NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049155

Metagenome / Metatranscriptome Family F049155

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049155
Family Type Metagenome / Metatranscriptome
Number of Sequences 147
Average Sequence Length 44 residues
Representative Sequence MHTTIRALLGAGLVVTAFGVAVAKLPPPPPLTDAQKAEKA
Number of Associated Samples 133
Number of Associated Scaffolds 147

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 71.43 %
% of genes from short scaffolds (< 2000 bps) 69.39 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.027 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(9.524 % of family members)
Environment Ontology (ENVO) Unclassified
(44.898 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.980 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 42.65%    β-sheet: 0.00%    Coil/Unstructured: 57.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 147 Family Scaffolds
PF01292Ni_hydr_CYTB 51.70
PF00033Cytochrome_B 17.01
PF13247Fer4_11 4.76
PF12838Fer4_7 4.08
PF01568Molydop_binding 2.72
PF00384Molybdopterin 0.68
PF01098FTSW_RODA_SPOVE 0.68
PF14358DUF4405 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 147 Family Scaffolds
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 51.70
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 51.70
COG3038Cytochrome b561Energy production and conversion [C] 51.70
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 51.70
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 51.70
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 17.01
COG0772Peptodoglycan polymerase FtsW/RodA/SpoVECell cycle control, cell division, chromosome partitioning [D] 0.68

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.03 %
UnclassifiedrootN/A31.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100845884All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium612Open in IMG/M
3300000443|F12B_10382203All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria822Open in IMG/M
3300001213|JGIcombinedJ13530_100303681All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria587Open in IMG/M
3300004051|Ga0055492_10022294All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1100Open in IMG/M
3300005293|Ga0065715_10267348Not Available1097Open in IMG/M
3300005328|Ga0070676_11618938All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300005336|Ga0070680_100280277All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1412Open in IMG/M
3300005347|Ga0070668_101261772All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria671Open in IMG/M
3300005365|Ga0070688_100975352Not Available672Open in IMG/M
3300005445|Ga0070708_100880236All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria841Open in IMG/M
3300005518|Ga0070699_100604343All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1000Open in IMG/M
3300005547|Ga0070693_100180521All Organisms → cellular organisms → Bacteria → Proteobacteria1359Open in IMG/M
3300005569|Ga0066705_10636627All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300005578|Ga0068854_101658849All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria584Open in IMG/M
3300005616|Ga0068852_102848752All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → Methyloversatilis universalis502Open in IMG/M
3300006050|Ga0075028_100228566All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1014Open in IMG/M
3300006173|Ga0070716_101853881All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium500Open in IMG/M
