Basic Information | |
---|---|
Family ID | F048835 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 147 |
Average Sequence Length | 43 residues |
Representative Sequence | MHVERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTRVPDA |
Number of Associated Samples | 123 |
Number of Associated Scaffolds | 147 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.04 % |
% of genes near scaffold ends (potentially truncated) | 93.20 % |
% of genes from short scaffolds (< 2000 bps) | 93.20 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.755 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.605 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.129 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.136 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 45.59% Coil/Unstructured: 54.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 147 Family Scaffolds |
---|---|---|
PF01370 | Epimerase | 40.14 |
PF04909 | Amidohydro_2 | 8.84 |
PF12695 | Abhydrolase_5 | 2.72 |
PF13563 | 2_5_RNA_ligase2 | 2.72 |
PF11066 | DUF2867 | 2.04 |
PF01734 | Patatin | 1.36 |
PF13207 | AAA_17 | 1.36 |
PF00004 | AAA | 1.36 |
PF01230 | HIT | 1.36 |
PF02585 | PIG-L | 0.68 |
PF00072 | Response_reg | 0.68 |
PF04392 | ABC_sub_bind | 0.68 |
PF01242 | PTPS | 0.68 |
PF09982 | DUF2219 | 0.68 |
PF00903 | Glyoxalase | 0.68 |
PF13460 | NAD_binding_10 | 0.68 |
PF01066 | CDP-OH_P_transf | 0.68 |
PF14534 | DUF4440 | 0.68 |
PF08352 | oligo_HPY | 0.68 |
PF00202 | Aminotran_3 | 0.68 |
PF03928 | HbpS-like | 0.68 |
PF03109 | ABC1 | 0.68 |
PF01425 | Amidase | 0.68 |
PF13365 | Trypsin_2 | 0.68 |
PF01464 | SLT | 0.68 |
COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
---|---|---|---|
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.36 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.36 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.36 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.68 |
COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.68 |
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.68 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.68 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.68 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.68 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.76 % |
Unclassified | root | N/A | 12.24 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101447693 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300000955|JGI1027J12803_107688717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 894 | Open in IMG/M |
3300003319|soilL2_10054851 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
3300004019|Ga0055439_10202947 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300005174|Ga0066680_10644546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 658 | Open in IMG/M |
3300005175|Ga0066673_10058543 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
3300005176|Ga0066679_10946349 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300005181|Ga0066678_10936590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 565 | Open in IMG/M |
3300005332|Ga0066388_101480916 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300005332|Ga0066388_101972049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
3300005340|Ga0070689_101338589 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300005345|Ga0070692_10047698 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
3300005459|Ga0068867_101345578 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300005467|Ga0070706_101417609 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300005468|Ga0070707_101778262 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300005471|Ga0070698_100059697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3851 | Open in IMG/M |
