Basic Information | |
---|---|
Family ID | F048814 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 147 |
Average Sequence Length | 44 residues |
Representative Sequence | MGKIVFAGAMSHVLDPDYYERACGAVGRQKVEAAMAEIARMGER |
Number of Associated Samples | 130 |
Number of Associated Scaffolds | 147 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 96.60 % |
% of genes near scaffold ends (potentially truncated) | 97.96 % |
% of genes from short scaffolds (< 2000 bps) | 93.20 % |
Associated GOLD sequencing projects | 123 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.197 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.884 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.170 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.939 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 147 Family Scaffolds |
---|---|---|
PF07883 | Cupin_2 | 9.52 |
PF11249 | DUF3047 | 5.44 |
PF00296 | Bac_luciferase | 4.76 |
PF02653 | BPD_transp_2 | 4.76 |
PF00480 | ROK | 3.40 |
PF00441 | Acyl-CoA_dh_1 | 3.40 |
PF13561 | adh_short_C2 | 2.72 |
PF00107 | ADH_zinc_N | 2.72 |
PF06537 | DHOR | 2.72 |
PF00005 | ABC_tran | 2.72 |
PF02738 | MoCoBD_1 | 2.72 |
PF02604 | PhdYeFM_antitox | 1.36 |
PF14226 | DIOX_N | 1.36 |
PF00581 | Rhodanese | 1.36 |
PF02771 | Acyl-CoA_dh_N | 1.36 |
PF02900 | LigB | 1.36 |
PF09754 | PAC2 | 1.36 |
PF01315 | Ald_Xan_dh_C | 1.36 |
PF03171 | 2OG-FeII_Oxy | 1.36 |
PF07681 | DoxX | 0.68 |
PF02633 | Creatininase | 0.68 |
PF16868 | NMT1_3 | 0.68 |
PF13087 | AAA_12 | 0.68 |
PF04264 | YceI | 0.68 |
PF00890 | FAD_binding_2 | 0.68 |
PF00211 | Guanylate_cyc | 0.68 |
PF00528 | BPD_transp_1 | 0.68 |
PF07969 | Amidohydro_3 | 0.68 |
PF03241 | HpaB | 0.68 |
PF01212 | Beta_elim_lyase | 0.68 |
PF11794 | HpaB_N | 0.68 |
PF04909 | Amidohydro_2 | 0.68 |
PF13147 | Obsolete Pfam Family | 0.68 |
PF13669 | Glyoxalase_4 | 0.68 |
PF05494 | MlaC | 0.68 |
PF00702 | Hydrolase | 0.68 |
COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
---|---|---|---|
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 6.80 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 4.76 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.76 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 2.72 |
COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.36 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.36 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.36 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.68 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.68 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.68 |
COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.68 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.68 |
COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.68 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.68 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.68 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.68 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.68 |
COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.68 |
COG2368 | Aromatic ring hydroxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.68 |
COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.68 |
COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.68 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.68 |
COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.68 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.68 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.68 |
COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.68 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.68 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.20 % |
Unclassified | root | N/A | 6.80 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459002|F0B48LX02I484L | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
2228664022|INPgaii200_c1124802 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
3300001139|JGI10220J13317_12064590 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 574 | Open in IMG/M |
