Basic Information | |
---|---|
Family ID | F048977 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 147 |
Average Sequence Length | 43 residues |
Representative Sequence | MHTWIDGWDWFWMTLMMGFWLVVLGAVIYIAVRLAQRPPTKPRAG |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 147 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 78.91 % |
% of genes near scaffold ends (potentially truncated) | 18.37 % |
% of genes from short scaffolds (< 2000 bps) | 69.39 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.871 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (41.497 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.381 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.537 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 147 Family Scaffolds |
---|---|---|
PF00403 | HMA | 13.61 |
PF11666 | DUF2933 | 8.16 |
PF00196 | GerE | 4.08 |
PF14342 | DUF4396 | 4.08 |
PF07992 | Pyr_redox_2 | 2.72 |
PF00005 | ABC_tran | 2.72 |
PF04972 | BON | 2.04 |
PF00462 | Glutaredoxin | 2.04 |
PF07883 | Cupin_2 | 2.04 |
PF02627 | CMD | 1.36 |
PF00034 | Cytochrom_C | 1.36 |
PF00571 | CBS | 1.36 |
PF02583 | Trns_repr_metal | 1.36 |
PF00702 | Hydrolase | 1.36 |
PF03401 | TctC | 0.68 |
PF13191 | AAA_16 | 0.68 |
PF06224 | HTH_42 | 0.68 |
PF08281 | Sigma70_r4_2 | 0.68 |
PF01475 | FUR | 0.68 |
PF00578 | AhpC-TSA | 0.68 |
PF13579 | Glyco_trans_4_4 | 0.68 |
PF13565 | HTH_32 | 0.68 |
PF08940 | DUF1918 | 0.68 |
PF04945 | YHS | 0.68 |
PF00296 | Bac_luciferase | 0.68 |
PF12849 | PBP_like_2 | 0.68 |
PF08002 | DUF1697 | 0.68 |
PF01022 | HTH_5 | 0.68 |
PF00753 | Lactamase_B | 0.68 |
PF12704 | MacB_PCD | 0.68 |
PF07695 | 7TMR-DISM_7TM | 0.68 |
PF12716 | Apq12 | 0.68 |
PF00361 | Proton_antipo_M | 0.68 |
PF00116 | COX2 | 0.68 |
PF01244 | Peptidase_M19 | 0.68 |
PF01545 | Cation_efflux | 0.68 |
PF09948 | DUF2182 | 0.68 |
PF13071 | DUF3935 | 0.68 |
PF09832 | DUF2059 | 0.68 |
COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
---|---|---|---|
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 13.61 |
COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 13.61 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.36 |
COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 1.36 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.36 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.68 |
COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.68 |
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.68 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.68 |
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.68 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.68 |
COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.68 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.68 |
COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.68 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.68 |
COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.87 % |
Unclassified | root | N/A | 23.13 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459021|G14TP7Y02IH4I3 | Not Available | 661 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0753818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1538 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0755177 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
3300000156|NODE_c0280471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300000550|F24TB_11912957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
3300000953|JGI11615J12901_10106797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
3300000956|JGI10216J12902_103051035 | Not Available | 1144 | Open in IMG/M |
3300000956|JGI10216J12902_103996577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3407 | Open in IMG/M |
3300000956|JGI10216J12902_106595524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 803 | Open in IMG/M |
3300000956|JGI10216J12902_115631163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
3300001537|A2065W1_10111741 | Not Available | 687 | Open in IMG/M |
3300001538|A10PFW1_10576057 | Not Available | 3044 | Open in IMG/M |
