NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F048549

Metagenome / Metatranscriptome Family F048549

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048549
Family Type Metagenome / Metatranscriptome
Number of Sequences 148
Average Sequence Length 39 residues
Representative Sequence MTVTVTPRPPVATAAHAFTLPTVRELPPVARPGTFDSTW
Number of Associated Samples 85
Number of Associated Scaffolds 148

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 55.41 %
% of genes near scaffold ends (potentially truncated) 29.05 %
% of genes from short scaffolds (< 2000 bps) 87.16 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.054 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(32.432 % of family members)
Environment Ontology (ENVO) Unclassified
(40.541 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(60.135 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 4.48%    β-sheet: 0.00%    Coil/Unstructured: 95.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 148 Family Scaffolds
PF01035DNA_binding_1 29.73
PF00311PEPcase 22.30
PF00171Aldedh 5.41
PF03069FmdA_AmdA 2.70
PF00903Glyoxalase 1.35
PF00027cNMP_binding 1.35
PF08031BBE 1.35
PF01590GAF 1.35
PF02417Chromate_transp 1.35
PF13185GAF_2 1.35
PF13191AAA_16 0.68
PF00196GerE 0.68
PF00353HemolysinCabind 0.68
PF13602ADH_zinc_N_2 0.68
PF02870Methyltransf_1N 0.68
PF00890FAD_binding_2 0.68
PF03992ABM 0.68
PF12706Lactamase_B_2 0.68
PF00005ABC_tran 0.68
PF00403HMA 0.68
PF03372Exo_endo_phos 0.68
PF00248Aldo_ket_red 0.68
PF07995GSDH 0.68
PF04234CopC 0.68
PF13384HTH_23 0.68
PF16655PhoD_N 0.68
PF00480ROK 0.68
PF11139SfLAP 0.68
PF13649Methyltransf_25 0.68
PF12697Abhydrolase_6 0.68
PF07690MFS_1 0.68
PF08734GYD 0.68
PF01370Epimerase 0.68
PF13411MerR_1 0.68
PF13473Cupredoxin_1 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 148 Family Scaffolds
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 30.41
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 29.73
COG2352Phosphoenolpyruvate carboxylaseEnergy production and conversion [C] 22.30
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 5.41
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 5.41
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 5.41
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 2.70
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 1.35
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.35
COG2059Chromate transport protein ChrAInorganic ion transport and metabolism [P] 1.35
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.68
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.68
COG2372Copper-binding protein CopC (methionine-rich)Inorganic ion transport and metabolism [P] 0.68
COG2608Copper chaperone CopZInorganic ion transport and metabolism [P] 0.68
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.05 %
UnclassifiedrootN/A20.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002568|C688J35102_119175051All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium Pan216649Open in IMG/M
3300002568|C688J35102_119349964Not Available678Open in IMG/M
3300002568|C688J35102_120123629All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300003992|Ga0055470_10132753All Organisms → cellular organisms → Bacteria → Terrabacteria group641Open in IMG/M
3300004081|Ga0063454_101979851Not Available515Open in IMG/M
3300004463|Ga0063356_105835029Not Available528Open in IMG/M
3300005093|Ga0062594_100254635All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300005356|Ga0070674_101265405All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae657Open in IMG/M
3300005367|Ga0070667_101491613Not Available635Open in IMG/M
3300005459|Ga0068867_101528971All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia622Open in IMG/M
3300005530|Ga0070679_100801802All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300005543|Ga0070672_102034547All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005547|Ga0070693_101485621All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia529Open in IMG/M
3300005563|Ga0068855_100863636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300005564|Ga0070664_102161892Not Available528Open in IMG/M
3300005615|Ga0070702_100401271All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300005840|Ga0068870_10393674Not Available900Open in IMG/M
3300005842|Ga0068858_100197064All Organisms → cellular organisms → Bacteria → Terrabacteria group1904Open in IMG/M
3300005937|Ga0081455_10242974Not Available1322Open in IMG/M
3300005937|Ga0081455_10291867All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300005981|Ga0081538_10000242All Organisms → cellular organisms → Bacteria61803Open in IMG/M
