPLARLLVAVRTSAVPLIGVLAAATTWFSLHLTVIAERTP
Ga0187770_1095449923300018090Tropical PeatlandLALPAARLLAPLRTSVLVPLIVVLTLASTWMGVYLLVIAHLAS
Ga0210399_1008759833300020581SoilMAFTSSATWVSSKPRFFLPAVLLALPLARLLASLRTSVLVPLIVVLAVLSTWVGVYLGVIARWAP
Ga0210401_1093902213300020583SoilLLPAVLLALPVARLLAPLRAAVLVPLIGVLTVATTWFGLYVTVIAKWTP
Ga0210408_1072470413300021178SoilGASETWFSSKLRFLLPAVLLALPPARALARLRTPVLIPLVAAVAIGTTWFGLYLSVIAKLPP
Ga0213881_1060065913300021374Exposed RockLLAPVRTSVLVPLFGVLAAATTWFGLYLTVIATWTP
Ga0210384_1018118033300021432SoilTSSANWVSSKPRFFLPAVLLALPLARLLASLRTSVLVPLIVVLAVLSTWVGVYLGVIARWAP
Ga0210390_1072593713300021474SoilTERIPVYLHVYTVMVALVSFGISANWLSEKPRYFLPAFLLALPVARLLAPLRTSVLIPLIFVFTLASTWIGVYLLVIAHWAS
Ga0210402_1084999223300021478SoilLAPLRTSVLVPLIVVLTLASTWIGVYLLVIARLAS
Ga0210402_1162435823300021478SoilVTTRAYWISSKPRFLLPAVLLALPVARLLTPLRTAVLVPLVGELTVATTWFCLYVTVIAKWTP
Ga0210410_1028253913300021479SoilFLPAVLLALPLARLLASLRTSVLVPLIVVLAVLSTWVGVYLGVIARWAP
Ga0210409_1071039513300021559SoilRLLASLRTSVLVPLIVGLAVLSTWVGVYLGVIARWAP
Ga0210409_1160268613300021559SoilKPRFFLPAVLLALPLARLLASLRTSVLVPLIVVLAVLSTWVGVYLGVIARWAP
Ga0208714_108807213300025527Arctic Peat SoilAVLLALPLARLLAPVRTSVLVPLIGVLTVATTWFGLYLMVISRWAP
Ga0207692_1004071843300025898Corn, Switchgrass And Miscanthus RhizosphereLPAVLLALPLARLLASLRTSVLVPLIVVLTVLSTWAGVYIGVIARWAP
Ga0207646_1051418133300025922Corn, Switchgrass And Miscanthus RhizosphereLARLLASLRTSVLVPLIVVLTVLSTWVGVYLGVIARWAP
Ga0207646_1092401023300025922Corn, Switchgrass And Miscanthus RhizosphereFFLPAVLLALPLARLLASLRTSVLVPLIVVLAALSTWVGVYLVVIARWAP
Ga0207700_1022815213300025928Corn, Switchgrass And Miscanthus RhizosphereAILLALPVARLLAPVRTAVLVPLIVVLTVLSTWYGLYLVAIAGWVP
Ga0207700_1072466013300025928Corn, Switchgrass And Miscanthus RhizosphereNWISSKPRFVLPAMLLALPAARLLAPLRTSVLVPLVGVLAVATTWFGLYLAVIARWTP
Ga0207700_1190193823300025928Corn, Switchgrass And Miscanthus RhizosphereSSKPRFVLPAMLLALPVARLLAPLRTAALVPLVGVLAVAATWFGLYLTIIARWTP
Ga0207641_1205443213300026088Switchgrass RhizosphereMLLALPVARLLTPLRTSVLVPLVGVLAVATTWFGLYLAVIAR
Ga0209801_123936113300026326SoilVLLALPVARLLAPLRAAVLIPLVGVLTVATTWFGLYVTVIAKWTP
Ga0208042_112707013300027568Peatlands SoilVLLALPVARLLAPLRTSVLVPLIGVLAVATTWFGLYLTVIARWTP
Ga0209178_129135323300027725Agricultural SoilMTFATSANWISSKPRFVLPAMLLALPVARLLAPLRTAALVPLVGVLAVAATWFGLYLTIIARWTP
Ga0209275_1040213213300027884SoilVYTVMVALVSFGISANWLSEKPRYFLPAFLLALPVARLLAPLRTSVLIPLIFVFTLASTWIGVYLLVIAHWAS
Ga0307311_1001558123300028716SoilPLARLLAPLRTAVLVPLIGVLTVAATWFGLYLMVIAKWAP
Ga0302220_1035411523300028742PalsaIPVYLHVYTVVVAVVAFGISANWLSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLIIAGWAS
Ga0302219_1007700513300028747PalsaWLSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLVIAGWAS
Ga0302224_1040035523300028759PalsaPLARLAAPLRTPVLVGLIAVLTVVSTWFGLYLLVITGWAP