3300005518|Ga0070699_100539082 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300005518|Ga0070699_100941253 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300005536|Ga0070697_100337179 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300005546|Ga0070696_101426823 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005546|Ga0070696_101761513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
3300005549|Ga0070704_100072664 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
3300005559|Ga0066700_10103629 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
3300005574|Ga0066694_10344926 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300005586|Ga0066691_10790230 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300005713|Ga0066905_100043791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2679 | Open in IMG/M |
3300005713|Ga0066905_100105184 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1928 | Open in IMG/M |
3300005713|Ga0066905_101933451 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300006032|Ga0066696_10453060 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300006804|Ga0079221_11588717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
3300006847|Ga0075431_100287366 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
3300006847|Ga0075431_101644365 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300006871|Ga0075434_101373782 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300006880|Ga0075429_100139509 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
3300006904|Ga0075424_101618069 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300007076|Ga0075435_100594681 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300007258|Ga0099793_10214047 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300009089|Ga0099828_10862263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 810 | Open in IMG/M |
3300009089|Ga0099828_11016709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
3300009089|Ga0099828_11533102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
3300009090|Ga0099827_10847580 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 791 | Open in IMG/M |
3300009094|Ga0111539_11532082 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300009143|Ga0099792_11184899 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300009597|Ga0105259_1127233 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
3300009678|Ga0105252_10556244 | Not Available | 529 | Open in IMG/M |
3300009792|Ga0126374_10872867 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300009792|Ga0126374_11090111 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
3300009806|Ga0105081_1065723 | Not Available | 559 | Open in IMG/M |
3300009814|Ga0105082_1052985 | Not Available | 690 | Open in IMG/M |
3300009816|Ga0105076_1088269 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300009821|Ga0105064_1092742 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300009836|Ga0105068_1103425 | Not Available | 557 | Open in IMG/M |
3300010046|Ga0126384_10838907 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300010046|Ga0126384_11725023 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 593 | Open in IMG/M |
3300010047|Ga0126382_10723986 | Not Available | 838 | Open in IMG/M |
3300010047|Ga0126382_11474839 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300010048|Ga0126373_12045423 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300010323|Ga0134086_10220328 | Not Available | 714 | Open in IMG/M |
3300010359|Ga0126376_12491743 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300010359|Ga0126376_12813511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
3300010361|Ga0126378_10422143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1447 | Open in IMG/M |
3300010361|Ga0126378_11511355 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300010362|Ga0126377_10598566 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300010366|Ga0126379_13669902 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