3300005981|Ga0081538_10034267All Organisms → cellular organisms → Bacteria3359Open in IMG/M
3300005981|Ga0081538_10073825All Organisms → cellular organisms → Bacteria1861Open in IMG/M
3300005981|Ga0081538_10112138All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300005981|Ga0081538_10152607All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300005981|Ga0081538_10175215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria928Open in IMG/M
3300005981|Ga0081538_10176639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces921Open in IMG/M
3300005985|Ga0081539_10019896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli4571Open in IMG/M
3300005985|Ga0081539_10355540Not Available615Open in IMG/M
3300006046|Ga0066652_100016105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli4997Open in IMG/M
3300006046|Ga0066652_100247832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1558Open in IMG/M
3300006058|Ga0075432_10260219All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300006169|Ga0082029_1782690All Organisms → cellular organisms → Bacteria2258Open in IMG/M
3300006196|Ga0075422_10394051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300006844|Ga0075428_100092790All Organisms → cellular organisms → Bacteria3291Open in IMG/M
3300006844|Ga0075428_100179597All Organisms → cellular organisms → Bacteria → Terrabacteria group2291Open in IMG/M
3300006844|Ga0075428_102254274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300006845|Ga0075421_102190600All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300006880|Ga0075429_101554948Not Available575Open in IMG/M
3300006969|Ga0075419_11178838Not Available564Open in IMG/M
3300007004|Ga0079218_10231554All Organisms → cellular organisms → Bacteria1440Open in IMG/M
3300007004|Ga0079218_11288443All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300007004|Ga0079218_12093383All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300009094|Ga0111539_10282701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1931Open in IMG/M
3300009094|Ga0111539_10448199All Organisms → cellular organisms → Bacteria1503Open in IMG/M
3300009094|Ga0111539_10937340All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300009094|Ga0111539_11016630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria964Open in IMG/M
3300009094|Ga0111539_11255952All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300009100|Ga0075418_10307837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1689Open in IMG/M
3300009100|Ga0075418_13159294Not Available502Open in IMG/M
3300009147|Ga0114129_11649344All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300009156|Ga0111538_10889778All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300009157|Ga0105092_10213878All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300009157|Ga0105092_10746183Not Available571Open in IMG/M
3300009162|Ga0075423_13149970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07505Open in IMG/M
3300009551|Ga0105238_10265061All Organisms → cellular organisms → Bacteria1698Open in IMG/M
3300009553|Ga0105249_10936546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria934Open in IMG/M
3300010037|Ga0126304_10943814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Actinomarinicola → Actinomarinicola tropica587Open in IMG/M
3300010038|Ga0126315_10147668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1390Open in IMG/M
3300010040|Ga0126308_10245942All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300010042|Ga0126314_10572321Not Available823Open in IMG/M
3300010042|Ga0126314_10812662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces688Open in IMG/M
3300010042|Ga0126314_11372560All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia531Open in IMG/M
3300010044|Ga0126310_11687263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07526Open in IMG/M
3300010045|Ga0126311_11425225All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300010371|Ga0134125_10492600All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300010396|Ga0134126_11477027All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300010399|Ga0134127_11344378All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300010401|Ga0134121_12604308Not Available549Open in IMG/M
3300010403|Ga0134123_10551605Not Available1097Open in IMG/M