3300006642|Ga0075521_10165791All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1040Open in IMG/M
3300006852|Ga0075433_11953115All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium503Open in IMG/M
3300006881|Ga0068865_100199570All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus1552Open in IMG/M
3300009084|Ga0105046_10318125All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1644Open in IMG/M
3300009131|Ga0115027_11803386All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria512Open in IMG/M
3300009148|Ga0105243_10198252All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1759Open in IMG/M
3300009174|Ga0105241_10308007All Organisms → cellular organisms → Bacteria → Proteobacteria1361Open in IMG/M
3300009177|Ga0105248_10208122All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2204Open in IMG/M
3300009177|Ga0105248_10984341All Organisms → cellular organisms → Bacteria → Proteobacteria953Open in IMG/M
3300009870|Ga0131092_10442817All Organisms → cellular organisms → Bacteria → Proteobacteria1191Open in IMG/M
3300010364|Ga0134066_10384717All Organisms → cellular organisms → Bacteria → Proteobacteria530Open in IMG/M
3300010373|Ga0134128_12342485All Organisms → cellular organisms → Bacteria → Proteobacteria588Open in IMG/M
3300010397|Ga0134124_11409911All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria723Open in IMG/M
3300010403|Ga0134123_10815030All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria929Open in IMG/M
3300010403|Ga0134123_13401108All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium514Open in IMG/M
3300012212|Ga0150985_102138647All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2828Open in IMG/M
3300012355|Ga0137369_10348401All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1083Open in IMG/M
3300012362|Ga0137361_10470385All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1154Open in IMG/M
3300012501|Ga0157351_1026188All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria652Open in IMG/M
3300012905|Ga0157296_10078018All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria854Open in IMG/M
3300012908|Ga0157286_10143216All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria753Open in IMG/M
3300012914|Ga0157297_10313670All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria595Open in IMG/M
3300012977|Ga0134087_10266030All Organisms → cellular organisms → Bacteria → Proteobacteria791Open in IMG/M
3300012986|Ga0164304_10321274All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis1069Open in IMG/M
3300012987|Ga0164307_11326183All Organisms → cellular organisms → Bacteria → Proteobacteria602Open in IMG/M
3300012989|Ga0164305_10546265All Organisms → cellular organisms → Bacteria → Proteobacteria921Open in IMG/M
3300013296|Ga0157374_12410967All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria553Open in IMG/M
3300013307|Ga0157372_12679146All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300014313|Ga0075347_1053124All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium843Open in IMG/M
3300014325|Ga0163163_12814292All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium543Open in IMG/M
3300014326|Ga0157380_11322477All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria769Open in IMG/M
3300015201|Ga0173478_10495615All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium610Open in IMG/M
3300015372|Ga0132256_100339800All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1593Open in IMG/M
3300018063|Ga0184637_10793004All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria506Open in IMG/M