3300003990|Ga0055455_10004108 | All Organisms → cellular organisms → Bacteria | 2820 | Open in IMG/M |
3300004114|Ga0062593_100051867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2565 | Open in IMG/M |
3300004156|Ga0062589_101973457 | Not Available | 591 | Open in IMG/M |
3300004463|Ga0063356_103618310 | Not Available | 666 | Open in IMG/M |
3300004480|Ga0062592_102595854 | Not Available | 511 | Open in IMG/M |
3300004643|Ga0062591_100109436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1813 | Open in IMG/M |
3300005045|Ga0071328_134542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6395 | Open in IMG/M |
3300005045|Ga0071328_136203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3902 | Open in IMG/M |
3300005172|Ga0066683_10128382 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300005467|Ga0070706_101791468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
3300005529|Ga0070741_10014360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13700 | Open in IMG/M |
3300005558|Ga0066698_11024528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300005713|Ga0066905_100284895 | Not Available | 1289 | Open in IMG/M |
3300005713|Ga0066905_100607109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 927 | Open in IMG/M |
3300005713|Ga0066905_100709422 | Not Available | 864 | Open in IMG/M |
3300005713|Ga0066905_100765854 | Not Available | 834 | Open in IMG/M |
3300005713|Ga0066905_102226996 | Not Available | 511 | Open in IMG/M |
3300006575|Ga0074053_10619174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 602 | Open in IMG/M |
3300006638|Ga0075522_10123694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1373 | Open in IMG/M |
3300007820|Ga0104324_110571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1203 | Open in IMG/M |
3300009012|Ga0066710_102001435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 859 | Open in IMG/M |
3300009090|Ga0099827_10118638 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
3300009789|Ga0126307_10000359 | All Organisms → cellular organisms → Bacteria | 29387 | Open in IMG/M |
3300009818|Ga0105072_1085268 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium F41-01 | 623 | Open in IMG/M |
3300009837|Ga0105058_1134317 | Not Available | 595 | Open in IMG/M |
3300009840|Ga0126313_10031146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 3658 | Open in IMG/M |
3300009840|Ga0126313_10309284 | Not Available | 1237 | Open in IMG/M |
3300010038|Ga0126315_10898278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
3300010047|Ga0126382_10040296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2650 | Open in IMG/M |
3300010166|Ga0126306_10069636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2483 | Open in IMG/M |
3300010166|Ga0126306_11635036 | Not Available | 537 | Open in IMG/M |
3300011003|Ga0138514_100000070 | All Organisms → cellular organisms → Bacteria | 8560 | Open in IMG/M |
3300011991|Ga0120153_1003492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5592 | Open in IMG/M |
3300012014|Ga0120159_1022253 | All Organisms → cellular organisms → Bacteria | 2317 | Open in IMG/M |
3300012014|Ga0120159_1066859 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 1086 | Open in IMG/M |
3300012199|Ga0137383_10100272 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 2103 | Open in IMG/M |
3300012199|Ga0137383_10310240 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300012199|Ga0137383_11089268 | Not Available | 579 | Open in IMG/M |
3300012201|Ga0137365_10008843 | All Organisms → cellular organisms → Bacteria | 8000 | Open in IMG/M |
3300012201|Ga0137365_10976299 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 615 | Open in IMG/M |
3300012204|Ga0137374_10004097 | All Organisms → cellular organisms → Bacteria | 17329 | Open in IMG/M |
3300012204|Ga0137374_10005313 | All Organisms → cellular organisms → Bacteria | 15316 | Open in IMG/M |
3300012204|Ga0137374_10006474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13942 | Open in IMG/M |