3300010376|Ga0126381_100006292 | All Organisms → cellular organisms → Bacteria | 13115 | Open in IMG/M |
3300010376|Ga0126381_101831165 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 876 | Open in IMG/M |
3300010398|Ga0126383_10819884 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300012189|Ga0137388_10234414 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
3300012198|Ga0137364_11062514 | Not Available | 610 | Open in IMG/M |
3300012199|Ga0137383_10232121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1352 | Open in IMG/M |
3300012204|Ga0137374_11118777 | Not Available | 559 | Open in IMG/M |
3300012204|Ga0137374_11163357 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 543 | Open in IMG/M |
3300012210|Ga0137378_11466805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
3300012351|Ga0137386_11122663 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300012355|Ga0137369_10740492 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300012358|Ga0137368_10511651 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300012917|Ga0137395_10118307 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1781 | Open in IMG/M |
3300012925|Ga0137419_10623252 | Not Available | 868 | Open in IMG/M |
3300012944|Ga0137410_10455579 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1039 | Open in IMG/M |
3300012948|Ga0126375_10247091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1206 | Open in IMG/M |
3300012971|Ga0126369_12684724 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300012972|Ga0134077_10513787 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300012977|Ga0134087_10674764 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300015054|Ga0137420_1257658 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300015358|Ga0134089_10140266 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300015372|Ga0132256_100770858 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300015374|Ga0132255_106143814 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300017654|Ga0134069_1333405 | Not Available | 543 | Open in IMG/M |
3300017656|Ga0134112_10240961 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300018000|Ga0184604_10144341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
3300018028|Ga0184608_10533478 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300018063|Ga0184637_10672647 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300018074|Ga0184640_10422632 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300018078|Ga0184612_10077027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1740 | Open in IMG/M |
3300018081|Ga0184625_10360714 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300018089|Ga0187774_10054546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1789 | Open in IMG/M |
3300018433|Ga0066667_11900048 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
3300018482|Ga0066669_11723137 | Not Available | 576 | Open in IMG/M |
3300018482|Ga0066669_12388544 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300019879|Ga0193723_1144505 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300020067|Ga0180109_1313994 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300020579|Ga0210407_10521312 | Not Available | 928 | Open in IMG/M |
3300021178|Ga0210408_10853152 | Not Available | 711 | Open in IMG/M |
3300021560|Ga0126371_13409169 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300022694|Ga0222623_10159708 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 877 | Open in IMG/M |
3300025160|Ga0209109_10439229 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300025918|Ga0207662_10066410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2173 | Open in IMG/M |