3300004268|Ga0066398_10064517 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300004479|Ga0062595_101994064 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300004633|Ga0066395_10247986 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300005166|Ga0066674_10064471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1671 | Open in IMG/M |
3300005174|Ga0066680_10132335 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
3300005180|Ga0066685_11094294 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300005328|Ga0070676_10260906 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300005332|Ga0066388_100789570 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
3300005332|Ga0066388_100906544 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
3300005353|Ga0070669_100801846 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300005353|Ga0070669_102024961 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 503 | Open in IMG/M |
3300005441|Ga0070700_100351304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1093 | Open in IMG/M |
3300005445|Ga0070708_100851642 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300005468|Ga0070707_101986795 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005536|Ga0070697_101211393 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 673 | Open in IMG/M |
3300005555|Ga0066692_10656894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
3300005558|Ga0066698_10076144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2174 | Open in IMG/M |
3300005598|Ga0066706_10605164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
3300005713|Ga0066905_100654718 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300005713|Ga0066905_101114115 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300005764|Ga0066903_105689900 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300005841|Ga0068863_100693775 | Not Available | 1012 | Open in IMG/M |
3300005844|Ga0068862_101512508 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 677 | Open in IMG/M |
3300005844|Ga0068862_102651663 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005879|Ga0075295_1021549 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300005937|Ga0081455_10974235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
3300005983|Ga0081540_1003560 | All Organisms → cellular organisms → Bacteria | 12254 | Open in IMG/M |
3300006034|Ga0066656_10766277 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. KM1 | 618 | Open in IMG/M |
3300006852|Ga0075433_10539445 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300006854|Ga0075425_100899710 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300006876|Ga0079217_11566997 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
3300006894|Ga0079215_11480120 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300006894|Ga0079215_11550321 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
3300006903|Ga0075426_10644019 | Not Available | 793 | Open in IMG/M |
3300006903|Ga0075426_11562369 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300009012|Ga0066710_102187227 | Not Available | 808 | Open in IMG/M |
3300009012|Ga0066710_103804157 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300009038|Ga0099829_11129292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 649 | Open in IMG/M |
3300009078|Ga0105106_10485071 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300009089|Ga0099828_10934939 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300009089|Ga0099828_11947579 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
3300009090|Ga0099827_10103630 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2266 | Open in IMG/M |
3300009147|Ga0114129_10775710 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1225 | Open in IMG/M |
3300009157|Ga0105092_10866869 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300009162|Ga0075423_11376671 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300009545|Ga0105237_12237511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
3300009553|Ga0105249_11222903 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 822 | Open in IMG/M |
3300009792|Ga0126374_10003005 | All Organisms → cellular organisms → Bacteria | 5448 | Open in IMG/M |