3300012204|Ga0137374_10022201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7163 | Open in IMG/M |
3300012204|Ga0137374_10033200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5602 | Open in IMG/M |
3300012204|Ga0137374_10039773 | All Organisms → cellular organisms → Bacteria | 4998 | Open in IMG/M |
3300012204|Ga0137374_10048189 | All Organisms → cellular organisms → Bacteria | 4423 | Open in IMG/M |
3300012204|Ga0137374_10074529 | All Organisms → cellular organisms → Bacteria | 3323 | Open in IMG/M |
3300012204|Ga0137374_10082403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 3108 | Open in IMG/M |
3300012204|Ga0137374_10214793 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 1643 | Open in IMG/M |
3300012204|Ga0137374_10319341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1266 | Open in IMG/M |
3300012204|Ga0137374_10344173 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300012204|Ga0137374_10377637 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 1134 | Open in IMG/M |
3300012204|Ga0137374_10444202 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300012204|Ga0137374_10844665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
3300012204|Ga0137374_10946699 | Not Available | 628 | Open in IMG/M |
3300012204|Ga0137374_10948213 | Not Available | 627 | Open in IMG/M |
3300012204|Ga0137374_10949955 | Not Available | 626 | Open in IMG/M |
3300012206|Ga0137380_10981039 | Not Available | 723 | Open in IMG/M |
3300012207|Ga0137381_10042939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3707 | Open in IMG/M |
3300012209|Ga0137379_10255547 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
3300012350|Ga0137372_10038963 | All Organisms → cellular organisms → Bacteria | 4301 | Open in IMG/M |
3300012350|Ga0137372_10146930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1929 | Open in IMG/M |
3300012350|Ga0137372_10285072 | Not Available | 1286 | Open in IMG/M |
3300012350|Ga0137372_10734590 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 712 | Open in IMG/M |
3300012350|Ga0137372_10756347 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300012350|Ga0137372_10892828 | Not Available | 631 | Open in IMG/M |
3300012353|Ga0137367_10001888 | All Organisms → cellular organisms → Bacteria | 16623 | Open in IMG/M |
3300012353|Ga0137367_10141403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1759 | Open in IMG/M |
3300012353|Ga0137367_10143159 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
3300012354|Ga0137366_10099481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2205 | Open in IMG/M |
3300012354|Ga0137366_11217227 | Not Available | 511 | Open in IMG/M |
3300012355|Ga0137369_10000882 | All Organisms → cellular organisms → Bacteria | 28794 | Open in IMG/M |
3300012355|Ga0137369_10110351 | All Organisms → cellular organisms → Bacteria | 2241 | Open in IMG/M |
3300012355|Ga0137369_10138949 | Not Available | 1942 | Open in IMG/M |
3300012355|Ga0137369_10386759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1012 | Open in IMG/M |
3300012355|Ga0137369_10574658 | Not Available | 787 | Open in IMG/M |
3300012355|Ga0137369_10913187 | Not Available | 589 | Open in IMG/M |
3300012355|Ga0137369_11097883 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300012356|Ga0137371_10049132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3262 | Open in IMG/M |
3300012356|Ga0137371_10593231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 851 | Open in IMG/M |
3300012357|Ga0137384_10156176 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 1909 | Open in IMG/M |
3300012358|Ga0137368_10245784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1240 | Open in IMG/M |
3300012358|Ga0137368_10337663 | Not Available | 1006 | Open in IMG/M |
3300012358|Ga0137368_10441857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 847 | Open in IMG/M |
3300012358|Ga0137368_10914264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