3300025923|Ga0207681_11271631 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300025930|Ga0207701_10952230 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300026297|Ga0209237_1096052 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
3300026298|Ga0209236_1266043 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300026314|Ga0209268_1131912 | Not Available | 618 | Open in IMG/M |
3300026322|Ga0209687_1242921 | Not Available | 557 | Open in IMG/M |
3300026331|Ga0209267_1069713 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
3300026377|Ga0257171_1087394 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300026530|Ga0209807_1017519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3509 | Open in IMG/M |
3300026530|Ga0209807_1074245 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
3300026536|Ga0209058_1029678 | All Organisms → cellular organisms → Bacteria | 3396 | Open in IMG/M |
3300026536|Ga0209058_1136433 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300026547|Ga0209156_10487555 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300027643|Ga0209076_1065225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1034 | Open in IMG/M |
3300027880|Ga0209481_10576030 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300027909|Ga0209382_10285865 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
3300027910|Ga0209583_10236601 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 799 | Open in IMG/M |
3300027957|Ga0209857_1012517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1705 | Open in IMG/M |
3300027957|Ga0209857_1087327 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300028380|Ga0268265_10325071 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1395 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10052646 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10134229 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10185115 | Not Available | 580 | Open in IMG/M |
3300031226|Ga0307497_10704660 | Not Available | 521 | Open in IMG/M |
(restricted) 3300031237|Ga0255334_1033845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 578 | Open in IMG/M |
3300031474|Ga0170818_115562428 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300031547|Ga0310887_10309049 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300031668|Ga0318542_10074907 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
3300031740|Ga0307468_101307620 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300031779|Ga0318566_10007621 | All Organisms → cellular organisms → Bacteria | 4316 | Open in IMG/M |
3300031781|Ga0318547_10934894 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300031911|Ga0307412_12165688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
3300032180|Ga0307471_101366334 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300032180|Ga0307471_103133791 | Not Available | 586 | Open in IMG/M |
3300032205|Ga0307472_100624514 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300032205|Ga0307472_102664469 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300032205|Ga0307472_102693333 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
3300033550|Ga0247829_10505905 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1001 | Open in IMG/M |
3300034114|Ga0364938_099155 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300034659|Ga0314780_128062 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.12% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.76% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.08% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.40% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.40% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 2.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.04% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.36% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.36% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.68% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.68% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031237 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_35cm_T3_129 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1014476932 | 3300000364 | Soil | GIVNGVSDMHVERDGKENRFTVRYLAVYAKSGADWRMIAWQSTRQD* |