3300009804|Ga0105063_1021291 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300009810|Ga0105088_1036554 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300010047|Ga0126382_11280291 | Not Available | 662 | Open in IMG/M |
3300010322|Ga0134084_10006087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2887 | Open in IMG/M |
3300010326|Ga0134065_10024506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1726 | Open in IMG/M |
3300010336|Ga0134071_10212609 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300010359|Ga0126376_10832620 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300010361|Ga0126378_10970477 | Not Available | 954 | Open in IMG/M |
3300010361|Ga0126378_12144121 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300010362|Ga0126377_11305727 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 797 | Open in IMG/M |
3300010366|Ga0126379_11182421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 871 | Open in IMG/M |
3300010376|Ga0126381_100854779 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1308 | Open in IMG/M |
3300010376|Ga0126381_103768269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300010398|Ga0126383_13001154 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
3300010398|Ga0126383_13484361 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300010399|Ga0134127_13555624 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300010400|Ga0134122_12508088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
3300011269|Ga0137392_11047019 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300011436|Ga0137458_1261209 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300012035|Ga0137445_1086670 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 633 | Open in IMG/M |
3300012096|Ga0137389_10960070 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 733 | Open in IMG/M |
3300012201|Ga0137365_10985254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 612 | Open in IMG/M |
3300012205|Ga0137362_10829883 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300012354|Ga0137366_11001165 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300012363|Ga0137390_11284298 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300012685|Ga0137397_10097013 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
3300012925|Ga0137419_10162425 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
3300012929|Ga0137404_11202638 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300012944|Ga0137410_10218586 | Not Available | 1482 | Open in IMG/M |
3300012957|Ga0164303_10686791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
3300014150|Ga0134081_10370807 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
3300014154|Ga0134075_10379368 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
3300014157|Ga0134078_10092323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1120 | Open in IMG/M |
3300014157|Ga0134078_10615240 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300014324|Ga0075352_1038025 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300015245|Ga0137409_11146271 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300015264|Ga0137403_10786227 | Not Available | 808 | Open in IMG/M |
3300015357|Ga0134072_10248850 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300015359|Ga0134085_10225052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 812 | Open in IMG/M |
3300015359|Ga0134085_10315512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
3300017974|Ga0187777_10237525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1234 | Open in IMG/M |
3300018031|Ga0184634_10362861 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 664 | Open in IMG/M |
3300018064|Ga0187773_11126406 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300018075|Ga0184632_10094965 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
3300018076|Ga0184609_10127097 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1162 | Open in IMG/M |
3300018077|Ga0184633_10129437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1307 | Open in IMG/M |