3300012360|Ga0137375_10103990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2883 | Open in IMG/M |
3300012360|Ga0137375_10176675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2053 | Open in IMG/M |
3300012360|Ga0137375_10499608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1036 | Open in IMG/M |
3300012360|Ga0137375_10639590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 879 | Open in IMG/M |
3300012360|Ga0137375_10981023 | Not Available | 666 | Open in IMG/M |
3300012532|Ga0137373_10315551 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300012532|Ga0137373_10426311 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300012532|Ga0137373_10869576 | Not Available | 663 | Open in IMG/M |
3300012532|Ga0137373_10973453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
3300012904|Ga0157282_10382749 | Not Available | 522 | Open in IMG/M |
3300012931|Ga0153915_10049924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4289 | Open in IMG/M |
3300012955|Ga0164298_10251497 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300012957|Ga0164303_11007693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
3300013772|Ga0120158_10495936 | Not Available | 539 | Open in IMG/M |
3300014301|Ga0075323_1129660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
3300015190|Ga0167651_1075663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 672 | Open in IMG/M |
3300015200|Ga0173480_10108961 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
3300015371|Ga0132258_12627894 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
3300016404|Ga0182037_10846122 | Not Available | 791 | Open in IMG/M |
3300017659|Ga0134083_10578687 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300018028|Ga0184608_10005212 | All Organisms → cellular organisms → Bacteria | 4185 | Open in IMG/M |
3300018031|Ga0184634_10009516 | All Organisms → cellular organisms → Bacteria | 3422 | Open in IMG/M |
3300018031|Ga0184634_10117031 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300018052|Ga0184638_1004050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4671 | Open in IMG/M |
3300018056|Ga0184623_10289839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
3300018063|Ga0184637_10437146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 772 | Open in IMG/M |
3300018077|Ga0184633_10104314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 1465 | Open in IMG/M |
3300019875|Ga0193701_1053277 | Not Available | 816 | Open in IMG/M |
3300025174|Ga0209324_10520641 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300025313|Ga0209431_10167324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1741 | Open in IMG/M |
3300025324|Ga0209640_11034941 | Not Available | 630 | Open in IMG/M |
3300025552|Ga0210142_1002358 | All Organisms → cellular organisms → Bacteria | 3579 | Open in IMG/M |
3300025862|Ga0209483_1082681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1436 | Open in IMG/M |
3300028715|Ga0307313_10013029 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
3300028721|Ga0307315_10252498 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 554 | Open in IMG/M |
3300028755|Ga0307316_10384741 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300028875|Ga0307289_10391598 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 572 | Open in IMG/M |
3300028880|Ga0307300_10121645 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300031226|Ga0307497_10044161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1530 | Open in IMG/M |
3300031564|Ga0318573_10425329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 714 | Open in IMG/M |
3300031576|Ga0247727_10077785 | All Organisms → cellular organisms → Bacteria | 3678 | Open in IMG/M |
3300031576|Ga0247727_10140394 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
3300031910|Ga0306923_11147587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 834 | Open in IMG/M |
3300032090|Ga0318518_10512385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
3300033233|Ga0334722_10025892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4917 | Open in IMG/M |