JGI1027J12803_1076887173 | 3300000955 | Soil | IVNGVSDMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTRQD* |
soilL2_100548513 | 3300003319 | Sugarcane Root And Bulk Soil | MHVENAGKEQRFTIRYLAVYAKSGGRWQMTAWQSTKVSDA* |
Ga0055439_102029472 | 3300004019 | Natural And Restored Wetlands | DGVSEMRVERDGKEQRFTVRYLAVYVQAGLRWRMIAWQSTRQPDA* |
Ga0066680_106445462 | 3300005174 | Soil | NGVSDMHVENAGKEQRFTIRYLAVYARAGQAWRMIAWQSTRVPDA* |
Ga0066673_100585431 | 3300005175 | Soil | MHVENAGKEQRFTIRYLAVYAKTGDHWRMIAWQSTRVPEA* |
Ga0066679_109463491 | 3300005176 | Soil | MHVENAGKEQRFTIRYLAVYAKTGDHWRMIAWQSTRLDA* |
Ga0066678_109365902 | 3300005181 | Soil | VSDMHVENAGKEQRFTIRYLAVYARAGQAWRMIAWQSTRVPDA* |
Ga0066388_1014809161 | 3300005332 | Tropical Forest Soil | GVSEMHVERDGKAQRFTVRYLAVYAKAGDRWRMLAWQSTRVPDA* |
Ga0066388_1019720491 | 3300005332 | Tropical Forest Soil | SEMHVERDGKEQRFNVGYLAVYTQANARWRMIDWQSTRQPDE* |
Ga0070689_1013385891 | 3300005340 | Switchgrass Rhizosphere | DMHVERDGKENRFTVRYLAVYAKTGERWRMIAWQSTRQD* |
Ga0070692_100476984 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | HGVSDMHVERDGKENRFTVRYLAVYAKAGERWRMIAWQSTRQD* |
Ga0068867_1013455781 | 3300005459 | Miscanthus Rhizosphere | MHVENAGKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPD* |
Ga0070706_1014176091 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVNGVSEMHVENAGKEQRFTVRYLAIYTKVGEQWRMLAWQSTRLPDA* |
Ga0070707_1017782621 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEMHVENAGKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPD* |
Ga0070698_1000596977 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RARVHGGVGVVTGVSEMHVESGGKEQRFTVRYLAVYAKSGEHWRMIAWQSTRQPDT* |
Ga0070699_1005390821 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VNGVSEMHVENAGKEQRFTVRYLAVYAKAGERWRMIAWQSTRQPDA* |
Ga0070699_1009412531 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EMHVENAGKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPD* |
Ga0070697_1003371793 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SDMHVERDGKENRFTVRYLAVYAKAGERWRMIAWQSTRQD* |
Ga0070696_1014268231 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTKQE* |
Ga0070696_1017615131 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GVSEMHVENAGKEQRFTVRYLAVYTKVGGPWRMLAWQSTRLPDA* |
Ga0070704_1000726644 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LVNGLSEMHVENGGKEQKFTVRYLAVYTKTGNEWRMIAWQSTRVPD* |
Ga0066700_101036294 | 3300005559 | Soil | AGKEQRFTVRYLAVYAKIAERWRMIAWQSTRQPDT* |
Ga0066694_103449261 | 3300005574 | Soil | ENAGKEQRFTVRYLAVYAKAGERWRMIAWQSTRQPDA* |
Ga0066691_107902301 | 3300005586 | Soil | GVSEMHVDNAGKEQRFTVRYLAVYAKIAERWRMIAWQSTRQPDA* |
Ga0066905_1000437911 | 3300005713 | Tropical Forest Soil | EMHVERDGKEQRFTVRYLAVYAKAGDRWRLIAWQSTRQPDA* |
Ga0066905_1001051841 | 3300005713 | Tropical Forest Soil | SEMHVERDGKEQRFNVGYLAVYTQADARWRMIDWPSTRQPDE* |
Ga0066905_1019334512 | 3300005713 | Tropical Forest Soil | VNGVSDMHVERDGKENRFTVRYLAVYAKAGSDWRMIAWQSTRQD* |
Ga0066696_104530601 | 3300006032 | Soil | RRARVHGNVGIVNGVSEMHVENAGKEQRFTIRYLAVYAKAGDNWRMIAWQSTRLDA* |
Ga0079221_115887171 | 3300006804 | Agricultural Soil | MHVENAGKEQRFTVRYLAVYAKTGGQWRMLAWQSTRQPDA* |
Ga0075431_1002873663 | 3300006847 | Populus Rhizosphere | GVSDMHVERDGKENRFTVRYLAVYGKSGADWRMIAWQSTKQE* |
Ga0075431_1016443651 | 3300006847 | Populus Rhizosphere | GVSEMHVENAGKEQRFTVRYLAIYAKIGEHWRMLAWQSTRVPDA* |
Ga0075434_1013737822 | 3300006871 | Populus Rhizosphere | GVSDMHVERDGKENRFTVRYLAVYAKSGADWRMIAWQSTRQD* |
Ga0075429_1001395093 | 3300006880 | Populus Rhizosphere | VENAGKEQRFTVRYVAVYTKAGGQWRMIAWQSTRLPDA* |