3300018073|Ga0184624_10390476All Organisms → cellular organisms → Bacteria → Proteobacteria619Open in IMG/M
3300020070|Ga0206356_10225967All Organisms → cellular organisms → Bacteria → Proteobacteria530Open in IMG/M
3300020076|Ga0206355_1682121All Organisms → cellular organisms → Bacteria → Proteobacteria694Open in IMG/M
3300021074|Ga0194044_10326715All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria579Open in IMG/M
3300022756|Ga0222622_11157349All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300023069|Ga0247751_1099660All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria523Open in IMG/M
3300023102|Ga0247754_1004340All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2732Open in IMG/M
3300023102|Ga0247754_1152860All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria574Open in IMG/M
3300025315|Ga0207697_10131528All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300025899|Ga0207642_10405852All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria816Open in IMG/M
3300025901|Ga0207688_11063410All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300025919|Ga0207657_10832072All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria713Open in IMG/M
3300025919|Ga0207657_11414232All Organisms → cellular organisms → Bacteria → Proteobacteria522Open in IMG/M
3300025927|Ga0207687_11951703All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium501Open in IMG/M
3300025930|Ga0207701_10159793All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1995Open in IMG/M
3300025930|Ga0207701_11028057Not Available685Open in IMG/M
3300025936|Ga0207670_10712523All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria831Open in IMG/M
3300025937|Ga0207669_10783674All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria789Open in IMG/M
3300025938|Ga0207704_11992302All Organisms → cellular organisms → Bacteria → Proteobacteria500Open in IMG/M
3300025940|Ga0207691_10220917All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1643Open in IMG/M
3300025949|Ga0207667_12042782All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria533Open in IMG/M
3300025961|Ga0207712_10792127All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria833Open in IMG/M
3300025986|Ga0207658_11315688Not Available661Open in IMG/M
3300026041|Ga0207639_10153732All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1930Open in IMG/M
3300026041|Ga0207639_11155578All Organisms → cellular organisms → Bacteria → Proteobacteria726Open in IMG/M
3300026089|Ga0207648_11873259All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300027775|Ga0209177_10254796All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300027841|Ga0209262_10636339All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium517Open in IMG/M
3300027915|Ga0209069_10387009All Organisms → cellular organisms → Bacteria → Proteobacteria763Open in IMG/M
3300028379|Ga0268266_10132715All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2228Open in IMG/M
3300028379|Ga0268266_11210606All Organisms → cellular organisms → Bacteria → Proteobacteria730Open in IMG/M
3300028861|Ga0302259_1109827All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria675Open in IMG/M
3300030294|Ga0311349_11150597All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria725Open in IMG/M
3300031564|Ga0318573_10636868All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria574Open in IMG/M
3300031722|Ga0311351_10226931All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1414Open in IMG/M