3300033290|Ga0318519_10880790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300033407|Ga0214472_10188117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2004 | Open in IMG/M |
3300033811|Ga0364924_123884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
3300034113|Ga0364937_023299 | Not Available | 1040 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 41.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.12% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.44% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.76% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.08% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.04% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.36% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.36% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.36% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.36% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.36% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.36% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.68% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.68% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.68% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.68% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.68% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.68% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005045 | Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300007820 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4NP_02317130 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | VHWMIGWNWAWMTFMMVFWIVALGAVIYAAVRIAHRPPRERNS |
ICChiseqgaiiDRAFT_07538182 | 3300000033 | Soil | VHAWTDGWGWFWMAFMMAFWVVLIGAVVYVAVRLAQRAPK* |
ICChiseqgaiiDRAFT_07551772 | 3300000033 | Soil | MHAWIDGWGWFWMAFMMAFWAVLIGAVVYVAARLAQRSPK* |
NODE_02804712 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MNGWDWVWMSVIMVFWIVVLGAVVYAAVRLGQGSPHRHH* |
F24TB_119129572 | 3300000550 | Soil | MMDGWDWVWMPFMMVFWLVVLGAVIYVAVRLANRPPR* |
JGI11615J12901_101067971 | 3300000953 | Soil | MHTWIDGWGLFWMAFMMAFWVVLIGAVVYIAVRLAQRSPK* |
JGI10216J12902_1030510352 | 3300000956 | Soil | MHTWIDGWDWLWMTLMMGFWLVILGAVIYIAVRLAHRPPTKPRADS* |
JGI10216J12902_1039965772 | 3300000956 | Soil | VHGWMDSWDWVWMSFMMVFWLVVLGAVVFAAVRLAQRPPRKDH* |
JGI10216J12902_1065955242 | 3300000956 | Soil | MIGWNWAWMTFMMVFWIVALGAVIYAAVRIAHRPPRERNS* |
JGI10216J12902_1156311632 | 3300000956 | Soil | MHWMDGWDWAWMTFMMVFWFALLGVAVYVAVRLATRPPTDRQQL* |
A2065W1_101117412 | 3300001537 | Permafrost | MHGWMDGTDWIWMTLMMSFWVVLLGAVVYVAVRLAQRPPTKPRADS* |
A10PFW1_105760576 | 3300001538 | Permafrost | MHAWVNGWDWVWMTFMMGFWVVLIGAVVYIAVRLAHRPPTKPRAGS* |
Ga0055455_100041082 | 3300003990 | Natural And Restored Wetlands | MYGHMTDWGWLWMSSMTAFWIVLVGAVVYIAVKLANRDTDHRRPT* |
Ga0062593_1000518672 | 3300004114 | Soil | MHTWIDGWGWFWMAFMMGLWVVLIGAVVYIAARLAQRSPK* |
Ga0062589_1019734571 | 3300004156 | Soil | MSMDGWDWLWMSFMSAFWLLLLGAVVYVAVRLATRPPHRSS* |
Ga0063356_1036183102 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MHVWIDSWGWFGMPLMMGVWVVLIGAVVYSAVRLAQRPPK* |
Ga0062592_1025958542 | 3300004480 | Soil | VHAWIDGWDWFWMAFMMALWVALIGAVVYIAVRLAQRSPQ* |
Ga0062591_1001094363 | 3300004643 | Soil | MHGWMDGSDWLWMTMMMGLWLVLLGAVVYITVRLVTVRLAQRPPTKPRSEYPPDTP* |
Ga0071328_1345424 | 3300005045 | Permafrost | VYWMDGWDWFWMNFMMVFWLVALGVVIYVAVKLATRPPREGSK* |
Ga0071328_1362036 | 3300005045 | Permafrost | MHWMDGWDWAWMTYMMIFWVVALGVAVYVAVKLATRRPTDRG* |
Ga0066683_101283824 | 3300005172 | Soil | MHAWVDGWDWVWMTFMMGFWVVLLGAVVYIAVRLAQRPPTKPRAGS* |
Ga0070706_1017914682 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDGWGWFWMTFMMVFWVVVLGAVIYVAVELANRRPTDPTSHS* |
Ga0070741_100143609 | 3300005529 | Surface Soil | VHGWMDGADWVWMSFVMVFWIVVLGAVVYAAVKLAQRPPHKRS* |
Ga0066698_110245282 | 3300005558 | Soil | MHGWMSGWDWLWMSFLMVFWIAVIGGVVYAAVRLA |
Ga0066905_1002848953 | 3300005713 | Tropical Forest Soil | MHGWIDAWDWLWMSLMMAFWFVVLGGVIFVAVRLAQRPPTKSNAR* |