Ga0075424_1016180691 | 3300006904 | Populus Rhizosphere | ENAGKEQRFTIRYLAVYARGAGGWQMTAWQSTKVPDA* |
Ga0075435_1005946813 | 3300007076 | Populus Rhizosphere | GKEQRFTVRYLAVYTKSGEAWRMIAWQSTRVPDA* |
Ga0099793_102140471 | 3300007258 | Vadose Zone Soil | GVSEMHVERDGKEQRFTVRYLAVYAKAGGHWRMIAWQSTRQD* |
Ga0099828_108622632 | 3300009089 | Vadose Zone Soil | GKEQRFTVRYLAVYAKAGEHWRMIAWQSTRQPEAGE* |
Ga0099828_110167092 | 3300009089 | Vadose Zone Soil | ERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTRQPEAQG* |
Ga0099828_115331021 | 3300009089 | Vadose Zone Soil | VSEMHVERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTREPEAQG* |
Ga0099827_108475802 | 3300009090 | Vadose Zone Soil | MHVERDGTEQRFTVRYLAVHAMAGEHWRLVAWQSTRQPDV* |
Ga0111539_115320821 | 3300009094 | Populus Rhizosphere | GVSEMHVENAGKEQRFTVRYLAVYAKTGEAWRMIAWQSTRVPDA* |
Ga0099792_111848992 | 3300009143 | Vadose Zone Soil | IVNGVSEMHVENAGKEQRFTIRYLAVYANAGDTWRMIAWQSTRVPDA* |
Ga0105259_11272332 | 3300009597 | Soil | SEMHVERDGKEQRFTVRYLAVYAKAGEQWRMIAWQSTRVD* |
Ga0105252_105562442 | 3300009678 | Soil | VNGVSEMHVENAGKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPD* |
Ga0126374_108728672 | 3300009792 | Tropical Forest Soil | VGVVTGVSEMHVEREGKEQRFTVRYLAVYARTGEHWRMIAWQSTRVPD* |
Ga0126374_110901112 | 3300009792 | Tropical Forest Soil | VNGVSDMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTRQD* |
Ga0105081_10657231 | 3300009806 | Groundwater Sand | VERDGKEQRFTVRYLAVYVKTAAQWRMIAWQSTKVPEA* |
Ga0105082_10529852 | 3300009814 | Groundwater Sand | MHVERDGKEQRFTVRYLAVYAKAGEQWRMIAWQSTRQD* |
Ga0105076_10882691 | 3300009816 | Groundwater Sand | GKEQRFTVRYLAVYAKAGGEWRMIAWQSTRQPDG* |
Ga0105064_10927422 | 3300009821 | Groundwater Sand | RRARVHGTVGVVNGVSDMHVERDGKEQRFTVRYLAVYAKAGDHWRMIAWQSTRQD* |
Ga0105068_11034252 | 3300009836 | Groundwater Sand | SKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPDA* |
Ga0126384_108389071 | 3300010046 | Tropical Forest Soil | MHVERDGKENRFTVRYLAVYAKTGADWRMIAWQSTRQD* |
Ga0126384_117250232 | 3300010046 | Tropical Forest Soil | GGVGIVNGVSDMHVERDGKENRFTVRYLAVYGKTGAEWRMIAWQSTRQD* |
Ga0126382_107239862 | 3300010047 | Tropical Forest Soil | NTGKEQRFTVRYLAIYTKIGEQWRMLAWQSTRVPDA* |
Ga0126382_114748391 | 3300010047 | Tropical Forest Soil | VGGVGIVNGVSDMHVERDGKENRFTVRYLAVYGKAGADWRMIAWQSTRQD* |
Ga0126373_120454231 | 3300010048 | Tropical Forest Soil | MHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTRQD* |
Ga0134086_102203281 | 3300010323 | Grasslands Soil | MHVENAGKEQRFTVRYLAVYTRAGEQWRMLAWQSTRQPDA* |
Ga0126376_124917432 | 3300010359 | Tropical Forest Soil | GLVDGVSEMHVERDGKEQRFTVRYLAVYAKATDRWRMIAWQSTRVPDA* |
Ga0126376_128135111 | 3300010359 | Tropical Forest Soil | GKEQHFTVRYLAVYAKIADRWQMTAWQSTKVPDA* |
Ga0126378_104221431 | 3300010361 | Tropical Forest Soil | GVSDMHVERDGKENRFTVRCLAVYAKAGADWRMIAWQSTRQD* |
Ga0126378_115113552 | 3300010361 | Tropical Forest Soil | VSDMHVENAGKEQRFTVRYLAVYAKAGDRWRMIAWQSTRQPDA* |
Ga0126377_105985662 | 3300010362 | Tropical Forest Soil | VNGVSDMHVERDGKENRFTVRYLAVYGKAGADWRMIAWQSTRQD* |
Ga0126379_136699021 | 3300010366 | Tropical Forest Soil | NGVSDMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTRQD* |
Ga0126381_1000062921 | 3300010376 | Tropical Forest Soil | YVENAGKEQHFTIRYLAVYAKIADRWQMTAWQSTKVPDA* |
Ga0126381_1018311653 | 3300010376 | Tropical Forest Soil | VENAGKEQRFTIRYLAVYAKIAGRWQMTAWQSTKVPDA* |
Ga0126383_108198842 | 3300010398 | Tropical Forest Soil | PRDRRVRVVGGVGIVNGVSDMHVERDGKENRFTVRYLAVYGKAGADWRMIAWQSTRQD* |
Ga0137388_102344143 | 3300012189 | Vadose Zone Soil | VHGGIGVVNGVSEMHVERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTREPEAQG* |
Ga0137364_110625142 | 3300012198 | Vadose Zone Soil | GKEQRFTIRYLAVYAKAGEQWRMLAWQSTRQPDV* |
Ga0137383_102321213 | 3300012199 | Vadose Zone Soil | GKEQRFTIRYLAVYAKAGDNWRMIAWQSTRVPDA* |