3300031731|Ga0307405_11222689All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium651Open in IMG/M
3300031771|Ga0318546_11231074All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria526Open in IMG/M
3300031833|Ga0310917_10112508All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1764Open in IMG/M
3300031846|Ga0318512_10140978All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1158Open in IMG/M
3300031939|Ga0308174_10835347All Organisms → cellular organisms → Bacteria → Proteobacteria775Open in IMG/M
3300031943|Ga0310885_10021523All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2410Open in IMG/M
3300031944|Ga0310884_10052019All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1840Open in IMG/M
3300031996|Ga0308176_12403064All Organisms → cellular organisms → Bacteria → Proteobacteria562Open in IMG/M
3300032126|Ga0307415_101894809All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium579Open in IMG/M
3300032211|Ga0310896_10171641All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1045Open in IMG/M
3300032421|Ga0310812_10364808All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300033406|Ga0316604_10081189All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1687Open in IMG/M
3300033413|Ga0316603_11173554All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria727Open in IMG/M
3300033414|Ga0316619_11095172All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium698Open in IMG/M
3300033418|Ga0316625_100941273Not Available761Open in IMG/M
3300033419|Ga0316601_100570506All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1096Open in IMG/M
3300033419|Ga0316601_100717717Not Available982Open in IMG/M
3300033482|Ga0316627_101532682All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium675Open in IMG/M
3300033513|Ga0316628_102746690All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium648Open in IMG/M
3300034115|Ga0364945_0148005Not Available704Open in IMG/M
3300034281|Ga0370481_0074739All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1108Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.80%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.44%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.08%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.08%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.40%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.72%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.04%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.04%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.04%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.04%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.04%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.36%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.36%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.68%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.68%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.68%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.68%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.68%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.68%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.68%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.68%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.68%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.68%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.68%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300004051Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009084Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly)EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014313Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015087Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300021074Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17mEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023069Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028861Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10084588413300000364SoilMKTIRAVLAAAFVVVSFGVAVAKLPAPAPLTDAQK