3300018431|Ga0066655_10410606 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300018431|Ga0066655_10996891 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300019279|Ga0184642_1057886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 739 | Open in IMG/M |
3300020006|Ga0193735_1157770 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 582 | Open in IMG/M |
3300020018|Ga0193721_1136993 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 602 | Open in IMG/M |
3300020109|Ga0194112_10044990 | All Organisms → cellular organisms → Bacteria | 4491 | Open in IMG/M |
3300022563|Ga0212128_10082004 | All Organisms → cellular organisms → Bacteria | 2080 | Open in IMG/M |
3300022563|Ga0212128_10097296 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
3300025157|Ga0209399_10144398 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300025905|Ga0207685_10387278 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300025922|Ga0207646_11149609 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300025923|Ga0207681_11657444 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 535 | Open in IMG/M |
3300025932|Ga0207690_10735228 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300026018|Ga0208418_1017221 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300026075|Ga0207708_10823667 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 800 | Open in IMG/M |
3300026075|Ga0207708_11483165 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
3300026301|Ga0209238_1225099 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300026306|Ga0209468_1196325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300026330|Ga0209473_1105332 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300026469|Ga0257169_1077714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
3300026480|Ga0257177_1038016 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300026507|Ga0257165_1065083 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300026514|Ga0257168_1011208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1713 | Open in IMG/M |
3300026535|Ga0256867_10103550 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300027273|Ga0209886_1069323 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300027277|Ga0209846_1026495 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 936 | Open in IMG/M |
3300027324|Ga0209845_1040003 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300027646|Ga0209466_1119472 | Not Available | 535 | Open in IMG/M |
3300027669|Ga0208981_1114276 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300027748|Ga0209689_1406599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
3300027775|Ga0209177_10012669 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
3300027874|Ga0209465_10067499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1730 | Open in IMG/M |
3300027880|Ga0209481_10503445 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
3300027950|Ga0209885_1006836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1141 | Open in IMG/M |
3300028792|Ga0307504_10340309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300028814|Ga0307302_10313454 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 772 | Open in IMG/M |
3300028878|Ga0307278_10274652 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300028889|Ga0247827_10233649 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300030006|Ga0299907_10032320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4068 | Open in IMG/M |
3300031455|Ga0307505_10147405 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300031713|Ga0318496_10158756 | Not Available | 1236 | Open in IMG/M |
3300031740|Ga0307468_100982968 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300031740|Ga0307468_102015438 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
3300031780|Ga0318508_1037007 | Not Available | 1257 | Open in IMG/M |
3300031798|Ga0318523_10016939 | All Organisms → cellular organisms → Bacteria | 3097 | Open in IMG/M |
3300031820|Ga0307473_10069292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1761 | Open in IMG/M |