Ga0137374_111187772 | 3300012204 | Vadose Zone Soil | VNGVSEMHVERDGKEQRFTVRYLAVYAKSGQNWRMIAWQSTRVD* |
Ga0137374_111633572 | 3300012204 | Vadose Zone Soil | GGIGVVNGVSEMHVESGGKEQRFTVRYLAVYAKSGEQWRMIAWQSTRQPDA* |
Ga0137378_114668052 | 3300012210 | Vadose Zone Soil | RDGKENRFTVRYLAVYAKSGADWRMIAWQSTRQD* |
Ga0137386_111226631 | 3300012351 | Vadose Zone Soil | MHVELDGKENRFTVRYLAVYAKAGADWRMVAWQSTKQD* |
Ga0137369_107404921 | 3300012355 | Vadose Zone Soil | RRARVHGGVGIVNGVSDMHVERDGKENRFTVRYLAAYAKVGDHWRMIAWQSTRQD* |
Ga0137368_105116513 | 3300012358 | Vadose Zone Soil | HVESGGKEQRFTVRYLAVYAKSGEQWRMIAWQSTRQPDA* |
Ga0137395_101183073 | 3300012917 | Vadose Zone Soil | GVSDMHVENAGKEQRFTIRYLAVYAKAGENWRMIAWQSTRMPDA* |
Ga0137419_106232522 | 3300012925 | Vadose Zone Soil | VHGGVGVVTGVSEMHVESGGKEQRFTVRYLAVYAKTGEHWRMIAWQSTRPPDA* |
Ga0137410_104555793 | 3300012944 | Vadose Zone Soil | MHVESGGKEQRFTVRYLAVYAKTGEHWRMIAWQSTRQPDA* |
Ga0126375_102470912 | 3300012948 | Tropical Forest Soil | GKEQHFTIRYLAVYAKIADRWQMTAWQSTKVPDA* |
Ga0126369_126847242 | 3300012971 | Tropical Forest Soil | DMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTKQE* |
Ga0134077_105137872 | 3300012972 | Grasslands Soil | ERDGKENRFTVRYLAVYAKTGADWRMIAWQSTKLDS* |
Ga0134087_106747641 | 3300012977 | Grasslands Soil | GKEQRFTIRYLAVYARGAGGWQMTAWQSTKVPDA* |
Ga0137420_12576581 | 3300015054 | Vadose Zone Soil | VHGGIGIVNGVSEMHVENAGKEQRFTIRYLAVYAKAGDTWRMIAWQSTRVPDV* |
Ga0134089_101402662 | 3300015358 | Grasslands Soil | VSDMHVERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTRVPDA* |
Ga0132256_1007708582 | 3300015372 | Arabidopsis Rhizosphere | NVGIVNGVSDMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTRQD* |
Ga0132255_1061438141 | 3300015374 | Arabidopsis Rhizosphere | DMHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTKQD* |
Ga0134069_13334052 | 3300017654 | Grasslands Soil | GAVGIVDGISEMHVENAGKEQRFTVRYLAVYTRAGEQWRMLAWQSTRQPDA |
Ga0134112_102409612 | 3300017656 | Grasslands Soil | ARVHGNVGVVNGVSDMHVERDGKEQRFTVRYLAVYAKAGGHWRMIAWQSTRQD |
Ga0184604_101443411 | 3300018000 | Groundwater Sediment | NAGKEQRFTVRYLAVYAKSGNAWRMIAWQSTRVPDA |
Ga0184608_105334782 | 3300018028 | Groundwater Sediment | RGIAPRERRARVHDGVGLVHGVSDMHVERDGEENRFTVRYLAVYAKAGEHWRMITWQSTRQD |
Ga0184637_106726471 | 3300018063 | Groundwater Sediment | NGVSEMHVERDGKEQRFTVRYLAVYAKAGEHWRMFAWQSTRQPD |
Ga0184640_104226321 | 3300018074 | Groundwater Sediment | AGKEQRFTVRYLAVYAKAGAAWRMIAWQSTRVPDA |
Ga0184612_100770273 | 3300018078 | Groundwater Sediment | SDMHVERDGKENRFTVRYLAVYAKAGDHWRMIAWQSTRQD |
Ga0184625_103607142 | 3300018081 | Groundwater Sediment | VSDMHVERDGKEQRFTVRYLAVCAKAGDHWRMIAWQSTRQD |
Ga0187774_100545461 | 3300018089 | Tropical Peatland | MHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTKQE |
Ga0066667_119000482 | 3300018433 | Grasslands Soil | DMHVENAGKEQRFTIRYLAVYARAGQAWRMIAWQSTRVPDA |
Ga0066669_117231372 | 3300018482 | Grasslands Soil | ERDGKEQRFTVRYLAVYAKAGGLWRMTAWQSTRVPDA |
Ga0066669_123885442 | 3300018482 | Grasslands Soil | ENAGKEQRFTIRYLAVYARIADRWQMTAWQSTKVPDAA |
Ga0193723_11445052 | 3300019879 | Soil | GVGLVHGVSDMHVERDGKENRFTVRYLAVYAKAGEHWRMIAWQSTRQD |
Ga0180109_13139941 | 3300020067 | Groundwater Sediment | HVESGGKEQRFTVRYLAVYAKTGEQWRMIAWQSTRLE |
Ga0210407_105213122 | 3300020579 | Soil | VSEMHVENAGKEQHFTVRYLAIYAKAGEHWRMIAWQSTRQPDA |
Ga0210408_108531521 | 3300021178 | Soil | RGIAPRERRARVHGAVGIVNGVSEMHVENAGKEQHFTVRYLAIYAKAGEHWRMIAWQSTRQPDA |
Ga0126371_134091692 | 3300021560 | Tropical Forest Soil | VNGVSEMHIERDGKEQRFTVRYLAVYALAGERWRMIAWQSTRVPDA |
Ga0222623_101597082 | 3300022694 | Groundwater Sediment | NRVSEMHVENAGKEQRFTVRYLAVYARAGQAWRMIAWQSTRVPDA |
Ga0209109_104392292 | 3300025160 | Soil | MNEKDVLHGISEMHVESAGKEQRFTVRYLAVYAKAGENWRMIAWQSTRVPDA |
Ga0207662_100664104 | 3300025918 | Switchgrass Rhizosphere | GGKEQRFTIRYLAVYTKIANRWQMTAWQSTKVPDA |