Ga0066905_1006071092 | 3300005713 | Tropical Forest Soil | MHWMDGWDWLWMTLMMGFWLVVLCAVIFIAVRLAQRPPTKPRADS* |
Ga0066905_1007094222 | 3300005713 | Tropical Forest Soil | MHTWVNGWDWLWTTMMMGFWLVVLGAVIFIAVRLAQRPRA* |
Ga0066905_1007658541 | 3300005713 | Tropical Forest Soil | MYHWMSDWSWFWMTFMMVFWIVVLGAVIYVAVRLAQRPPDGKHS* |
Ga0066905_1022269961 | 3300005713 | Tropical Forest Soil | VHGWMDGWDWVWMSFMMVFWIAFLGAVVYAAVGLAQRPPHKGS* |
Ga0074053_106191741 | 3300006575 | Soil | WIWMSLMMAFWVVLIGAVVFIAVRLAQRPPTKPRADS* |
Ga0075522_101236942 | 3300006638 | Arctic Peat Soil | MNSGSDWVWMSFMMVLGVVVLGAVVYVAVRLAQRPLREHPS* |
Ga0104324_1105712 | 3300007820 | Soil | MHAWMDGWDWIWMPFMMGFWIVVLGAVVYIAVRLARQPPTKPRADS* |
Ga0066710_1020014354 | 3300009012 | Grasslands Soil | MYLWMNEWGCFWMTFMMVFWVVLLGAVIYVAVRLGQRPPGEKHS |
Ga0099827_101186384 | 3300009090 | Vadose Zone Soil | ADTQLTREEKGDAMHTWIDGWDWVWMTFMIVFWVVLLGAVVYIAVRLAQRPPTKPKAGS* |
Ga0126307_1000035934 | 3300009789 | Serpentine Soil | MMDGWDWAWMPFMMIFWLVVLGAVIYVAVRLANRPPR* |
Ga0105072_10852681 | 3300009818 | Groundwater Sand | MDGWGWIWMSFMMVFWAVVLGAVVYVAVRLAQRPTRQRQH* |
Ga0105058_11343171 | 3300009837 | Groundwater Sand | MYHWMDGWGWIWMSFMMVFWAVVLGAVVYVAVRLAQRPTRQRQH* |
Ga0126313_100311462 | 3300009840 | Serpentine Soil | MHTWVNGWDWLWMTLMMGFWLVVLGAVIYIAVRLAHRPPAQPRADS* |
Ga0126313_103092841 | 3300009840 | Serpentine Soil | MDGFDWLWMTLMMGSWLVVIAAVVLFAVRLATRQPRSGDP* |
Ga0126315_108982782 | 3300010038 | Serpentine Soil | MDGWDWLWMTFMMGFFFVAIGAVVYISVRLAQHVPRGRNT* |
Ga0126382_100402961 | 3300010047 | Tropical Forest Soil | MDGWDWVWMSFMMVFWIAFLGAVVYAAVGLAQRPPHKGS* |
Ga0126306_100696364 | 3300010166 | Serpentine Soil | MDGWDWLWMTFGMGFWIVLVGVVVYVAVRLATRWPRAGHP* |
Ga0126306_116350362 | 3300010166 | Serpentine Soil | MNGWDWVWMTFMMVFWVVLLGAVVYGAIRLAQRSPREGKS* |
Ga0138514_10000007011 | 3300011003 | Soil | MHGWMNGWDWFWMTFMMILWIAGLGAVVYAAVRLAQREPHQ* |
Ga0120153_10034921 | 3300011991 | Permafrost | MHNWMDGSDWIWMTLMMSFWVVLLGVAVYIAVRLAQRPPTKPRADS* |
Ga0120159_10222533 | 3300012014 | Permafrost | MHAWMDGWDWVWMTFMMGFWVILIGAVVYIAVRLAQQPPTKP* |
Ga0120159_10668593 | 3300012014 | Permafrost | DWVWMTFMMGFWVVLIGAVVYIAVRLAHRPPTKPRAGS* |
Ga0137383_101002722 | 3300012199 | Vadose Zone Soil | MHAWVDGWDWVWMTFIMGFWVVLLGAVVYIAVRLAQRPPTKPRAGS* |
Ga0137383_103102402 | 3300012199 | Vadose Zone Soil | MHTWIDGWDWLWMTLTMGFWLVVLGAVIYIAVRLAQRPPTRPRTDS* |
Ga0137383_110892682 | 3300012199 | Vadose Zone Soil | MVSWGWFWMTFMMLFWVVLIGAVIYVAARLGQRPPGEKHF* |
Ga0137365_100088438 | 3300012201 | Vadose Zone Soil | MHTWIDGWDWFWMTLMMGFWLVVLGAVIYIAVRLAQRPPTKPRAG* |
Ga0137365_109762991 | 3300012201 | Vadose Zone Soil | MSGKGVAMHTWIGGWDWLWMTLMMGFWLVVLGAVTYIAVRFAHRSPAQPTADS* |
Ga0137374_1000409721 | 3300012204 | Vadose Zone Soil | MHWMNGSDWAWMTFMIVFWVVLLGAVVYAAVRLAHRPPREGRS* |
Ga0137374_1000531310 | 3300012204 | Vadose Zone Soil | MTLMMGFWLVVLGAVIYLAVRLAQRPPTNPRAGS* |
Ga0137374_1000647415 | 3300012204 | Vadose Zone Soil | MHGWMNGWDWFWMSFMMAFWVVFLGAVVYVAVRLATRAPREKHL* |
Ga0137374_100222019 | 3300012204 | Vadose Zone Soil | MHAWINGWDWLWMTFMMGFWIVLLGAVVYFAVRFAQRPPTKPRAGS* |
Ga0137374_100332002 | 3300012204 | Vadose Zone Soil | MHTTWMNGWDWLWMTLMMGFWLVVLGAVIYIAVRLAHRSPAQPRADS* |
Ga0137374_100397737 | 3300012204 | Vadose Zone Soil | MYHWMNGWAWYWMSFVMAFWVVVLGVVVYVAVRLAQRPPDGTRS* |
Ga0137374_100481895 | 3300012204 | Vadose Zone Soil | MHTWMDGWDWFWMTLMMGSWLVVLGAVIYIAVRLAQRPPTKPRADSTK* |
Ga0137374_100745296 | 3300012204 | Vadose Zone Soil | MHWTDGLDWVWMTFMMGFWIIFLGAIVYIAVRLAQRPPTNPRAGS* |
Ga0137374_100824032 | 3300012204 | Vadose Zone Soil | MYGWMDGWGWLWMSFTMVFWVVLLGAVVYIAVRLAQRPPTAES* |
Ga0137374_102147932 | 3300012204 | Vadose Zone Soil | MHAWIDGWDWVWMTFMMGFGIILLGAVVYIAVRVAQRPPTKPRAG* |
Ga0137374_103193412 | 3300012204 | Vadose Zone Soil | MHGWMGGWEWFWMAFMMLFGIAFLGAVVYAAVRLAQGAPRERHQ* |
Ga0137374_103441732 | 3300012204 | Vadose Zone Soil | MNGWDWVWMTFMMVWVVLLGAVVYGAIRLAQRSPRERKT* |
Ga0137374_103776372 | 3300012204 | Vadose Zone Soil | MHTWIDGWDWLWMTLMMGFWLVVLGAVIYIAVRLAQRPPTKPRAES* |