F12B_1038220323300000443SoilMTTLRPLVAALLVIATFGIAIAKLPPPAPLTDAQKAAAEEK
JGIcombinedJ13530_10030368113300001213WetlandMTTMRAMIAAALVVATWGVAVAKLPPPAPLTDAQKA
JGI24747J21853_105021323300001978Corn, Switchgrass And Miscanthus RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKAAKDKASADAEAAR
Ga0055492_1002229413300004051Natural And Restored WetlandsMKTLRALVAAGLVVATFGVAVAKLPPPPPLTDAQKQAAEEKKAKD
Ga0062595_10088657433300004479SoilMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKAAKDKASADAEAARLNKAMDRAAAAYIADQKAKGI
Ga0065715_1026734813300005293Miscanthus RhizosphereMKTTQALVTAGLVVATFGLAVAKLPAPPPMTDAQKEEAKAK
Ga0070658_1048405733300005327Corn RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKAAKDKASADAEAARLNKAMDRAAAAY
Ga0070676_1161893823300005328Miscanthus RhizosphereMNRTVRALLGASLVVAAFSAAVAKLPPAPPLTEEQKADKA
Ga0070683_10106854323300005329Corn RhizosphereMNTTLRALASALLVVGLFGVAVAKLPVPPQTEEQKAAAEAKKAKDAVAAEEAKKQ
Ga0070683_10195580323300005329Corn RhizosphereMNVTLRALVAAGLCAGLFGAAVAKLPPPTPEQKAAAEAKKEKDDAAAEKAKKE
Ga0070677_1013898323300005333Miscanthus RhizosphereMQTTIRVLLGPALVVTVFGVAVAKLPPAPPLTEEQKAENAAKDKAAADTAK
Ga0070680_10028027733300005336Corn RhizosphereMNTTLRALVSAGLVVSLFGVAMAKLPPAPPMTEEQKAAAEAKK
Ga0070660_10007842253300005339Corn RhizosphereMRTTIRALTGAALVVAAFGVAVAKLPPAPPLTDQQKAEKAANDKATADAAKAEL
Ga0070668_10126177213300005347Switchgrass RhizosphereMTTLRALTGAILVLGAFGIATAKLPAPPPPTDAQKAAAEEKKAK
Ga0070669_10088242623300005353Switchgrass RhizosphereMQTTIRVLLGPALVVTVFGVAVAKLPPAPPLTEEQKAENAAKDKAAADTAKAQLVRAEDK
Ga0070669_10122570413300005353Switchgrass RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKATKDKAAADAEAA
Ga0070688_10097535223300005365Switchgrass RhizosphereMMTTMRAMIGAGLVLACFGVAMAKLPPAPPLTDAQKVAAE
Ga0070667_10157901333300005367Switchgrass RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKATKDKASADAEAAKLNKAMDR
Ga0070709_1125297213300005434Corn, Switchgrass And Miscanthus RhizosphereMQTTIRALLGAALVVTALGVALAKLPPPPPMTDQQKAEKAAKDKATADS
Ga0070708_10088023613300005445Corn, Switchgrass And Miscanthus RhizosphereMTTLRALIAAALIVGLFGVAVAKLPPPVLTDAQKAAADDKKAKD
Ga0070699_10060434313300005518Corn, Switchgrass And Miscanthus RhizosphereMTTLRALIAAALIVGLFGVAVAKLPPPVLTDAQKAAADDKKAK
Ga0070684_10075763013300005535Corn RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKATKDKATADAEAARLNKAMDRAAERYIADQKAKGI
Ga0070693_10018052123300005547Corn, Switchgrass And Miscanthus RhizosphereMHTTIRALIGAAIVVAAFGVAVAKLPPAPPLTDQQKAEKA
Ga0066705_1063662713300005569SoilMTNLKSLRALLGAAFVLGAFTLATAKLPPPPPMTPEQKAA
Ga0066708_1076251013300005576SoilMTTLRALIAAALIVGLFGVAVAKLPPPAPLTDAQKAAADDKKAKDAAAA
Ga0068854_10165884933300005578Corn RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKATKDKAS
Ga0068852_10284875233300005616Corn RhizosphereMNPTLRALTAAVLVVALYGAAVAKLPAPPPLTEEQK
Ga0075024_10055531223300006047WatershedsMKTLRALIAAALVVGLFGAALAKLPPPAPPTDAQKAAAEEKKAKDAAA
Ga0075028_10022856623300006050WatershedsMTTLRALIAAALVAGLFGVAVAKLPPPAPLTDAQKAAADEKKAKDA
