NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F048958

Metagenome / Metatranscriptome Family F048958

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048958
Family Type Metagenome / Metatranscriptome
Number of Sequences 147
Average Sequence Length 47 residues
Representative Sequence MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIIT
Number of Associated Samples 103
Number of Associated Scaffolds 147

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 72.60 %
% of genes near scaffold ends (potentially truncated) 97.96 %
% of genes from short scaffolds (< 2000 bps) 88.44 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (75.510 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(21.088 % of family members)
Environment Ontology (ENVO) Unclassified
(57.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(54.422 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.06%    β-sheet: 0.00%    Coil/Unstructured: 56.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 147 Family Scaffolds
PF03406Phage_fiber_2 5.44
PF05065Phage_capsid 0.68
PF13385Laminin_G_3 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 147 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.55 %
UnclassifiedrootN/A22.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002835|B570J40625_100824120Not Available812Open in IMG/M
3300003393|JGI25909J50240_1088416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage618Open in IMG/M
3300003431|JGI25913J50563_1032090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage820Open in IMG/M
3300003431|JGI25913J50563_1075940All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage510Open in IMG/M
3300004125|Ga0066182_10060917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage861Open in IMG/M
3300004448|Ga0065861_1016904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1687Open in IMG/M
3300004804|Ga0007796_10202216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300005527|Ga0068876_10411865Not Available752Open in IMG/M
3300005527|Ga0068876_10625049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300005581|Ga0049081_10301560All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage552Open in IMG/M
3300006637|Ga0075461_10216819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300006639|Ga0079301_1097740Not Available902Open in IMG/M
3300006805|Ga0075464_10180504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1249Open in IMG/M
3300006805|Ga0075464_10438768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage796Open in IMG/M
3300006805|Ga0075464_10497046All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage746Open in IMG/M
3300006805|Ga0075464_10868358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300006805|Ga0075464_10869392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300006805|Ga0075464_11016186All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300006917|Ga0075472_10510597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300006920|Ga0070748_1186011All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300007538|Ga0099851_1113712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1025Open in IMG/M
3300007538|Ga0099851_1349555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300007708|Ga0102859_1084956All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage903Open in IMG/M
3300007973|Ga0105746_1181674All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage716Open in IMG/M
3300008119|Ga0114354_1025401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2651Open in IMG/M
3300008266|Ga0114363_1014205All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6335Open in IMG/M
3300008266|Ga0114363_1075873Not Available1265Open in IMG/M
3300008266|Ga0114363_1228384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300008448|Ga0114876_1189284All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage707Open in IMG/M
3300008448|Ga0114876_1210305All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage646Open in IMG/M
3300008450|Ga0114880_1118868Not Available995Open in IMG/M
3300008450|Ga0114880_1220449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage618Open in IMG/M
3300008450|Ga0114880_1273685All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage510Open in IMG/M
3300009149|Ga0114918_10320254Not Available862Open in IMG/M
3300009152|Ga0114980_10172555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1278Open in IMG/M