3300010403|Ga0134123_11218887All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300010403|Ga0134123_12456350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300012469|Ga0150984_100621498All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012469|Ga0150984_110391618All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300014311|Ga0075322_1170536All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300015374|Ga0132255_104311780All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300017965|Ga0190266_11015308All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300018061|Ga0184619_10212786Not Available889Open in IMG/M
3300018422|Ga0190265_10043334All Organisms → cellular organisms → Bacteria3861Open in IMG/M
3300018422|Ga0190265_10077332All Organisms → cellular organisms → Bacteria3031Open in IMG/M
3300018422|Ga0190265_10097990All Organisms → cellular organisms → Bacteria2738Open in IMG/M
3300018422|Ga0190265_10113061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter2575Open in IMG/M
3300018422|Ga0190265_10129988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2424Open in IMG/M
3300018422|Ga0190265_10203633All Organisms → cellular organisms → Bacteria1992Open in IMG/M
3300018422|Ga0190265_10330070All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300018422|Ga0190265_10413970All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300018422|Ga0190265_10923119All Organisms → cellular organisms → Bacteria → Terrabacteria group995Open in IMG/M
3300018422|Ga0190265_11053976Not Available934Open in IMG/M
3300018422|Ga0190265_11147996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria896Open in IMG/M
3300018422|Ga0190265_11574257All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300018422|Ga0190265_11659927All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300018422|Ga0190265_11664098Not Available749Open in IMG/M
3300018422|Ga0190265_11839926Not Available713Open in IMG/M
3300018422|Ga0190265_12541552All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300018422|Ga0190265_12680374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300018422|Ga0190265_13658342Not Available513Open in IMG/M
3300018422|Ga0190265_13722379Not Available508Open in IMG/M
3300018429|Ga0190272_10510886Not Available1024Open in IMG/M
3300018429|Ga0190272_11367075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis709Open in IMG/M
3300018429|Ga0190272_11605528All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300018429|Ga0190272_11935876All Organisms → cellular organisms → Bacteria → Terrabacteria group621Open in IMG/M
3300018432|Ga0190275_10133634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2260Open in IMG/M
3300018432|Ga0190275_10668158All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300018465|Ga0190269_11402847Not Available567Open in IMG/M
3300018466|Ga0190268_10031517All Organisms → cellular organisms → Bacteria1886Open in IMG/M
3300018466|Ga0190268_10228349All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300018469|Ga0190270_11659069Not Available692Open in IMG/M
3300018469|Ga0190270_13441597Not Available502Open in IMG/M
3300018476|Ga0190274_12225108All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300018481|Ga0190271_10078023All Organisms → cellular organisms → Bacteria2958Open in IMG/M
3300018481|Ga0190271_10274315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1734Open in IMG/M
3300019255|Ga0184643_1430085All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300019279|Ga0184642_1425344Not Available520Open in IMG/M
3300019377|Ga0190264_10538606All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300019377|Ga0190264_12037375All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300019377|Ga0190264_12220798Not Available512Open in IMG/M
3300022756|Ga0222622_10263409All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300022756|Ga0222622_10359296Not Available1017Open in IMG/M
3300024430|Ga0196962_10015219All Organisms → cellular organisms → Bacteria2301Open in IMG/M
3300024430|Ga0196962_10046198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 2047081314Open in IMG/M
3300024430|Ga0196962_10059407All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300024430|Ga0196962_10233531All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300025935|Ga0207709_10162691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1558Open in IMG/M
3300025937|Ga0207669_11016818All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae697Open in IMG/M
3300027636|Ga0214469_1056793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1206Open in IMG/M
3300027907|Ga0207428_10070450All Organisms → cellular organisms → Bacteria2748Open in IMG/M
3300027907|Ga0207428_10155741All Organisms → cellular organisms → Bacteria1738Open in IMG/M