3300032180|Ga0307471_102840859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 615 | Open in IMG/M |
3300032770|Ga0335085_10817007 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300033433|Ga0326726_10267699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1595 | Open in IMG/M |
3300033500|Ga0326730_1100309 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.16% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.12% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.12% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.76% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.76% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.40% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.72% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 2.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.04% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.36% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.36% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.36% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.36% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.36% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.36% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.68% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.68% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.68% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026018 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027950 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E1_04103380 | 2170459002 | Grass Soil | MGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCMTEIARMGERF |
INPgaii200_11248021 | 2228664022 | Soil | MGEIVFGGAMSHVLDPDYYQVACGDLGRQKVTEAMAAIARM |
JGI10220J13317_120645902 | 3300001139 | Soil | MGRIVFGGAMSHVLDPDYYERACGALGRQTVVAVMAEIARMGERLS |
Ga0066398_100645172 | 3300004268 | Tropical Forest Soil | MGKIVFAGAMSHVLDPEYYDHACGAVGRQKVEAAMTEIARMGERFSATR |
Ga0062595_1019940642 | 3300004479 | Soil | MGKLVFAGAMSHVLDPEYYDRACGALGRKTVTECMAQIAQMGERFSATG |
Ga0066395_102479861 | 3300004633 | Tropical Forest Soil | MGKIVFGGAMSHVLDPEYYQAACGDLGRRKVTEAMEAIAR |
Ga0066674_100644713 | 3300005166 | Soil | MGRIVFAAAMSHVLDPDYYERVCGAVGRRKTDEAMAAIAA |
Ga0066680_101323351 | 3300005174 | Soil | MGKIVFAGAMSHVLDPDYYERACGAVGRQKVEAAMAEIARMGER |
Ga0066685_110942941 | 3300005180 | Soil | MGKIVFAGAMSHVLDPDYYDAACGPVGRRKVEDVMEAIRQMGARL |
Ga0070676_102609062 | 3300005328 | Miscanthus Rhizosphere | MGKLVFAGAMSHVLDPDYYDRACGALGRKTVTECMAQIAQMGERFSATGAD |
Ga0066388_1007895702 | 3300005332 | Tropical Forest Soil | MGKIVFAGAMSHVLDPEYYDHACGAVGRQKVEAAMTEIGRMGERFSA |
Ga0066388_1009065442 | 3300005332 | Tropical Forest Soil | MGEIVFAGAMSHVLDPQYYQEACGPSGRRKVEACMAEIRTMGATFLARRPDA |
Ga0070669_1008018462 | 3300005353 | Switchgrass Rhizosphere | MGKIVFAGAMSHVLDPDYYQRACGDEGRRKTVECMTEIARMGE |
Ga0070669_1020249611 | 3300005353 | Switchgrass Rhizosphere | MGQIVFAGAMSHVLDPDYYDRACGAAGRQKVTECMTEIAR |
Ga0070700_1003513043 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRIVFGGAMSHVLDPDYYERACGALGRQTVVAVMAEIARMGERLSA |
Ga0070708_1008516422 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCMTEIAR |
Ga0070707_1019867952 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKIVFAGAMSHVLDPEYYRAACGPVGRQKVEALMAEIRQMGGRLAGA |
Ga0070697_1012113933 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIASMGDRFV |
Ga0066692_106568941 | 3300005555 | Soil | MGKIVFAAAMSHVLDPDYYQAACGLTGRRKVEACMAEIEKLGET |
Ga0066698_100761443 | 3300005558 | Soil | MGKIVFAGAMSHVLDPDYYERACGAVGRQKVEAAMAEIA |
Ga0066706_106051643 | 3300005598 | Soil | MGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIANMGDRFVEKKADAL |
Ga0066905_1006547182 | 3300005713 | Tropical Forest Soil | MGRIVFAGAMSHVLDPDYYERACGADGRQKVLAAMAEIAKMGERCSAAKPD |
Ga0066905_1011141152 | 3300005713 | Tropical Forest Soil | MGRIVFAGAMSHVLDPDYYERVCGAVGRRKTEETMAAIAAMGER |
Ga0066903_1056899001 | 3300005764 | Tropical Forest Soil | MGKIVFGGAMSHVLDPEYYQAACGDLGRRKVTEAMEAIA |
Ga0068863_1006937751 | 3300005841 | Switchgrass Rhizosphere | MGEIVFGGAMSHVLDPDYYQAACGDLGRQKVVEAMDAI |
Ga0068862_1015125081 | 3300005844 | Switchgrass Rhizosphere | MGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIA |
Ga0068862_1026516631 | 3300005844 | Switchgrass Rhizosphere | MGKLVFAGAMSHVLDPDYYDRACGALGRKTVTECMAQ |
Ga0075295_10215491 | 3300005879 | Rice Paddy Soil | MGRIVFAGAMSHVLDPDYYERACGAVGRRTVETAMAEIAAMGARLSA |
Ga0081455_109742351 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGKIVFAGAMSHVLDPDYYQRACGDEGRQKTVACMAEIARMGERLSAARPDAL |
Ga0081540_10035601 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MGTIVFGGAMSHVLDPEYYQAACGDLGRRKVTEEMEA |
Ga0066656_107662772 | 3300006034 | Soil | MGKIVFAGAMSHVLDPDYYDAACGPVGRRKVEDVMEAIRQMGARLAARS |
Ga0075433_105394452 | 3300006852 | Populus Rhizosphere | MGKLVFAGAMSHVLDPDYYDKACGALGRKTVTECMAQIAQMGERFSATGADA |
Ga0075425_1008997102 | 3300006854 | Populus Rhizosphere | MGKLVFAGAMSHVLDPDYYDKACGALGRKTVTECMAQI |
Ga0079217_115669971 | 3300006876 | Agricultural Soil | MGKIVFAGAMSHVLDPEYYQAACGDVGRQKVTAAMEAIAHMGDRFVEQKADALI |
Ga0079215_114801202 | 3300006894 | Agricultural Soil | VFAAAMSHVLDPDYYEAACGAGGRRMVEACMTEIRAMGDRLSGWFPLL |
Ga0079215_115503211 | 3300006894 | Agricultural Soil | MGRIVFAGAMSHVLDPEYYDHACGQIGRRMVEEVMA* |
Ga0075426_106440191 | 3300006903 | Populus Rhizosphere | MGKIVFAGAMSHVLDPEYYDRACGARGRRTVTECMAQIAQMGER |
Ga0075426_115623691 | 3300006903 | Populus Rhizosphere | MGKLVFAGAMSHVLDPDYYDKACGALGRKTVTECMAQIAQMGER |
Ga0066710_1021872272 | 3300009012 | Grasslands Soil | MGKIVFAGAMSHVLDPEYYQRVCGDVGRQKTEEAMAAIAK |
Ga0066710_1038041572 | 3300009012 | Grasslands Soil | MGRIVFAAAMSHVLDPDYYERVCGAVGRRKTDEAM |
Ga0099829_111292923 | 3300009038 | Vadose Zone Soil | MGEIVFGGAMSHVLDPDYYQAACGDVGRQKVTEAMEAIARMG |
Ga0105106_104850711 | 3300009078 | Freshwater Sediment | MGRIVFAGAMSHVLDPDYYERACGALGRRMITDTMTAIAQMGARFSATKADA |
Ga0099828_109349392 | 3300009089 | Vadose Zone Soil | MGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIANMG |
Ga0099828_119475792 | 3300009089 | Vadose Zone Soil | MGKIVFAGAMSHVLDPDYYERACGAVGRQTVEAVMAEIAKMG |
Ga0099827_101036303 | 3300009090 | Vadose Zone Soil | MGKIVFAGAMSHVLDPDYYERACGAVGRRTVEAVMAEIAKMGERFSA |
Ga0114129_107757104 | 3300009147 | Populus Rhizosphere | MGRIVFAGAMSHVLDPDYYDRACGAQGRRMITETMA |
Ga0105092_108668691 | 3300009157 | Freshwater Sediment | VGRIVFAGAMSHVLDPDYYQAAGGMSGRRMVEACMVEIRKLGDT |
Ga0075423_113766711 | 3300009162 | Populus Rhizosphere | MGRIVFAAAMSHVLDPDYYDRVCGAAGRRKTEEAMAAIA |
Ga0105237_122375111 | 3300009545 | Corn Rhizosphere | MGRIVFGGAMSHVLDPDYYERACGALGRQTVVAVMAEIARMGERLSARQPDARIV |
Ga0105249_112229032 | 3300009553 | Switchgrass Rhizosphere | MGQIVFAGAMSHVLDPDYYDRACGAAGRQKVTECMTEIARMGERLTAARPDAL |
Ga0126374_100030056 | 3300009792 | Tropical Forest Soil | MSHVLDPEYYQAACGDLGRQKVTEAMEAIARMGDRLVERKPDALIVV |
Ga0105063_10212912 | 3300009804 | Groundwater Sand | MGQIVFAAAMSHVLDPDYYQAACGVAGRRMVEACMAEVRKLGD |
Ga0105088_10365541 | 3300009810 | Groundwater Sand | VGQIVFAAAMSHVLDPDYYQAACGPAGRRTVEACMAEVRKLGDTFLRRRPDALI |
Ga0126382_112802911 | 3300010047 | Tropical Forest Soil | MGTIVFGGAMSHVLDPEYYQAACGDLGRQMVTEAMEAIARMGDRFVARKPDAL |
Ga0134084_100060871 | 3300010322 | Grasslands Soil | MGKIVFAAAMSHVLDPDYYQAACGLSGRRKVEACMAEIGKLGDTLLAHRP |
Ga0134065_100245061 | 3300010326 | Grasslands Soil | MGKIVFAAAMSHVLDPDYYQAACGLSGRRKVEACMAEIEKL |
Ga0134071_102126091 | 3300010336 | Grasslands Soil | MGRIVFAGAMSHVLDPDYYERACGSVGRQKVEAAMAEIARM |
Ga0126376_108326201 | 3300010359 | Tropical Forest Soil | MGKIVFAGAMSHVLDPDYYDRACGALGRRTVSECMAQIAHMGERFS |
Ga0126378_109704773 | 3300010361 | Tropical Forest Soil | MGTIVFGGAMSHVLDPEYYQAACGDLGRQMVTEAMEAIARMGDRFVERKPDALIVVA |
Ga0126378_121441211 | 3300010361 | Tropical Forest Soil | MGKIVFGGAMSHVLDPEYYQAACGDLGRRKVTEAMEAIARMGDRFV |
Ga0126377_113057273 | 3300010362 | Tropical Forest Soil | MGQIAFGGAMSHVLDPEYYQAACGDLGRQKVTEAMEAIARMGDRFVERKPDALIVV |
Ga0126379_111824211 | 3300010366 | Tropical Forest Soil | MGKIVFGGAMSHVLDPEYYQAACGDLGRRKVTEAMEAIARMGDRFVERK |
Ga0126381_1008547793 | 3300010376 | Tropical Forest Soil | MGKIVFAGAMSHVLDPDYYQRACGALGRRTVEECMREIAAMG |
Ga0126381_1037682692 | 3300010376 | Tropical Forest Soil | MGKIVFAGAMSHVLDPDYYQRACGDEGRQKVTACMTEIARMGERFTAT |