Ga0070716_10173275513300006173Corn, Switchgrass And Miscanthus RhizosphereMQTTIRALMGAGLIMTAFGVALAKLPPAPPMTDEQKTEKAAKDKATADAEAARLNK
Ga0070716_10185388113300006173Corn, Switchgrass And Miscanthus RhizosphereMKTIRAVLAAAFVVVSFGVAVAKLPAPAPMTDAQKAEAK
Ga0097621_10001228673300006237Miscanthus RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKATKDKAAADAEA
Ga0075521_1016579113300006642Arctic Peat SoilMRTTIRALAMAALTLATFSVAVAKLPPPAPLTNAQKVAAE
Ga0075433_1195311523300006852Populus RhizosphereMKSWQAVGAAALVVGMFGIAVAKLPPPPPMTDAQKATADE
Ga0068865_10019957013300006881Miscanthus RhizosphereMNTTIRALLGAGLVVAAFSAAVAKLPPAPPLTEEQKADKAA
Ga0105046_1031812543300009084FreshwaterMNTIRALIGATLVVATFGLAVAKLPPPPPMTDAQKAAA
Ga0115027_1180338623300009131WetlandMTSLRAILAAGLVVLTFGVAVAKLPAPPPPTEEQKA
Ga0105243_1019825243300009148Miscanthus RhizosphereMKTIRAVFGAALVVVTFGLAVAKLPPAPPMTDAQKATAE*
Ga0105241_1030800713300009174Corn RhizosphereMQTTIRALLGAALVVGAFGVAVAKLPPAPPLTDEQKAAKAA
Ga0105248_1020812213300009177Switchgrass RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKAAKDK
Ga0105248_1098434123300009177Switchgrass RhizosphereMQTTIRALLGAALVVGAFGVAVAKLPPAPPLTDEQKAAKAAKD
Ga0131092_1044281723300009870Activated SludgeMTTIRALIGATLVVACFGVAVAKLPPPPPLTDAQKAAAD
Ga0134066_1038471713300010364Grasslands SoilMTTVRALLGAALVVGAFTLATAKLPPPPPMTDAQKAAAEEK
Ga0134128_1234248513300010373Terrestrial SoilMHTTIRALLGAGLVVTAFGVAVAKLPPPPPLTDAQKAEKAA
Ga0134124_1140991113300010397Terrestrial SoilMTSLRALLAAGLVILTFSVAVAKLPPPPPLTDEQKAAAETAKAKAA
Ga0134123_1081503033300010403Terrestrial SoilMQTTIRALLGDGLVVTAFGVAVAKLPPVPPMTDEQKAEK
Ga0134123_1340110813300010403Terrestrial SoilMKTIRALSAAALVVASFGLAVAKLPPAPPMTDAQKAAA
Ga0105246_1178484223300011119Miscanthus RhizosphereMNTTIRALLGAGLVVAAFSAAVAKLPPAPPLTEEQKADKAAKDKSAADAA
Ga0150985_10213864753300012212Avena Fatua RhizosphereMLKTLRAILAAALVVAAFGVAVAKLPPAPPLTDEQKADKA
Ga0137369_1034840113300012355Vadose Zone SoilMTTLRALVAALLVIATFRIAVAKLPPPAPLPDAQKTAADEKKA
Ga0137361_1047038523300012362Vadose Zone SoilMTTLRALIAAAMVVLTFGWAVAKLPPPAPLDEKAKAAAEE
Ga0157351_102618813300012501Unplanted SoilMQTTIRALLGAGLIVTAFGVAVAKLPPVPPMTDEQKAEKAAKDKAS
Ga0157296_1007801813300012905SoilMRRESMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKA
Ga0157286_1014321613300012908SoilMQTTIRALLGGGLVVTAFGVAVAKLPPVPPMTDEQKAEKATKDK
Ga0157297_1031367033300012914SoilMTTIRGLIGAVLVLACFGVAVAKLPPAPPLTDAQKAAAEEKKAKD
Ga0164302_1091446323300012961SoilMQTTIRVLLGPALVVTVFGVAVAKLPPAPPLTEEQKAENAAKDKAAADTAKAQLV
Ga0134087_1026603013300012977Grasslands SoilMTTVRALLGAALVLGAFTLATAKLPPPPPMTDAQKAAAEEK
Ga0164308_1111024513300012985SoilMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKAAKDKASADAEAA
Ga0164304_1032127433300012986SoilMQTTIRALLGAGLIVTAFGVAVAKLPPVPPMTDEQK
Ga0164307_1035699923300012987SoilMQTTIRALIGAALVVTAFGVAVAKLPPAPPMTDQQKAEKAAKDKASADAAKTELTRAEDKAFDNYVANEK
Ga0164307_1132618313300012987SoilMQTTIRALLGAALVVTAFGVAVAKLPPTPPLTDEQKAAKAAKDK
Ga0164305_1054626513300012989SoilMQTTIRALLGAALVVTAFGVAVAKLPPAPPLTEEQKAEKATKDKA
Ga0157374_1241096713300013296Miscanthus RhizosphereMTSLRALLAAGLVIVTFSVAVAKLPPPPPLTDEQKAAAETAKAKAAA
Ga0157372_1267914623300013307Corn RhizosphereMQTTIRALLGAALVVTAFGVAVAKLPPAPPMTEEQK
Ga0075347_105312423300014313Natural And Restored WetlandsMKTLRALVAAGLVVATFGVAVAKLPPPPPLTDAQK
Ga0163163_1281429223300014325Switchgrass RhizosphereMKTMQAVLAAGLVVATFSLAVAKLPAPPPMTDAQKATAE
Ga0157380_1132247713300014326Switchgrass RhizosphereMTTIRGLIGAALVLACFGVAVAKLPPAPPLTDAQKAAAEEKKAKDA
Ga0167637_102132123300015087Glacier Forefield SoilMKTNTKELSGMTTFRALFAALMVVASFGLAIAKLPPPPPMDDAAKAAAEEKKG