Ga0207681_112716311 | 3300025923 | Switchgrass Rhizosphere | RVHDGVGLVHGVSDMHVERDGKENRFTVRYLAVYAKAGERWRMIAWQSTRQD |
Ga0207701_109522302 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | NGVSEMHVENAGKEQHFTVRFLAVYVKSGEQWRMLAWQSTRQPDA |
Ga0209237_10960522 | 3300026297 | Grasslands Soil | MHVERDGKEQRFTVRYLAVYAKAGEHWRMIAWQSTRVPDA |
Ga0209236_12660432 | 3300026298 | Grasslands Soil | MHVERDGKENRFTVRYLAVYAKAGADWRMVAWQSTKQD |
Ga0209268_11319122 | 3300026314 | Soil | NAGKEQRFTVRYLAVYTRTGEQWRMLAWQSTRQPDA |
Ga0209687_12429211 | 3300026322 | Soil | VRVHGDVGIVDGISEMHVDNAGKEQRFTVRYLAVYTRAGEQWRMLAWQSTRQPDA |
Ga0209267_10697131 | 3300026331 | Soil | VNGVSEMHVDNAGKEQRFTVRYLAVYAKIAERWRMIAWQSTRQPDA |
Ga0257171_10873941 | 3300026377 | Soil | RVHGNVGVVNGVSDMHVERDGKENRFTVRYLAVYAKAGDHWRMIAWQSTRQD |
Ga0209807_10175194 | 3300026530 | Soil | DNAGKEQRFTVRYLAVYTRAGEQWRMLAWQSTRQPDA |
Ga0209807_10742453 | 3300026530 | Soil | VDNAGKEQRFTIRYLAVYARAGQAWRMIAWQSTRVPDA |
Ga0209058_10296784 | 3300026536 | Soil | RAGKENRFTVRYLAVYAKTGADWRMIAWQSTKLDS |
Ga0209058_11364331 | 3300026536 | Soil | VHGDVGIVNGVSEMHVERDGKEQRFTVRYLAVYAKAGGHWRMIAWQSTRQD |
Ga0209156_104875551 | 3300026547 | Soil | NAGKEQRFTIRYLAVYAKAGDTWRMIAWQSTRLDA |
Ga0209076_10652253 | 3300027643 | Vadose Zone Soil | VNGVSEMHVENAGKEQRFTVRYLAVYAKVGERWRMIAWQSTRQPDA |
Ga0209481_105760302 | 3300027880 | Populus Rhizosphere | EMQVERDGKAQRFTVRYLAVYARAAGRWRMIAWQSTRVPDA |
Ga0209382_102858652 | 3300027909 | Populus Rhizosphere | MHVERDGKENRFTVRYLAVYAKAGANWRMIAWQSTKQE |
Ga0209583_102366012 | 3300027910 | Watersheds | MHVENAGKEQHFTVRYLAIYAKAGEHWRMIAWQSTRQPDA |
Ga0209857_10125173 | 3300027957 | Groundwater Sand | RGSKEQRFTVRYLAVYAKTGDQWRMIAWQSTRVPDA |
Ga0209857_10873272 | 3300027957 | Groundwater Sand | RVHGTVGVVNGVSDMHVERDGKEQRFTVRYLAVYAKAGDHWRMIAWQSTRQD |
Ga0268265_103250713 | 3300028380 | Switchgrass Rhizosphere | HVERDGKENRFTVRYLAVYAKSGADWRMVAWQSTKQD |
(restricted) Ga0255310_100526461 | 3300031197 | Sandy Soil | SEMHVENAGREQRFTVRYLAVYGKKPEGWRMIAWQSTRVPD |
(restricted) Ga0255310_101342291 | 3300031197 | Sandy Soil | GIVNGVSDMHVERDGKENRFTVRYLAVYTKAGADWRMIAWQSTRQD |
(restricted) Ga0255310_101851151 | 3300031197 | Sandy Soil | VGVVNGVSEMHVENAGKEQRFAVRYLAVYAKAGEHWRMIAWQSTRQPDT |
Ga0307497_107046602 | 3300031226 | Soil | MSYVPGKEQHFMYLAVYAKIADRWRMTAWQSTKVADA |
(restricted) Ga0255334_10338452 | 3300031237 | Sandy Soil | VNGVSEMHVENAGKEQRFTVRYLAVYAKAGERWRMIAWQSTRQPDA |
Ga0170818_1155624281 | 3300031474 | Forest Soil | VSEMHVENAGKEQHFTVRYLAVYAKSGEQWRMIAWQSTRQPDA |
Ga0310887_103090491 | 3300031547 | Soil | MHVERDGKENRFTVRYLAVYAKAGADWRMIAWQSTKQD |
Ga0318542_100749074 | 3300031668 | Soil | VERDGRENRFTVRYLAVYAKAGADWRMIAWQSTKLE |
Ga0307468_1013076201 | 3300031740 | Hardwood Forest Soil | VSDMHVERDGKENRFTVRYLAVYAKSGADWRMVAWQSTKQD |
Ga0318566_100076211 | 3300031779 | Soil | VENAGKDQHFTIRYLAVYAKIADRWQMTAWQSTKVPDA |
Ga0318547_109348942 | 3300031781 | Soil | HVERDGKENRFTVRYLAVYGKAGADWRMIAWQSTKQE |
Ga0307412_121656881 | 3300031911 | Rhizosphere | ENAGKEQKFTIRYLAIYAKSGGQWRMTAWQSTKVPE |
Ga0307471_1013663341 | 3300032180 | Hardwood Forest Soil | VNGVSEMHVENAGKEQRFTIRYLAVYAKAGDNWRMIAWQSTRVPEA |
Ga0307471_1031337911 | 3300032180 | Hardwood Forest Soil | VGIVNGVSEMHVENAGKEQHFTVRYLAIYAKAGEHWRMIAWQSTRQPDA |
Ga0307472_1006245142 | 3300032205 | Hardwood Forest Soil | RARVHGGIGVVNGVSEMHVENAGKEQYFTVRYLAVYVKSGEQWRMLAWQSTRQPDA |
Ga0307472_1026644691 | 3300032205 | Hardwood Forest Soil | DGKEQHFTVRYLAVYAKAGEHWRLIAWQSTRQPDA |
Ga0307472_1026933331 | 3300032205 | Hardwood Forest Soil | VENAGKEQRFTVRYLAVYAKAGATWRMTAWQSTKVPDA |
Ga0247829_105059053 | 3300033550 | Soil | HVENAGKEQRFTVRYLAVYAKTGEAWRMIAWQSTRVPDA |
Ga0364938_099155_446_562 | 3300034114 | Sediment | MHVERDGKEQRFTVRYLAVYAKAGEQWRMIAWQSTRQE |
Ga0314780_128062_2_115 | 3300034659 | Soil | HVERDGKENRFTVRYLAVYGKSGADWRMIAWQSTKQE |
⦗Top⦘ |