Ga0126383_130011541 | 3300010398 | Tropical Forest Soil | MGRIVFASAMSHVLDPDYYDHACGAVGRRMVEEVMREIRAMGERC |
Ga0126383_134843612 | 3300010398 | Tropical Forest Soil | MGQIVFGGAMSHVLDPEYYQAASGDLGRRKVTEAMEAIARMGDRFVERKP |
Ga0134127_135556241 | 3300010399 | Terrestrial Soil | MGKLVFAGAMSHVLDPDYYDRACGALGRKTVTECMAQIAQMGERF |
Ga0134122_125080881 | 3300010400 | Terrestrial Soil | MGKIVFAGAMSHVLDPDYYQRACGDEGRQKVTACM |
Ga0137392_110470191 | 3300011269 | Vadose Zone Soil | MGKIVFAGAMSHVLDPDYYERACGAVGRQTVEAVMAEIAKMGERFS |
Ga0137458_12612091 | 3300011436 | Soil | MGRIVFAGAMSHVLDPEYYQRVCGDEGRKKTEEAMAAIAAMGERFSAT |
Ga0137445_10866701 | 3300012035 | Soil | MGQIVFAGAMSHVLNPDYYDRACGAAGRQKVTECM |
Ga0137389_109600701 | 3300012096 | Vadose Zone Soil | MGKIVFAGAMSHVLDPDYYERACGAVGRQTVEAVMAEIAKMGE |
Ga0137365_109852542 | 3300012201 | Vadose Zone Soil | MGKIVFAGAMSHVLDPDYYERACGAVGRRTVEAVMAEIAKMGERFSAKK |
Ga0137362_108298832 | 3300012205 | Vadose Zone Soil | MGKIVFAGAMSHVLDPDYYERACGAFGRQTVEAVMAEI |
Ga0137366_110011652 | 3300012354 | Vadose Zone Soil | MGRIVFGGAMSHVLDPDYYERACGSVGRQKVEAAMAE |
Ga0137390_112842981 | 3300012363 | Vadose Zone Soil | MGRIVFAGAMSHVLDPEYYDRACGAVGRQTVEAVMA |
Ga0137397_100970131 | 3300012685 | Vadose Zone Soil | MGKIIFAGAMSHVLDPDYYQRACGDEGRRKTVECMTEIARMGER |
Ga0137419_101624251 | 3300012925 | Vadose Zone Soil | MAVKRSKETAMGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIAN |
Ga0137404_112026382 | 3300012929 | Vadose Zone Soil | MGKMVFAGAMSHVLDPDYYDAACGPVGRRKVEDVMEAIRQMGARLAARSPD |
Ga0137410_102185861 | 3300012944 | Vadose Zone Soil | MGKIVFGGAMSHVLDPEYYQAACGDVGRQKVIEAMDAIAGMGDRLV |
Ga0164303_106867911 | 3300012957 | Soil | MGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCITEIARMGE |
Ga0134081_103708072 | 3300014150 | Grasslands Soil | MGKIVFAGAMSHVLDPEYYQRVCGDVGRQKTEEAMAAIAAMGERFSATKA |
Ga0134075_103793681 | 3300014154 | Grasslands Soil | MGRIVFAGAMSHVLDPDYYERACGSVGRQKVEAAMAEIARMGERCSA |
Ga0134078_100923231 | 3300014157 | Grasslands Soil | MGKIVFAAAMSHVLDPDYYQAACGLSGRRKVEACMAEIEKLGDSFLARRP |
Ga0134078_106152401 | 3300014157 | Grasslands Soil | MGKIVFAGAMSHVLDPEYYDRACGAVGRQTVEAVMAEIARMGE |
Ga0075352_10380254 | 3300014324 | Natural And Restored Wetlands | MGKIVFAGAMSHVLDPDYYQRACGDEGRRKTVECMTEI |
Ga0137409_111462712 | 3300015245 | Vadose Zone Soil | MGKIVFAGAMSHVLDPDYYQRACGDDGRQKVTACMAEIA |
Ga0137403_107862272 | 3300015264 | Vadose Zone Soil | MGKIVFAGAMSHVLDPEYYDRACGAVGRQTVEAVMAEIA |
Ga0134072_102488502 | 3300015357 | Grasslands Soil | MGKIVFAGAMSHVLDPDYYDAACGPVGRRKVEDVMEAIRQ |
Ga0134085_102250522 | 3300015359 | Grasslands Soil | MGKIVFGGAMSHVLDPEYYQAACGDIGRQKVVAAMDAIASMGDRFV* |
Ga0134085_103155121 | 3300015359 | Grasslands Soil | MGRIVFAAAMSHVLDPDYYQAACGLTGRRKVEACMAEI |
Ga0187777_102375252 | 3300017974 | Tropical Peatland | MGEIVFAGAMSHVLDPDYYERACGALGRRTVQECMAEIGRMGDRLTARRVDA |
Ga0184634_103628612 | 3300018031 | Groundwater Sediment | MGKIVFGGAMSHVLDPEYYQAACGDVGRQKVMAAMDAIAKMGDRFV |
Ga0187773_111264062 | 3300018064 | Tropical Peatland | MGQIVFAGAMSHVLDPEYYERACGAAGRRAVEQCMA |
Ga0184632_100949653 | 3300018075 | Groundwater Sediment | MGKIVFAGAMSHVLDPDYYQRACGDDGRKKVTACMAEIARMGERF |
Ga0184609_101270971 | 3300018076 | Groundwater Sediment | MGKIVFAGAMSHVLDPDYYQRACGDDGRKKVTACMAEIA |
Ga0184633_101294371 | 3300018077 | Groundwater Sediment | MGRLVFAGAMSHVLDPDYYDRACGALGRQKVVAAMAEIARM |
Ga0066655_104106061 | 3300018431 | Grasslands Soil | MGKIVFAAAMSHVLDPDYYQAACGLTGRRKVEACMAEIEKLGETFLAR |
Ga0066655_109968911 | 3300018431 | Grasslands Soil | MGKIVFAGAMSHVLDPEYYQAACGDVGRQKVVAAMDAIASMGDRFVETKAEGLIVVA |
Ga0184642_10578861 | 3300019279 | Groundwater Sediment | MGRLVFAGAMSHVLDPDYYQRACGDDGRQKVTACMAEIARMGER |
Ga0193735_11577702 | 3300020006 | Soil | MGQIVFAGAMSHVLDPDYYERACGAAGRQKVTECMA |
Ga0193721_11369932 | 3300020018 | Soil | MGRLVFAGAMSHVLDPDYYDRACGAVGRQKVVAAMAEIARM |
Ga0194112_100449906 | 3300020109 | Freshwater Lake | MGTIVFAGAMSHVLDPDYYDRACGAIGRRMITETMAEIAQMGERLSSAK |
Ga0212128_100820041 | 3300022563 | Thermal Springs | MGRIVFAAAMSHVLDPDYYEAACGLSGRRKVEACMAEIRR |
Ga0212128_100972961 | 3300022563 | Thermal Springs | VGRLVFAGAMSHVLDPDYYDRACGAVGRQKVTDAMAAIA |