3300009160|Ga0114981_10193604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1116Open in IMG/M
3300009164|Ga0114975_10340582Not Available825Open in IMG/M
3300009165|Ga0105102_10556684All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage629Open in IMG/M
3300009169|Ga0105097_10090318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1671Open in IMG/M
3300009184|Ga0114976_10420828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage697Open in IMG/M
3300009194|Ga0114983_1094706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage662Open in IMG/M
3300009864|Ga0132193_100648Not Available1571Open in IMG/M
3300010158|Ga0114960_10381889All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage691Open in IMG/M
3300010334|Ga0136644_10195290All Organisms → Viruses → Predicted Viral1210Open in IMG/M
3300010885|Ga0133913_11159683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1985Open in IMG/M
3300010885|Ga0133913_12073900All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1409Open in IMG/M
3300010885|Ga0133913_12203138All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1358Open in IMG/M
3300010970|Ga0137575_10085432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
3300011010|Ga0139557_1069771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300012012|Ga0153799_1033642Not Available977Open in IMG/M
3300012017|Ga0153801_1031493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage938Open in IMG/M
3300012017|Ga0153801_1046901Not Available762Open in IMG/M
3300012715|Ga0157599_1241427Not Available1138Open in IMG/M
3300012733|Ga0157606_1150325Not Available1479Open in IMG/M
3300013004|Ga0164293_10166936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1620Open in IMG/M
3300013006|Ga0164294_10747789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300013372|Ga0177922_11338860Not Available794Open in IMG/M
3300014711|Ga0134314_110112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300014811|Ga0119960_1053675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage674Open in IMG/M
3300014811|Ga0119960_1059454All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300015050|Ga0181338_1032755Not Available787Open in IMG/M
3300015050|Ga0181338_1059793All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300017716|Ga0181350_1081313All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
3300017716|Ga0181350_1092058All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage755Open in IMG/M
3300017736|Ga0181365_1020670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1658Open in IMG/M
3300017754|Ga0181344_1149317All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300017766|Ga0181343_1044221Not Available1321Open in IMG/M
3300017766|Ga0181343_1225543All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300017780|Ga0181346_1226798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage662Open in IMG/M
3300017784|Ga0181348_1011003All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3919Open in IMG/M
3300017784|Ga0181348_1212409All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage687Open in IMG/M
3300017784|Ga0181348_1262226All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300017785|Ga0181355_1216254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage747Open in IMG/M
3300017785|Ga0181355_1296182All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300017785|Ga0181355_1389429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300019784|Ga0181359_1128556All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage896Open in IMG/M
3300021438|Ga0213920_1072784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300021956|Ga0213922_1116585Not Available529Open in IMG/M
3300022072|Ga0196889_1074608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage637Open in IMG/M
3300022190|Ga0181354_1231290Not Available536Open in IMG/M
3300022407|Ga0181351_1193068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300022407|Ga0181351_1243961All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage565Open in IMG/M
3300023174|Ga0214921_10074150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2748Open in IMG/M
3300024346|Ga0244775_11213730All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage587Open in IMG/M
3300024355|Ga0255157_1038113Not Available802Open in IMG/M
3300024513|Ga0255144_1074272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300025076|Ga0209316_105643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1289Open in IMG/M