Ga0302234_1024374713300028773PalsaLPAVLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLVIAGWAS
Ga0302225_1036999313300028780PalsaRLLAPLRTSVLVPLIVVFTLASTWIGVYLLVIAGWAS
Ga0302226_1001608243300028801PalsaWMSSKPRFILPAVLLTLPIARLLAPLRTSALIPLLAVFTAASAWFGLYLVIIARFAS
Ga0302221_1049381323300028806PalsaAVLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLVIAGWAS
Ga0302235_1019993713300028877PalsaTERIPVYLHVYTVAVAFVAFGISANWLSEKPRYFLPAVLLALPVARLLTPLRTSVLVPLIVVFTLASTWIGVYVLIIAGWAS
Ga0302229_1008450913300028879PalsaSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIAVFTLASTWIGVYVLIIAGWAS
Ga0311368_1049332413300029882PalsaFGISANWLSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLIIAGWAS
Ga0311368_1053957123300029882PalsaALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLIIAGWAS
Ga0311340_1076037623300029943PalsaLARLAAPLRTPVLVGLIAVLTVVSTWFGLYLLVITGWAP
Ga0311352_1014322213300029944PalsaPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLIIAGWAS
Ga0311352_1118647413300029944PalsaLLPAVLLTLPLARLAAPLRTPVLVGLIAVLTVVSTWFGLYLLVITGWAP
Ga0302304_1026906713300029993PalsaVAFTISANWLSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLVIAHWAS
Ga0311339_1024888023300029999PalsaVYLHVYTVVVAVVAFTISANWLSEKPRYFLPAVLLALPVARLLAPLRASVLVPLIVVFTLASTWIGVYLLVIAGWAS
Ga0311339_1092767233300029999PalsaARLLAPLRTSVLVPLIAVFTLASTWIGVYLLIIAGWAS
Ga0311339_1135281013300029999PalsaRLLAPLRTSVLVPLIVVFTLASTWISVYLLVIAGWAS
Ga0311338_1114996333300030007PalsaALPVARLLAPLRTSVLVPLIAVFTLASTWIGVYLLIIAGWAS
Ga0302181_1015715813300030056PalsaAVALTAWSLTERIPVYLHVYTVLVAFVAFTISANWLSEKPRYFLPAVLLALPVARLLAPLRTSVLIPLIVVFTLASTWIGVYLLVIAGWAS
Ga0302179_1020510823300030058PalsaLPAVLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLIIAGWAS
Ga0311353_1121230613300030399PalsaVSFGISANWLSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIFVFTLASTWIGVYLLVIAHWAS
Ga0311370_1032342913300030503PalsaFSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIAVFTLASTWIGVYVLIIAGWAS
Ga0302183_1023362713300030509PalsaVLLTLPIARLLAPLRTSALIPLLAVFTAASAWFGLYLVIIARFAS
Ga0302183_1037315813300030509PalsaLALPLARLLAPLRTSVLVPLIVALALASGWLGLYLEVIAKWAP
Ga0311372_1178097913300030520PalsaFTISANWLSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLVIAGWAS
Ga0311372_1241622823300030520PalsaLPLARLLAPLRTSVLVPLIVSLALASGWLGLYLEVIAKWAP
Ga0311355_1059355423300030580PalsaPAVLLALPLARLLAPLRTSVLVPLIVALALASGWLGLYLEVIAKWAP
Ga0311355_1115580423300030580PalsaRLLAPLRTSILVPLIVVFTLVSTWIGVYLLIIAGWAS
Ga0265393_117901913300030586SoilRLLAPVRTSVLVPLFAVLTALSTWFGLYLIVIARWAP
Ga0311354_1029252423300030618PalsaNWLSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIFVFTLASTWIGVYLLVIAHWAS
Ga0210269_1030724413300030627SoilPAVLLALPVARLLAPVRTSVLVPLFAVLTALSTWFGLYLIVIARWAP