Ga0209399_101443983 | 3300025157 | Thermal Springs | VGRLVFAGAMSHVLDPDYYDRACGAVGRQKVTDAMAQ |
Ga0207685_103872781 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCMTEIARMGERFSATR |
Ga0207646_111496091 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCMTEIARMGERFS |
Ga0207681_116574441 | 3300025923 | Switchgrass Rhizosphere | MGQIVFAGAMSHVLDPDYYDRACGAAGRQKVTECMTEIARMGERLTAARPDA |
Ga0207690_107352281 | 3300025932 | Corn Rhizosphere | MGKLVFAGAMSHVLDPDYYDRACGALGRKTVTECM |
Ga0208418_10172212 | 3300026018 | Natural And Restored Wetlands | MGKIVFAGAMSHVLDPDYYQRACGDEGRRKTVECMT |
Ga0207708_108236672 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRIVFAGAMSHVLDPDYYDHACGPVGRRMVEEVMREIRAMGDR |
Ga0207708_114831651 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MGRIVFGGAMSHVLDPDYYERACGALGRQTVVAVMAEIARMGERLSARQPD |
Ga0209238_12250991 | 3300026301 | Grasslands Soil | MGRIVFAAAMSHVLDPDYYERVCGAVGRRKTDEAMAAIAAMGERFSAIGAD |
Ga0209468_11963252 | 3300026306 | Soil | MGKIVFAAAMSHVLDPDYYQAACGLTGRRKVEACMAEIEKLGETF |
Ga0209473_11053321 | 3300026330 | Soil | MGRIVFAAAMSHVLDPDYYERVCGAVGRRKTDEAMVA |
Ga0257169_10777142 | 3300026469 | Soil | MGEIVFGGAMSHVLDPDYYQAACGDVGRQKVTEAMEAIAGMGDRFVERRPD |
Ga0257177_10380162 | 3300026480 | Soil | MGKIVFAGAMSHVLDPDYYQRACGDDGRQKVTACMAEIARMGERFT |
Ga0257165_10650832 | 3300026507 | Soil | MGKIVFAGAMSHVLDPDYYQRACGDEGRLMVTDCMTEIAR |
Ga0257168_10112083 | 3300026514 | Soil | MGKIVFAGAMSHVLDPDYYQRACGDEGRLMVTDCMTEIARMGE |
Ga0256867_101035503 | 3300026535 | Soil | MGKIVFAGAMSHVLDPDYYQRACGDDGRRKVTACMTEIARM |
Ga0209886_10693232 | 3300027273 | Groundwater Sand | MGQIVFAAAMSHVLDPDYYQAACGLVGRRTVEACMAEVRKLGDTLLSRRPDALI |
Ga0209846_10264952 | 3300027277 | Groundwater Sand | VGQIVFAAAMSHVLDPDYYQAACGLAGRRTVEACMAEVRK |
Ga0209845_10400032 | 3300027324 | Groundwater Sand | MGKLVFAGAMSHVLDPDYYQRACGAEGRHKVTLCMSEIARMGERLQ |
Ga0209466_11194721 | 3300027646 | Tropical Forest Soil | MGKIVFAGAMSHVLDPEYYDHACGAVGRQKVEAAMVEIARMGERFSATKA |
Ga0208981_11142761 | 3300027669 | Forest Soil | MGKIVFAGAMSHVLDPEYYQAACGDVGRQKVVAAMDA |
Ga0209689_14065992 | 3300027748 | Soil | MGKIVFAAAMSHVLDPDHYQAACGLSGRRKVEACMAEIEKLG |
Ga0209177_100126693 | 3300027775 | Agricultural Soil | MGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTECMTEIARMGE |
Ga0209465_100674991 | 3300027874 | Tropical Forest Soil | MGKIVFGGAMSHVLDPEYYQAACGDLGRRKVTEAMEAIARMGDRFVERKPD |
Ga0209481_105034452 | 3300027880 | Populus Rhizosphere | MGRIVFGGAMSHVLDPDYYDRACGALGRQSVLAAMAEIG |
Ga0209885_10068361 | 3300027950 | Groundwater Sand | MGKLVFAGAMSHVLDPDYYDHACGAVGRRMVEEVMAEIRA |
Ga0307504_103403091 | 3300028792 | Soil | MGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCMAEIAR |
Ga0307302_103134542 | 3300028814 | Soil | MGQIVFAGAMSHVLDPDYYDRACGAAGRQKVTECMAEIARMGERLTAARPDAL |
Ga0307278_102746522 | 3300028878 | Soil | MGKIVFAGAMSHVLDPDYYQRACGDDGRQKVTACMAEIARMGERF |
Ga0247827_102336491 | 3300028889 | Soil | MGKIVFAGAMSHVLDPDYYQRACGDEGRRKTVECM |
Ga0299907_100323206 | 3300030006 | Soil | MGRIVFAGAMSHVLDADYYDQACGDLGRRSVLAAMAEIARMGE |
Ga0307505_101474053 | 3300031455 | Soil | MGKIVFAGAMSHVLDPDYYQRACGDDGRRKTVECMTEIAR |
Ga0318496_101587561 | 3300031713 | Soil | MGQIAFGGAMSHVLDPEYYQAACGDLGRQKVTEAM |
Ga0307468_1009829683 | 3300031740 | Hardwood Forest Soil | MGEIVFGGAMSHVLDPDYYQAACGDLGRQKVVEAMDAIGKMGDRFVERKP |
Ga0307468_1020154381 | 3300031740 | Hardwood Forest Soil | MGRIVFAGAMSHVLDPDYYDRACGAVGRQTVVAVMAEIARMGE |
Ga0318508_10370071 | 3300031780 | Soil | MGQIAFGGAMSHVLDPEYYQAACGDLGRQKVTEAMEAIARMGDRLVERKPD |
Ga0318523_100169395 | 3300031798 | Soil | MGQIAFGGAMSHVLDPEYYQAACGDLGRQKVTEAMEAIARMGDRLVERKPDALIV |
Ga0307473_100692921 | 3300031820 | Hardwood Forest Soil | MGKIVFAGAMSHVLDPDYYQRACGDEGRRMVTDCM |
Ga0307471_1028408592 | 3300032180 | Hardwood Forest Soil | MGRIVFAGAMSHVLDPDYYDHACGAVGRRMVEEVMAEIRVMGD |
Ga0335085_108170071 | 3300032770 | Soil | MGRIVFAGAMSHVLDPDYYERACGAVGRQAVVACMTEIGRMGERLS |
Ga0326726_102676992 | 3300033433 | Peat Soil | MGKIVFGGAMSHVLDPEYYQAACGDLGRQKVIEAMDAIAGMGDRL |
Ga0326730_11003091 | 3300033500 | Peat Soil | MGKIVFGGAMSHVLDPEYYQAACGDLGRQKVIEAMDAIAGMGDRLVERKPDALIVV |
⦗Top⦘ |