3300025645|Ga0208643_1179613All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300025896|Ga0208916_10255211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300025896|Ga0208916_10553544All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes501Open in IMG/M
3300027693|Ga0209704_1239404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300027697|Ga0209033_1060390All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1332Open in IMG/M
3300027710|Ga0209599_10101087All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage759Open in IMG/M
3300027741|Ga0209085_1155900All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage960Open in IMG/M
3300027763|Ga0209088_10011126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4851Open in IMG/M
3300027763|Ga0209088_10044146All Organisms → cellular organisms → Bacteria2189Open in IMG/M
3300027777|Ga0209829_10052116All Organisms → Viruses → Predicted Viral2160Open in IMG/M
3300027785|Ga0209246_10177289Not Available836Open in IMG/M
3300027806|Ga0209985_10059476All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2088Open in IMG/M
3300027808|Ga0209354_10013098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3311Open in IMG/M
3300027808|Ga0209354_10174152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage876Open in IMG/M
3300027816|Ga0209990_10011875All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5301Open in IMG/M
(restricted) 3300027970|Ga0247837_1240070All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage720Open in IMG/M
(restricted) 3300028114|Ga0247835_1184446All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage724Open in IMG/M
(restricted) 3300028559|Ga0247831_1044259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2419Open in IMG/M
(restricted) 3300029268|Ga0247842_10565770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300031758|Ga0315907_10187053All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1741Open in IMG/M
3300031758|Ga0315907_10283995All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1363Open in IMG/M
3300031758|Ga0315907_10337806Not Available1228Open in IMG/M
3300031786|Ga0315908_10724526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage818Open in IMG/M
3300031787|Ga0315900_10554090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage855Open in IMG/M
3300031857|Ga0315909_10028720All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5434Open in IMG/M
3300031857|Ga0315909_10359036Not Available1061Open in IMG/M
3300031857|Ga0315909_10402594Not Available980Open in IMG/M
3300031857|Ga0315909_10418704Not Available953Open in IMG/M
3300031857|Ga0315909_10981329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300031951|Ga0315904_10810109Not Available769Open in IMG/M
3300032050|Ga0315906_10378268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1242Open in IMG/M
3300032050|Ga0315906_10978476All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300032092|Ga0315905_10019873All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6801Open in IMG/M
3300032092|Ga0315905_11569818All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300032093|Ga0315902_10209184Not Available1947Open in IMG/M
3300032093|Ga0315902_10418845Not Available1202Open in IMG/M
3300032093|Ga0315902_10506066Not Available1049Open in IMG/M
3300032093|Ga0315902_10644325Not Available877Open in IMG/M
3300032093|Ga0315902_11028588All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300032116|Ga0315903_10509253All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage948Open in IMG/M
3300033981|Ga0334982_0044575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2475Open in IMG/M
3300033993|Ga0334994_0287757Not Available841Open in IMG/M
3300033996|Ga0334979_0423377All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage732Open in IMG/M
3300034012|Ga0334986_0320398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage815Open in IMG/M
3300034012|Ga0334986_0412974All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage683Open in IMG/M
3300034062|Ga0334995_0397900Not Available863Open in IMG/M
3300034066|Ga0335019_0676450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M
3300034071|Ga0335028_0387680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage802Open in IMG/M
3300034092|Ga0335010_0440655All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage701Open in IMG/M