Ga0302309_1035136723300030687PalsaAVLLTLPIARLLAPLRTSALIPLLAVFTAASAWFGLYLVIIARFAS
Ga0302180_1065325813300031028PalsaAFVAFTISANWLSEKPRYFLPAVLLALPVARLLAPLRTSVLIPLIVVFTLASTWIGVYLLVIAGWAS
Ga0302325_1239933313300031234PalsaYTVVVAFVAFTISANWLSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLIIAGWAS
Ga0302324_10214464923300031236PalsaLARLLAPLRTSVLVPLIVSLALASGWLGLYLEVIAKWAP
Ga0302326_1151174323300031525PalsaERIPVYLHVYTVVVAFVAFTISANWLSEKPRYFLPAVLLALPVARLLAPLRTSILVPLIVVFTLVSTWIGVYLLIIAGWAS
Ga0307469_1167875813300031720Hardwood Forest SoilLPAILLALPVARLLAPVRTAVLVPLIVVLTVLSTWYGLYLVAIAGWVP
Ga0318493_1070283413300031723SoilLPAVLLTLPVARLLARVRTPVLVLLIGVLAAASTWFGLYLLAIVGWAP
Ga0306918_1150040823300031744SoilVVAVMAFTSSANWVSSKPRFFLPAVLLALPLARLLASLRTSVLVPLIVVLTVLSTWVGVYLAVIAGWAP
Ga0318494_1082582913300031751SoilARLLAPLRTSILVPLIIVLTLASTWIGVYLLVIARLAS
Ga0307477_1091968813300031753Hardwood Forest SoilALPVARLLAPLRAAVLVPLVGVLTVITTWFGLYVTVIAKWTP
Ga0318554_1039273313300031765SoilLPAFLLALPVARLLAPLRTSVLVPLIALLTALSTWFGLYLIVIGRWAP
Ga0318552_1032806823300031782SoilARLLAPLRASVLVPLIGVLAVATTWFGLYLTVIAKWTP
Ga0318557_1009512213300031795SoilARLLAPVRVRILVPLVAVLAVAAAWFGLYLTAIVGWAP
Ga0318527_1050579413300031859SoilALPVARVLARLRTAVLVPLVVVLAAASTWFGLYLTVIARWTP
Ga0306925_1221953813300031890SoilLTLPLARLLARVRTPVLVLLIGVLAAASTWFGLYLLAIVGWAP
Ga0318520_1063326723300031897SoilILPAFLLALPVARLLAPLRTSVLVPLIAVLTALSTWFGLYLIVIGRWAP
Ga0306921_1103585413300031912SoilVARLLAPLRTSVLVPLIVVLTIASTWFGLYLLVIARLAS
Ga0308174_1096325123300031939SoilVIMTFATSANWISSKPRFVLPAMLLALPVARLLAPLRTSVLVPLVGVLAVAATWFGLYLTIIARWTP
Ga0308174_1133066013300031939SoilMTFATSANWISSKPRFVLPAMLLALPVARLLAPLRTAALVPLVGVLAVAATWFGCT
Ga0310910_1075783813300031946SoilVGVLAFTTSATWLSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIVVLTLGSTWIGVYLLVIARWAS
Ga0318513_1019700313300032065SoilLLALPVARVLARLRTAVLVPLVVVLAAASTWFGLYLTVIARWTP
Ga0318524_1015819023300032067SoilFLLALPVARLLAPLRTSVLVPLIAVLTALSTWFGLYLIVIGRWAP
Ga0318525_1022209313300032089SoilVARLLARLRTVVLVPLVVVLVAASTWFGLYLTVIARWTP
Ga0318518_1067161213300032090SoilVVVAVMAFTSSANWVSSKPRFFLPAVLLALPLARLLASLRTSVLVPLIVVLTVLSTWVGVYLAVIAGWAP
Ga0306920_10193954613300032261SoilPRYFLPAILLALPVARLLAPLRTSILVPLIIVLTLASTWIGVYLLVIARLAS
Ga0335085_1195003823300032770SoilYLLPAVLLALPVARLLAPLRTSVLVPLIVVLTLASTWFGLYLLVIARFAS
Ga0335080_1218326113300032828SoilLARLLAPLRTRVLVPLVGVLVVASTWFGLYITVIARWTP
Ga0335081_1027396013300032892SoilLARLLAPVRTSVLVPLIGVLAAATTWFGLYLTVIAKWTP
Ga0334840_062574_3_1373300033824SoilLLALPVARLLAPLRTSVLVPLIVVFTLASTWIGVYLLVIAGWAS
Ga0370483_0037591_1338_14933300034124Untreated Peat SoilAFPAARLLLALPVARLLAPLRIAVLAGLIVVLTVLSTWFGLYLHLVARWVP
Ga0370515_0072117_1329_15023300034163Untreated Peat SoilWLSEKPRYFLPAVLLALPVARLLAPLRTSVLVPLIVVFTLVSTWIGVYLLVIAGWAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.