Ga0173478_1049561513300015201SoilMKTTQALVTAGLVVATFGFAVAKLPAPPPMTDAQKEEAK
Ga0132256_10033980013300015372Arabidopsis RhizosphereMTTLRTLIAAALVVGLFGVAVAKLPPPAPLTDAQKAAAEEKKSKD
Ga0184637_1079300423300018063Groundwater SedimentMTTLRALIAAGIVVATFGIALAKLPPPAPMTDAQK
Ga0184624_1039047623300018073Groundwater SedimentMKTILAILAATIVVASFGVAVAKLPPGPPLTDAQKAEAKAKAD
Ga0190265_1342473313300018422SoilMKTLRALVAAGIVVASFSVAVAKLPPPAPLTEEQKKAAEEKKAKDAVAA
Ga0173479_1082400523300019362SoilMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKATKDKATADAEAARLNKAMD
Ga0206356_1022596733300020070Corn, Switchgrass And Miscanthus RhizosphereMQTTIRALLGAALVVGAFGVAVAKLPPAPPMTDQQK
Ga0206355_168212123300020076Corn, Switchgrass And Miscanthus RhizosphereMHTTIRALIGAAIVVAAFGVAVAKLPPAPPLTDQQKAE
Ga0194044_1032671523300021074Anoxic Zone FreshwaterMTTLRAILAAALVVFSFGVAVAKLPPAPPMTDEQK
Ga0222622_1115734923300022756Groundwater SedimentMTNVRALLGAALLLGAFTLATAKLPAPPPMTDEQK
Ga0247751_109966023300023069SoilMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEK
Ga0247754_100434013300023102SoilMTTTIRGLLGAVLVLVCFGVAVAKLPPAPPLTDAQKAAAEE
Ga0247754_115286013300023102SoilMTTIRGLVGAMLVLACFGVAVAKLPPAPPLTDAQKVAAEEKKAKDA
Ga0207697_1013152823300025315Corn, Switchgrass And Miscanthus RhizosphereMHTTIRALLGAGLVVTAFGVAVAKLPPPPPLTDAQKAEKA
Ga0207642_1040585233300025899Miscanthus RhizosphereMTTIRGLIGAALVLACFGVAVAKLPPAPPLTDAQKAAAEEKKAMDA
Ga0207688_1106341023300025901Corn, Switchgrass And Miscanthus RhizosphereMKTTQALVTAGLVVATFGLAVAKLPAPPPMTDAQKEEAK
Ga0207705_1145886913300025909Corn RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPAPPMTDEQKAEKATKDKASADAEAAKLNKAM
Ga0207654_1127253323300025911Corn RhizosphereMQTTFKALLSAALVVGLFGVAVAKLPPPLPQTDEQKAEKAAKDKAAADAAK
Ga0207657_1083207233300025919Corn RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAQKAA
Ga0207657_1141423213300025919Corn RhizosphereMQTTIRALAAAALVVAAFGVAVAKLPPAPPLTDEQKA
Ga0207681_1049555233300025923Switchgrass RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKAAKDKASAD
Ga0207687_1193833413300025927Miscanthus RhizosphereMHTTIRALLGAGLVVTAFGVAVAKLPPPPPLTDAQKAEKAASDKATAD
Ga0207687_1195170323300025927Miscanthus RhizosphereMKTIRAILAATIVVASFGVAVAKLPPGPPLTDAQKAEAKAKA
Ga0207664_1072564913300025929Agricultural SoilMQTTIRALLGAALVVSAFGIALAKLPPAPPMTDAQKAEKAAKDKATADAEKAA
Ga0207701_1015979313300025930Corn, Switchgrass And Miscanthus RhizosphereMQTTIRVLLSPALVVTVFGVAVAKLPPAPPLTEEQKAENAAKDKAA
Ga0207701_1102805733300025930Corn, Switchgrass And Miscanthus RhizosphereMTTLRALAGAAMVLAAFGVAMAKLPAPPPLTDAQK
Ga0207644_1018094843300025931Switchgrass RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKATKDKAAADAEAAKLNKAMDRTAQRYIADQKA
Ga0207670_1071252313300025936Switchgrass RhizosphereMTSLRALLAAGLVILTFSVAVAKLPPPPPLTDEQKAAAETAKAKA
Ga0207669_1078367413300025937Miscanthus RhizosphereMTTIRGLIGAVLVLACFGVAVAKLPPAPPLTDAQK
Ga0207704_1110661913300025938Miscanthus RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKATKDKASADAEAAKLNK
Ga0207704_1199230223300025938Miscanthus RhizosphereMTTLRALAGAALVLGAFGVAMAKLPAPPPLTDAQKVAAEEK
Ga0207691_1022091713300025940Miscanthus RhizosphereMTTMRAMIGAGLVLACFGVAMAKLPPAPPLTDAQKVA
Ga0207679_1069683723300025945Corn RhizosphereMHTTIRALIGAAIVVAAFGVAVAKLPPAPPLTDQQKAEKAAKDKATADAEKAALT
Ga0207667_1204278213300025949Corn RhizosphereMQTTIRALLGVSLVVGAFGVALAKLPPAPPMTDAQ
Ga0207651_1172425423300025960Switchgrass RhizosphereMKTTQALVTAGLVVATFGFAVAKLPAPPPMTDAQKEEAKAKAAAAAALT
Ga0207712_1079212713300025961Switchgrass RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKA
Ga0207658_1131568823300025986Switchgrass RhizosphereMKSWQAVCAAALVVGTFGLAVAKLPAPPPMTDAQK
Ga0207639_1015373213300026041Corn RhizosphereMKTIRAVFGAALVVVTFGLAVAKLPPAPPMTDAQKATAEEAK
Ga0207639_1115557823300026041Corn RhizosphereMQTTIRALIGAALVVTAFGVAVAKLPPAPPMTDQQK
Ga0207648_1187325923300026089Miscanthus RhizosphereMKTTQALVTAGLVVATFGLAVAKLPAPPPMTDAQK
Ga0209177_1025479623300027775Agricultural SoilMQTTIRALLGAALVVGAFGVAVAKLPPAPPMTDEQKA
Ga0209262_1063633913300027841FreshwaterMTTLRAILSALLVVGTFGVAVAKLPPPPPLTDAQKAAAEEKK
Ga0209450_1087769623300027885Freshwater Lake SedimentMTTLRALIAAGLVVGTFGVAVAKLPAPPPMTDAQKAAAEEKKGKDAVAAEAA
Ga0209069_1038700913300027915WatershedsMNTIRALIGATLVVATFGLAVAKLPPPPPMTDAQKAAAEEAKAKTAASA
Ga0268266_1013271543300028379Switchgrass RhizosphereMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKATKDK
Ga0268266_1121060613300028379Switchgrass RhizosphereMTTLRALAGAALVLGAFGVAMAKLPAPPPLTDAQKV
Ga0247822_1062290913300028592SoilMKTTQALVTAGLVVATFGLAVAKLPAPPPMTDAQKEEAKAKAAAA
Ga0302259_110982723300028861FenMTTLRALIAAALVVGLFGMAVAKLPPPAPLTDAQK
Ga0247827_1095728213300028889SoilMQTTIRALLGAGLVVTAFGVAVAKLPPAPPMTDEQKAEKATKDKAAADADAAKL
Ga0311349_1115059713300030294FenMKSLRAILAAALVVLCFGVAVAKLPPPAPLTDEQKAAAEATKAKAA
Ga0318573_1063686813300031564SoilMTTLRATIGAALVLAAFGVAVAKLPPPPPMTEEQKAEKAA
Ga0311351_1022693113300031722FenMKTIRAVLAATLVVASFGIAVAKLPPAAPLTDAQKAEAKAK
Ga0307405_1122268923300031731RhizosphereMKTMQAVLAAGLVVATFGIAVAKLPAPPPMTDAQKAAAEE
Ga0318546_1123107423300031771SoilMKTLRALAGAAMVLAAFGVAMAKLPVPPPPTDAQKAAAEE
Ga0310917_1011250843300031833SoilMTTLRATIGAALVLAAFGVAVAKLPPPPPMTEEQKAEK
Ga0318512_1014097813300031846SoilMTTLRATIGAALVLAAFGVAVAKLPPPPPMTEEQKAEKAAKEK
Ga0307407_1086111213300031903RhizosphereMKTLRALIAAGLIVTTFGVAVAKLPPPAPLTEEQKKAAEEKKVKDAAA
Ga0308175_10149855223300031938SoilMSPTVRALTTAALVVALFGVAVAKIPVPPLTEEQKAAAEGKKAKDAAAAA
Ga0308174_1083534713300031939SoilMHTTIRAVLGAALVVTAFGVAVAKLPPAPPLTDEQ
Ga0310885_1002152313300031943SoilMTTTIRGLLGAVLVLVCFGVAVAKLPPAPPLTDAQK
Ga0310884_1005201913300031944SoilMQTTIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQK
Ga0308176_1240306423300031996SoilMHTTIRAVLGAALVVTAFGVAVAKLPPAPPLTDEQKAAKAAK
Ga0310890_1053312633300032075SoilMQTTIRALLGAGLVVTAFGLAVAKLPPVPPMTDEQKAEKAAKDKASADAEAAKLNKAMDRAA
Ga0326721_1101403623300032080SoilMNPTLRALTAAFLVVALYGGAVAKLPAPPPMTEEQKAAAEAKKAK
Ga0307415_10189480923300032126RhizosphereMKTLRALIAAGLVVATFGVAVAKLPPPAPLTEEQKK
Ga0310889_1054066223300032179SoilMQITIRALLGAGLVVTAFGVAVAKLPPVPPMTDEQKAEKATKDKATADAEAARLNKAMDRAAERYIADQKAKG
Ga0310896_1017164123300032211SoilMTTTIRGLLGAVLVLVCFGVAVAKLPPAPPLTDAQKAAAEEKKAKDA
Ga0310812_1036480823300032421SoilMQTTFKALLSAALVVGLFGVAVAKLPPPPPQTDEQKAEKA
Ga0316604_1008118913300033406SoilMNTLRALVAAGLVVATFGVAVAKLPPPPPLTDAQKQAAEEK
Ga0316603_1117355413300033413SoilMTTLRAILAAALVVVSFGVAVAKLPAPPPMTDEQKAAAE
Ga0316619_1109517213300033414SoilMNTLRALVAAGLVVATFGVAVAKLPPPPPLTDAQKQAAEEKKAKDAV
Ga0316625_10094127313300033418SoilMRTIRAVLGATLVVASFGLAVAKLPPPPPMTDAQKAAAEE
Ga0316601_10057050613300033419SoilMTTIRALIAAALVVATWSVAVAKLPLPPPLTDAQKAAAEE
Ga0316601_10071771723300033419SoilMRTIRAVLGATLVVASFGLAVAKLPPPPPMTDAQKAAAE
Ga0316627_10153268213300033482SoilMRTIRAVLGATLVVASFGLAVAKLPPPPPMTDAQKAA
Ga0316628_10274669023300033513SoilMTMTTLRALIAAGLVVATFGVAVAKLPAPPPPTDAQK
Ga0364945_0148005_1_1083300034115SedimentMKTIRAVLAAAFVVVSFGVAVAKLPVPAPLTDAQKA
Ga0370481_0074739_1_1263300034281Untreated Peat SoilMKTIRAVLAATLVVASFGVAVAKLPPAPPLTDVQKAEAKAKA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.