3300034101|Ga0335027_0453521Not Available816Open in IMG/M
3300034101|Ga0335027_0884532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300034104|Ga0335031_0408478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage851Open in IMG/M
3300034112|Ga0335066_0531967All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage618Open in IMG/M
3300034121|Ga0335058_0733593All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300034122|Ga0335060_0007353All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7343Open in IMG/M
3300034168|Ga0335061_0000778All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage16385Open in IMG/M
3300034168|Ga0335061_0445966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300034280|Ga0334997_0344226Not Available955Open in IMG/M
3300034284|Ga0335013_0658543All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake21.09%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater19.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater14.29%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.20%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake8.84%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.40%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.04%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface2.04%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic1.36%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.36%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater1.36%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.68%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.68%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water0.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.68%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.68%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.68%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.68%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.68%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.68%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.68%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003431Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004125Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2)EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0MEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300009864Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, surface; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010158Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaGEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300010970Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016EnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012715Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012733Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014711Surface water microbial communities from Bangladesh - BaraHaldiaSW0111EnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024355Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300024513Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300025076Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - 3C3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027777Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300029268 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19mEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034168Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J40625_10082412013300002835FreshwaterMARKKVIDLDTYNALDAYSIALHEYYKSLRKAGFSIEIALALMSDR
JGI25909J50240_108841613300003393Freshwater LakeMAKKKVIDLDTYNALDAWAISLHEMYRALIRAGFRSDIAMGLIV
JGI25913J50563_103209013300003431Freshwater LakeMAKKKVIDLDTYSQLDQYSICMHEFYKSLRRAGFAVDLCLAIIVE
JGI25913J50563_107594023300003431Freshwater LakeMAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFPVDLALAVIVEPMAYPRWILPEPVEVEKF
Ga0066182_1006091713300004125Freshwater LakeMAKKKVIDLDTYNALDAWAISLHEMYRALIRAGFRSDIAMGLIVDKDIYPDWILP
Ga0065861_101690413300004448MarineMAKKRVIDLDTYSALDVWAIGLQEMYRALRRAGFDVDLSLAIIVEPMAYPRWILARASRS
Ga0007796_1020221633300004804FreshwaterMARKKVIDLETYNALDAHCIALNEFYKGLRRAGFAVDVAIAIIVEPSAYPEWIIPKPDLIPHEWDDDEED*
Ga0068876_1041186513300005527Freshwater LakeMARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPT
Ga0068876_1062504943300005527Freshwater LakeMARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLA
Ga0049081_1030156013300005581Freshwater LenticMARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDIALGIITEPSAYPD
Ga0075461_1021681913300006637AqueousMAKKKVIDLDTYNALDAYAISMHEFYKALRKAGFAVDLC
Ga0079301_109774013300006639Deep SubsurfaceMARKKVIDLDTYSQLDAWAISLHEMYRALRKAGFA
Ga0075464_1018050463300006805AqueousMAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDMCLAI
Ga0075464_1043876813300006805AqueousMAKKKVIDLDTYNALDAWAIGLHEMYRALRRAGFGVDIALGIIMERHAYPD
Ga0075464_1049704613300006805AqueousMARKKAIDLDTYNELDVWAISVNEMYKALRRAGMSID
Ga0075464_1086835813300006805AqueousMARKKAIELDTYNELDAWAISLQEMYRALRRAGMSVDIAL
Ga0075464_1086939213300006805AqueousMARKKAIDLDTYNALDVWAISVNEMYKALRRAGMSI
Ga0075464_1101618633300006805AqueousMAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFGVDIALGIIMERDAYP
Ga0075472_1051059743300006917AqueousMAKKKVIDLDTYNALDVCAISLHEMYRVLIRDGFRSDIAMGIIMERDAYPDWILP
Ga0070748_118601143300006920AqueousMARKNVIDLDTYTALDAWAISLQEMYRALRRAGFEVDLALGIITEP
Ga0099851_111371213300007538AqueousMAKKKVIDLDTYNALDAYAISIHEFYKSLRRAGFAVDLCLAIIVERSAYPDWLLPS
Ga0099851_134955533300007538AqueousMAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFPVDLALAVIVEPMAYPRWILPEPVEA
Ga0102859_108495643300007708EstuarineMARKKVIDLDTYSALDAWAISLQEMYRALRRAGFEVDLALGILVEPSSFPDWILPKPDLIPHSWDDDDDED*
Ga0105746_118167413300007973Estuary WaterMAKKKVIDLDTYNALDAWAISLHEMYRALIRAGFRSDIAMGLIVDKEVYPDW
Ga0114354_102540113300008119Freshwater, PlanktonMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDMAL
Ga0114363_101420513300008266Freshwater, PlanktonMARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPTAYPAWILPSPVDPERFG
Ga0114363_107587313300008266Freshwater, PlanktonMAKKKVIDLDTYNALDQYAICMHEFYKSLRRAGFAVDLCLGI
Ga0114363_122838413300008266Freshwater, PlanktonMARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPTAYPAWILP
Ga0114876_118928413300008448Freshwater LakeMARKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDICL
Ga0114876_121030513300008448Freshwater LakeMAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDICL
Ga0114880_111886843300008450Freshwater LakeMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFPVDMCLAIITDRDAYPDW
Ga0114880_122044943300008450Freshwater LakeMARKKVIDLDTYNALDAYSIGLHEYYKSLRRAGFSIDICLALISDRESYP
Ga0114880_127368513300008450Freshwater LakeMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCL
Ga0114918_1032025443300009149Deep SubsurfaceMAKKKVIDLDTYNQLDAWAISLHEMYRALRRAGFAVDISLALIADK
Ga0114980_1017255553300009152Freshwater LakeMARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDIALG
Ga0114981_1019360413300009160Freshwater LakeMARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDIALGIITEPSAYPDWILPKPDLIPHTYDED
Ga0114975_1034058243300009164Freshwater LakeMAKKKVIDLDTYSALDAYAISMNEFYKALRRAGFAVDLCLAIITD
Ga0105102_1055668443300009165Freshwater SedimentMAKKKVIDLDTYNALDQYAISMHEFYKSLRRAGFAVDLCLAIIT
Ga0105097_1009031863300009169Freshwater SedimentMARKKVIDLDTYTALDAWAISLQEMYRALRKSGFEVDLALAII
Ga0114976_1042082813300009184Freshwater LakeMAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIITDRDS
Ga0114983_109470613300009194Deep SubsurfaceMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLSIIQDRDAYPDWI
Ga0132193_10064813300009864Meromictic PondMAKKKVIDLDTYSALDAYAISMHEFYKALRRAGFAVDLCLAIITDRDAYPD
Ga0114960_1038188913300010158Freshwater LakeMAKKRVIDLDTYNALDSWAITLNEMYKALRRSGFAVDIALAI
Ga0136644_1019529013300010334Freshwater LakeMAKKKVIDLDTYNALDSWAITLNEMYKALRRSGFAIDIALA
Ga0133913_1115968373300010885Freshwater LakeMAKKKVIDLDTYSALDAYAISMNEFYKALRRAGFAVDLCLAIITDRDAYPDW
Ga0133913_1207390053300010885Freshwater LakeMAKKRVIDLDTYNALDSWAITLNEMYKALRRSGFAVDIALAIIVDRDAYP
Ga0133913_1220313853300010885Freshwater LakeMARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDIALGIITEPSAYPDWILPKPDLIPHTY
Ga0137575_1008543213300010970Pond Fresh WaterMARKKVIDLDTYNALDAWAISLQEMYKALRRAGFDVETCLAIII
Ga0139557_106977113300011010FreshwaterMAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFPVDLALAVIVEPMAYPRWILPEPAEVEKFGD
Ga0153799_103364213300012012FreshwaterMAKKKVIDLDTYSALNAYAISMNEFYKALRRAGFA
Ga0153801_103149313300012017FreshwaterMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFP
Ga0153801_104690113300012017FreshwaterMARKATNKLVDEGYSKLDAWAIGVHEMYRALRRAG
Ga0157599_124142713300012715FreshwaterMARKKVIDLDTYSALDAWAISLQEMYKALRRSGFDVDICLAIIV
Ga0157606_115032513300012733FreshwaterMARKKVIDLDTYSALDAWAISLQEMYKALRRSGFDVDICLAIIVEPSAYPD
Ga0164293_1016693663300013004FreshwaterMAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLSIIQDR
Ga0164294_1074778933300013006FreshwaterMAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDISLAI
Ga0177922_1133886013300013372FreshwaterMARKKVIDLDTYSQLDAWAISLHEMYRALRKAGFAVDLCLAIITDRDSYPDWILPT
Ga0134314_11011213300014711Surface WaterMARKKAIDLETYNELDAWAISLQEMYRALRRAGMSVDIALAIIVEP
Ga0119960_105367513300014811AquaticMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIKQIVTGK
Ga0119960_105945413300014811AquaticMARKKVIDLDTYNALDAWAISLHEMYRALRRAGFAVDVALSIIHADRDWE
Ga0181338_103275533300015050Freshwater LakeMARTKKVIDLDTYSALDAYAISMHEFYRALRRAGFAVDLCLGIITS
Ga0181338_105979313300015050Freshwater LakeMAKKKVIDLDTYSALDAYAISMHEFYRALRRAGFAVDLCLGIITERGAYPDWLLPA
Ga0181350_108131323300017716Freshwater LakeMAKKKVIDLDTYNALDAWAISLHEMYRALIRAGFRSDI
Ga0181350_109205813300017716Freshwater LakeMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFA
Ga0181365_102067053300017736Freshwater LakeMAKKKVIDLDTYNKLDQYAICMHEFYKSLRRAGFAVDLCLGIITERGAYPDWL
Ga0181344_114931723300017754Freshwater LakeMAKKKVIDLDTYNALDAWAISLHEMYSSLRRAGFGVDIA
Ga0181343_104422163300017766Freshwater LakeMAKKKVIDLDTYSRLDAWAISLHEMYRALRRAGFAVDLALSIIQDPDAYPDWILP
Ga0181343_122554313300017766Freshwater LakeMAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAV
Ga0181346_122679843300017780Freshwater LakeMARKKVIDLDTYSQLDAGAISLHEMYRALRRAGFAVDLC
Ga0181348_101100393300017784Freshwater LakeMAKKKVIDLDTYSALDAYAISMHEFYRALRRAGFAVD
Ga0181348_121240913300017784Freshwater LakeMARKKVIDLDTYSQLDQYAICMHEFYKSLRRAGFAVDLCLAIITDR
Ga0181348_126222633300017784Freshwater LakeMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDMCL
Ga0181355_121625413300017785Freshwater LakeMAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDISLALISDKDAYPDWILPSI
Ga0181355_129618243300017785Freshwater LakeMARKKVIDLDTYTALDAWAISLQEMYRALRRAGFEVDLALAVIVEP
Ga0181355_138942923300017785Freshwater LakeMAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFPVDLALAVIVEPMAYPRWILPEP
Ga0181359_112855633300019784Freshwater LakeMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDL
Ga0213920_107278413300021438FreshwaterMARKKVIDLDTYSALDAYAISMHEFYKALRRAGFAVDLCLAIITDRDAY
Ga0213922_111658513300021956FreshwaterMARKKAIDLETYNELDVWAISINEMYKALRRAGMSVDIALAI
Ga0196889_107460813300022072AqueousMARKKVIDLDTYSQLDAWAISLHEMYRALRKAGFAVDLCLA
Ga0181354_123129023300022190Freshwater LakeMARKKVIDLDTYNALDAWAIGINEMYKALRRAGVATDLCVAIIIEPSAYPD
Ga0181351_119306813300022407Freshwater LakeMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIITDREAYPGWT
Ga0181351_124396113300022407Freshwater LakeMAKKKVIDLDTYNELDAWAISLHEMYRALIRAGFRSDIAMGLIVD
Ga0214921_1007415083300023174FreshwaterMAKKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVELSLAIIVEPSA
Ga0244775_1121373013300024346EstuarineMARTKKVIDLDTYSALDAYAISIHEFYRALRRAGFA
Ga0255157_103811343300024355FreshwaterMAKKKVIDLDTYNALDAWAICLHEMWTALKKAGFTTDIALA
Ga0255144_107427243300024513FreshwaterMAKKKVIDLDTYNALDAWAICLHEMWTALKKAGFTTDIALALVMDKDAYPE
Ga0209316_10564363300025076FreshwaterMARKKVIDLDTYTALDAWAISLQEMYRALRRAGFEVDLALAVIVEPSAYPDWIIPKPDLIPHTYE
Ga0208643_117961313300025645AqueousMARKKVIDLDTYNALDQWAISLHEMYKALRRAGFATDICMGII
Ga0208916_1025521113300025896AqueousMAKKRVIDLDTYNALDSWAITLNEMYKALRRSGFAVD
Ga0208916_1055354433300025896AqueousMARKKVIDLDTYTALDAWAISLQEMYRALRRAGFDVELSLAIIVEPMAY
Ga0209704_123940413300027693Freshwater SedimentMARKKVIDLDTYTALDAWAISLQEMYRALRKSGFEVDLALAIIVEPSAYPDWILPKPDLIPHT
Ga0209033_106039013300027697Freshwater LakeMAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFGVDIALGII
Ga0209599_1010108743300027710Deep SubsurfaceMARKKVIDLDTYTALDAWAISLQEMYRALRRAGFEVDLALG
Ga0209085_115590013300027741Freshwater LakeMAKKKVIDLDTYNALDSWAITLNEMYKALRRSGFAIDIALAIIVDRDAYPDWIL
Ga0209088_1001112613300027763Freshwater LakeMARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDIALGIITEPSAYPDWILPKPD
Ga0209088_1004414613300027763Freshwater LakeMAKKKVIDLDTYSALDAYAISMNEFYKALRRAGFAVDLCLAII
Ga0209829_1005211613300027777Freshwater LakeMAKKKVIDLDTYNALDSWAITLNEMYKALRRSGFA
Ga0209246_1017728923300027785Freshwater LakeMAKKKVIDLDTYSALDAYAISMHEFYRALRRAGFAVDLCLGIITERSAYPDWLLP
Ga0209985_1005947613300027806Freshwater LakeMARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPTA
Ga0209354_1001309873300027808Freshwater LakeMAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFPV
Ga0209354_1017415213300027808Freshwater LakeMAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFDV
Ga0209990_1001187513300027816Freshwater LakeMARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPTAYPAWILPSPV
(restricted) Ga0247837_124007023300027970FreshwaterMARKKVIDLDTYSQLDQWAISLHEMYRALRRAGFAVDLCLA
(restricted) Ga0247835_118444623300028114FreshwaterMARKKVIDLDTYNALDAYAISMHEFYKSLRRAGFAVD
(restricted) Ga0247831_104425973300028559FreshwaterMARKKVIDLDTYSQLDQWAISLHEMYRALRRAGFAVDLCLAIISDRDAYPDWILPSI
(restricted) Ga0247842_1056577043300029268FreshwaterMARKKVIDLDTYNALDAYAISMHEFYKSLRRAGFAVDLCLAIIT
Ga0315907_1018705313300031758FreshwaterMARKKVIDLDTYNALDAYAISMHEFYKALRRAGFAVDLCLAIIT
Ga0315907_1028399563300031758FreshwaterMARKKVIDLDTYSRLDAWAISLHEMYRALRRAGFAVDIALS
Ga0315907_1033780653300031758FreshwaterMARKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDLCLSIIQDRDAYPDW
Ga0315908_1072452613300031786FreshwaterMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDMALAI
Ga0315900_1055409043300031787FreshwaterMAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDISLALISDKDAYPDWIL
Ga0315909_1002872093300031857FreshwaterMARKKVIDLDTYSALDAYAISMHEFYRALRRAGFAV
Ga0315909_1035903653300031857FreshwaterMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDMALAIIT
Ga0315909_1040259413300031857FreshwaterMAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDISLALISDKDAYPDWILP
Ga0315909_1041870413300031857FreshwaterMAKKKVIDLDTYNALDAYAISMHEFYKSLRRAGFAVDLCLAIIVERSAY
Ga0315909_1098132923300031857FreshwaterMARKKVIDLDTYNALDTWAIGLQEMYRALRRAGFDVELSLAIIIEPGA
Ga0315904_1081010913300031951FreshwaterMARKKVIDLDTYSQLDAWAIGLHEMYRALRRAGFAVDM
Ga0315906_1037826813300032050FreshwaterMARKKVIDLDTYSQLDQYAICMHEFYKSLRRAGFA
Ga0315906_1097847613300032050FreshwaterMARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPTAYPAWILPSPVDPERFGD
Ga0315905_1001987313300032092FreshwaterMARKKVIDLDTYNALDTWAIGLQEMYRALRRAGFDVELSLAII
Ga0315905_1156981823300032092FreshwaterMARKKVIDLDTYNALDTWAIGLQEMYRALRRAGFDVELSLAIIIEPA
Ga0315902_1020918473300032093FreshwaterMARKKVIDLDTYSQLDAWAIGLHEMYRALRRAGFAVDIALSIIQDRDAYPE
Ga0315902_1041884513300032093FreshwaterMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVD
Ga0315902_1050606613300032093FreshwaterMAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDL
Ga0315902_1064432513300032093FreshwaterMARKKVIDLDTYSALDAYAISMHEFYRALRRAGFAVDLCLG
Ga0315902_1102858813300032093FreshwaterMAKKKVIDLDTYNALDAYAISMHEFYKSLRRAGFAVDLCLAIITDR
Ga0315903_1050925343300032116FreshwaterMARKKVIDLDTYTQLDAWAISLHEMYRALRRAGFAVDMCLAIITD
Ga0334982_0044575_3_1703300033981FreshwaterMAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAIDICLAIISDRDAYPDWILPS
Ga0334994_0287757_2_1723300033993FreshwaterMARKKVIDLDTYNALDAYSIALHEYYKSLRKAGFSIEIALALMSDRDTYPEWILPKL
Ga0334979_0423377_1_1383300033996FreshwaterMARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVELSLAIIVEP
Ga0334986_0320398_659_8143300034012FreshwaterMARKKVIDLDTYTALDAWAISLQEMYRALRRAGFEVDLALAVIVEPSAYPDW
Ga0334986_0412974_531_6833300034012FreshwaterMAKKRVIDLDTYNALDAWAIALHEMYRALRRAGFAVDLCLAIISDRDAYPD
Ga0334995_0397900_3_1403300034062FreshwaterMAKTRKKVIDLDTYSKLDAYSIAMHEFYKSLRRAGFAVDLSLAIIS
Ga0335019_0676450_1_1623300034066FreshwaterMAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAIDICLAIISDRDAYPDWIL
Ga0335028_0387680_3_1703300034071FreshwaterMARKKVIDLDTYSQLDQWAISLHEMYRALRRAGFAVDLCLAIISDRDAYPDWILPS
Ga0335010_0440655_1_1083300034092FreshwaterMAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAI
Ga0335027_0453521_3_1613300034101FreshwaterMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIITDRDSYPDWI
Ga0335027_0884532_2_1483300034101FreshwaterMAKKKVIDLDTYNALDAYAICMHEFYKSLRRAGFAVDLCLAIIVERSAY
Ga0335031_0396766_3_2093300034104FreshwaterMARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDLALAIIVEPSAYPAWILPTPIDPERFGDYDDE
Ga0335031_0408478_1_1323300034104FreshwaterMAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDISLALIS
Ga0335066_0531967_500_6163300034112FreshwaterMAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAIDIC
Ga0335058_0733593_3_1073300034121FreshwaterMAKKKVIDLDTYNALDAWAISLHEMYSSLRRAGFG
Ga0335060_0007353_1_1503300034122FreshwaterMARKKVIDLDTYSALDAWAIGLQEMYRALRRAGFDVELSLAIIVEPNSYP
Ga0335061_0000778_1_1173300034168FreshwaterMAKKKVIDLDTYSALDAWAIGLQEMYRALRKAGFDVELS
Ga0335061_0445966_2_1333300034168FreshwaterMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIIT
Ga0334997_0344226_834_9533300034280FreshwaterMARKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDLCL
Ga0335013_0658543_1_1263300034284FreshwaterMARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.