Ga0137374_104442024 | 3300012204 | Vadose Zone Soil | VAHARLDGWDWFWMVFVMLFWIAILGAVVCAAVRLARRAPRERHQ* |
Ga0137374_108446652 | 3300012204 | Vadose Zone Soil | MDGWDWFWMSSMIVFWLVVLGAVIYVAVKFATRPPSGGRSP* |
Ga0137374_109466992 | 3300012204 | Vadose Zone Soil | MHGWMDGWDWFWMAFMMLFWIAVLGAVVYAAVRLAQRAPRERHQ* |
Ga0137374_109482132 | 3300012204 | Vadose Zone Soil | MHTTWMNGWDWLWMTLMMGFWLVVLGAVIYIAVRLAHRSPAQPRAES* |
Ga0137374_109499551 | 3300012204 | Vadose Zone Soil | MHGWITGWEWFWMSFMMVFWLVAIGAVVYVAVRLARRPPPEKQQ* |
Ga0137380_109810391 | 3300012206 | Vadose Zone Soil | MHAWVDGWDWVWMTFMMVFWVVLLGAVVYIAVRLAQRPAT |
Ga0137381_100429392 | 3300012207 | Vadose Zone Soil | MYHWMDGWAWFWMTFTMVFWLVVLAAVVYVAVRLAQRPPRERRS* |
Ga0137379_102555472 | 3300012209 | Vadose Zone Soil | MHTWMDGWDWLWMTLTMGFWLVFLGAVIYIAVRLAQRPPTRPRTDS* |
Ga0137372_100389636 | 3300012350 | Vadose Zone Soil | MHAWIDGWDWFWMTLMMGFWLVVLGAVIYIAVRLAQRPPTKPRAES* |
Ga0137372_101469305 | 3300012350 | Vadose Zone Soil | FWMAFMMLFWIAVLGAVVYAAVRFAQRAPRERHE* |
Ga0137372_102850722 | 3300012350 | Vadose Zone Soil | MHTTWMNGRDWLWMTLMMGFWLVVLGALIYIAVRLAYRSPAQPRADS* |
Ga0137372_107345902 | 3300012350 | Vadose Zone Soil | MHTWVNGWDWLWMTLMMGFWLVVLGAVIFAAVRLAQRPPTKPRADS* |
Ga0137372_107563471 | 3300012350 | Vadose Zone Soil | GVSMHVWMNGWDWVWMTFLMVFWVFVLGAVVYIAVRLAQRRPPHEGKP* |
Ga0137372_108928281 | 3300012350 | Vadose Zone Soil | MHSWMNGWDWLWMTLMMGFWLVVLGAVIYIAVRLAHRPPTEPRAGS* |
Ga0137367_1000188821 | 3300012353 | Vadose Zone Soil | MNGSDWAWMTFMIVFWVVLLGAVVYAAVRLAHRPPREGRS* |
Ga0137367_101414031 | 3300012353 | Vadose Zone Soil | GWGWFWMTFMTVFWIAVLGVVVYVAVRLAQRPPHEG* |
Ga0137367_101431592 | 3300012353 | Vadose Zone Soil | MGGWDWFWMAFMMLFWIAVLGAVVYAAVRLAQRAPRERHQ* |
Ga0137366_100994811 | 3300012354 | Vadose Zone Soil | GWDWLWMTLMMGFWLVVLGAVVYIAVRLAHRSPAQPRADS* |
Ga0137366_112172272 | 3300012354 | Vadose Zone Soil | MYAWMSGWDWFWMTLMMGFWLVVVGAVIYLAVRLAHRPPTRPRADS* |
Ga0137369_1000088232 | 3300012355 | Vadose Zone Soil | MHTWMDGWDWFWMTLMMGFWLVVLGAVIYIAVRLAQRPPTKPRADSTK* |
Ga0137369_101103511 | 3300012355 | Vadose Zone Soil | QRQEKGEAMHTWIDGWDWLWMTLMMGFWLVVLGAVIYIAVRLAQRPPTKPRAES* |
Ga0137369_101389495 | 3300012355 | Vadose Zone Soil | MNGWDWVWMTFMMVFWVVLLGAVVYGAIRLAQRSPRERKT* |
Ga0137369_103867591 | 3300012355 | Vadose Zone Soil | TWIDGWDWFWMTLMMGFWLVVLGAVIYIAVRLAQRPPTKPRAG* |
Ga0137369_105746581 | 3300012355 | Vadose Zone Soil | MDGWDWVWMSFMLVFWIVLLGAVVYVAVRLAQRPPHSRS* |
Ga0137369_109131872 | 3300012355 | Vadose Zone Soil | MGGWDWFWMVFMMLFWIAVLGAVVYAAVRLAQRAPRER |
Ga0137369_110978832 | 3300012355 | Vadose Zone Soil | MHVWMNNWGWFWMTFMMIFWIALLGAVVFVAVRLAQRPPREGKQ* |
Ga0137371_100491324 | 3300012356 | Vadose Zone Soil | MHAWVDGWDWVWMTFIMGFWVVLLGAVVYIAVRRAQRPPTKPRAGS* |
Ga0137371_105932311 | 3300012356 | Vadose Zone Soil | MHIWMDGWDWLWMTLTMGFWLVFLGAVIYIAVRLAQR |
Ga0137384_101561765 | 3300012357 | Vadose Zone Soil | MHAWVDGWDWVWMTFMMGFWVVLLGAVVYIAVRLTQRPPTKPRAGS* |
Ga0137368_102457844 | 3300012358 | Vadose Zone Soil | MHGWTDGWGWFWMSFMMVFWVVVLGAVVYIAVRLAQRPRREGKS* |
Ga0137368_103376631 | 3300012358 | Vadose Zone Soil | MYGWMDGWGWLWMSFMMVFWIALLGTVVYIAVRLAQRPPAGKL* |
Ga0137368_104418571 | 3300012358 | Vadose Zone Soil | MHGWMGGWEWFSMAFMMLFGIAFLGAVVYAAVRLAQGAPRDRHQ* |
Ga0137368_109142642 | 3300012358 | Vadose Zone Soil | MHTWVDGWDWLWMTLMMGFWLVVLGAVIYIAVRLAH |
Ga0137375_101039903 | 3300012360 | Vadose Zone Soil | MHAWINGWDWLWMTLMMGFWIVLLGAVVYFAVRFAQRPPTKPRAGS* |
Ga0137375_101766752 | 3300012360 | Vadose Zone Soil | VLFGWMDGWGWLWMSFTMVFWVVLLGAVVCIAVRLAQRPPTGKS* |
Ga0137375_104996081 | 3300012360 | Vadose Zone Soil | MDGWDWFWMSSMMVFWLVVLGAVIYVAVRLANRSPTNPKTRL* |
Ga0137375_106395904 | 3300012360 | Vadose Zone Soil | MHTWVDGWDWVWMTLMMGFWLVVLGVVVFMAVRLAQRPPTKPRADS* |
Ga0137375_109810232 | 3300012360 | Vadose Zone Soil | MHTTWMNGWDWLWMTLMMGFWLVVLGAVIYIGVRLAHRSPAQPRADS* |
Ga0137373_103155511 | 3300012532 | Vadose Zone Soil | KGGAMHTTWMNGWDWLWMTLMMGFWLVVLGAVIYIAVRLAHRSPAQPRAES* |
Ga0137373_104263112 | 3300012532 | Vadose Zone Soil | MHGWMGGWEWFSMAFMMLFGIAFLGAVVYAAVRLAQGAPRERHQ* |
Ga0137373_108695762 | 3300012532 | Vadose Zone Soil | MHTTWMNGWDWLWMTLMMGFWLVVLGAVIYIAVRLAHRPPTEPRADS* |
Ga0137373_109734531 | 3300012532 | Vadose Zone Soil | MHAWVDGSDWIWMTLMMGFWVVLVGAVVYIAVRLAQRPPSKPSAGS* |
Ga0157282_103827491 | 3300012904 | Soil | MHTWIDGWGWFWMAFMMGLWVVLIGAVVYIAAWLAQRSPK* |
Ga0153915_100499245 | 3300012931 | Freshwater Wetlands | MRTWMDGWDWAWMTVMMVTWVVVVAAPVYVAVRLANRPPGDRGRS* |
Ga0164298_102514973 | 3300012955 | Soil | MDGSDWVWMTMMMGFWLVLLGAVVYIAVRLAQRPPTKSSSDS* |
Ga0164303_110076931 | 3300012957 | Soil | MDGSDWLWMTMMMGLWLVLLGAVVYITVRLVTVRLAQRPPTKPRSEYPPDTP* |
Ga0120158_104959361 | 3300013772 | Permafrost | MHVWMDGWDWVWMSFMMVVWIAVLGAAIYLVVRLAQRPPSDHKP* |
Ga0075323_11296601 | 3300014301 | Natural And Restored Wetlands | MWTDGWDWLWMSFMMVFWIVVLGAVVYVAVRLAHRPPDHRS* |
Ga0167651_10756631 | 3300015190 | Glacier Forefield Soil | MNNWGWFWMTFMVVFWVVLLGAVVFIAVRLAQRPPREGKS* |
Ga0173480_101089613 | 3300015200 | Soil | MHTWIDGWGWFWMTFMMALWVVLIGAVVYIAVRLAQRSPK* |
Ga0132258_126278943 | 3300015371 | Arabidopsis Rhizosphere | MDGWDWVWMSFMMVFWIAALGAVVYFVIRLTQRPPTDRTS* |
Ga0182037_108461222 | 3300016404 | Soil | VYGWMDSWDWIWMTFMMGFWVVLLGIVVFVAVRLGQRPP |
Ga0134083_105786872 | 3300017659 | Grasslands Soil | MHGWMSGWDWLWMSFLMVFWIAVIGGVVYAAVRLATRPPAPRSR |
Ga0184608_100052123 | 3300018028 | Groundwater Sediment | VHGWMDGWDWAWMTFMMAFWLVILGAVVYAAVRLAQRPPRKDH |
Ga0184634_100095161 | 3300018031 | Groundwater Sediment | VHWIDSWDWFWMNFMMVFWLVALGVVIYVAVKLANRPPSEGSKR |
Ga0184634_101170312 | 3300018031 | Groundwater Sediment | VHWIDSWDWFWMNFMMVFWLVALGVVIYVAVKLATRPPREGSK |
Ga0184638_10040503 | 3300018052 | Groundwater Sediment | MAGWGWFWMSFMMVFWAVVLGAVVYVAVRLAQRPTRQRHQ |
Ga0184623_102898391 | 3300018056 | Groundwater Sediment | MYWIDGWGWFWMNFMMVFWLVALGVVIYVAVKLATRPPREGSK |
Ga0184637_104371461 | 3300018063 | Groundwater Sediment | MYWMDGWDWFWMNFMMVFWLVALGVVIYVAVKLANRPPSEGSKR |
Ga0184633_101043144 | 3300018077 | Groundwater Sediment | VHWIDSWDWFWMNFMMVFWLVALGVVIYVAVKLASRPPREGSKR |
Ga0193701_10532771 | 3300019875 | Soil | GWDWAWMTFMMAFWLVILGAVVYAAVRLAQRPPRKDH |
Ga0209324_105206413 | 3300025174 | Soil | MHVWMNGWDWVWMTFTMLFWVVALGVAVYVAIRLANRPPTDRR |
Ga0209431_101673243 | 3300025313 | Soil | VYHWMSGWDWLWMSFTMFAWAVVVGAVVYVAVRLASRPPDGPKAGP |
Ga0209640_110349412 | 3300025324 | Soil | MHLLADGHVWADGWDWLWMTLMMGFWVIVLGIVVYVAVRLATRPPTEPKSHS |
Ga0210142_10023585 | 3300025552 | Natural And Restored Wetlands | MYGHMTDWGWLWMSSMTAFWIVLVGAVVYIAVKLANRDTDHRRPT |
Ga0209483_10826812 | 3300025862 | Arctic Peat Soil | MNSGSDWVWMSFMMVLGVVVLGAVVYVAVRLAQRPLREHPS |
Ga0307313_100130293 | 3300028715 | Soil | MDGWDWAWMTFMMAFWLVILGAVVYAAVRLAQRPPRKDH |
Ga0307315_102524981 | 3300028721 | Soil | DVHGWMDGWDWAWMTFMMAFWLVILGAVVYAAVRLAQRPPRKDH |
Ga0307316_103847412 | 3300028755 | Soil | WDWAWMTFMMAFWLVILGDVVYAAVRLAQRPPRKDH |
Ga0307289_103915981 | 3300028875 | Soil | WWKHARRRADVHGWMDGWDWAWMTFMMAFWLVILGAVVYAAVRLAQRPPRKDH |
Ga0307300_101216451 | 3300028880 | Soil | HGWMDGWDWAWMTFMMAFWLVILGAVVYAAVRLAQRPPRKDH |
Ga0307497_100441611 | 3300031226 | Soil | MHAWMDGGDWIWMSLMMAFWVVLIGAVVFIAVRLAQRPTTKPRADS |
Ga0318573_104253291 | 3300031564 | Soil | MDSWDWIWMTFMMGFWVVLLGIVVFVAVRLGQRPPGGKPS |
Ga0247727_100777852 | 3300031576 | Biofilm | MHVWTNGWDWVWMTFMMLFWVVALGVAVYVAVKLANRPPTDRR |
Ga0247727_101403941 | 3300031576 | Biofilm | MWMNGWDWVWMTFTMLFWAVALGVAVYVAVKLANRPPTDRR |
Ga0306923_111475871 | 3300031910 | Soil | MDGWDWLWMTLMMGFWLVLLAAVIFIAVRLAQRPSSKPRAVS |
Ga0318518_105123853 | 3300032090 | Soil | KKGGAVHWMDGWDWLWMTLMMGFWLVLLAAVIFIAVRLAQRPSSKPRAVS |
Ga0334722_100258923 | 3300033233 | Sediment | LGWFWMTFMTVFWVVVLGAVIYVAVRLGQRPPRGKHS |
Ga0318519_108807901 | 3300033290 | Soil | MDGWGWLRMTFMMVFWIAVLGAVVYAAVRLAQRPPGGRRS |
Ga0214472_101881173 | 3300033407 | Soil | MYWMDGWDWFWMNFTMVFWLVALGVVIYVAVKLATRPPREGSK |
Ga0364924_123884_19_141 | 3300033811 | Sediment | MDGWDWFWMNFMMVFWLVALGVVIFVAVKLATRPPREGSK |
Ga0364937_023299_581_709 | 3300034113 | Sediment | MHWMDGWDWAWMTFMMAFWLALLGVAVYVAVKLANRPPADRR |
⦗Top⦘ |