3300027907|Ga0207428_11231219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300027909|Ga0209382_11861960All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300028705|Ga0307276_10153194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300028719|Ga0307301_10092436All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300028744|Ga0307318_10050107All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300028784|Ga0307282_10427364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300028796|Ga0307287_10330559All Organisms → cellular organisms → Bacteria → Terrabacteria group575Open in IMG/M
3300028814|Ga0307302_10362741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces715Open in IMG/M
3300028814|Ga0307302_10571601Not Available562Open in IMG/M
3300028876|Ga0307286_10290003Not Available604Open in IMG/M
3300030006|Ga0299907_10260754All Organisms → cellular organisms → Bacteria1422Open in IMG/M
3300030619|Ga0268386_10073863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2663Open in IMG/M
3300030785|Ga0102757_11106154All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300031152|Ga0307501_10281193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium506Open in IMG/M
3300031228|Ga0299914_10425013All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300031901|Ga0307406_10061976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2418Open in IMG/M
3300031901|Ga0307406_10244563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1348Open in IMG/M
3300031901|Ga0307406_10685585All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300031901|Ga0307406_11345199Not Available625Open in IMG/M
3300032002|Ga0307416_100167336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2041Open in IMG/M
3300032126|Ga0307415_100673757All Organisms → cellular organisms → Bacteria930Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil32.43%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere14.86%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.41%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.73%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere4.73%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.05%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.70%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil2.70%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.70%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.03%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.35%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.35%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.35%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.35%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.35%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.68%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.68%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.68%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024430Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027636Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeqEnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300030785Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J35102_11917505123300002568SoilMTIVVTPRPPISAAAHVFSMPVVRELPPVQRPGMFDTTW*
C688J35102_11934996423300002568SoilMTLTVTPRPPVASTAHAFSLPTVREIPPVQRPGTFSSIW*
C688J35102_12012362923300002568SoilLEMPRRWSIRAMTIVVTPRPPIAAAHAYSTPIVREIPPVQRPGMFDATW*
Ga0055470_1013275313300003992Natural And Restored WetlandsVTVTVTPRPPVASTAHAFSLPVAREIPPVVRPGMFSSTW*
Ga0063454_10197985113300004081SoilAGAKGLLPMTLTVTPRPPVASTAHAFSLPTVREIPPVQRPGTFSSIW*
Ga0063356_10583502913300004463Arabidopsis Thaliana RhizosphereFAVTVTITSRVPVATAHVYTRPTVRELPPLPRPGTFDSTW*
Ga0062594_10025463533300005093SoilLEMSHRWSIRAMTIVVTPRPPIAAAHVYSTPIVREIPPVQRPGMFDATW*
Ga0070674_10126540523300005356Miscanthus RhizosphereTAHPHPTMSPLPTPRPPAHRHVYVAAVVRELPPVSRPGQFASTW*
Ga0070667_10149161313300005367Switchgrass RhizosphereLEMSHRWSIRTMTIIVTPRPPIAAAHVYSTPIVREIPPVQRPGMFDATW*
Ga0068867_10152897123300005459Miscanthus RhizosphereMTIVVTPRRPIAAAEHVFTTPVVRELPPVQRPGMYDSTW*
Ga0070679_10080180213300005530Corn RhizosphereMTIVVTPRPPIAAAAHAFSTPVVRELPPVQRPGMFDTTW*
Ga0070672_10203454723300005543Miscanthus RhizosphereMTIVVTPRPPIAAAHVYSTPIVREIPPVQRPGMFDATW*
Ga0070693_10148562113300005547Corn, Switchgrass And Miscanthus RhizosphereMTIVVTPRPPIAAAAHVFTTPVVRELPPVQRPGMYDSTW*
Ga0068855_10086363613300005563Corn RhizosphereAAAKGLPPVTVTVTPRPPVASTAHAFSLPVVRELPPVVRPGTFSSTW*
Ga0070664_10216189223300005564Corn RhizosphereMSPLPTPRPPAHRHVYVAAVVRELPPVSRPGQFASTW*
Ga0070702_10040127133300005615Corn, Switchgrass And Miscanthus RhizosphereAMTIVVTPRPPIAAAHVYSTPIVREIPPVQRPGMFDATW*
Ga0068870_1039367433300005840Miscanthus RhizosphereMTVVAPRPPIAAATHVFSTPVVRELPPVQRPGMFDSTW*
Ga0068858_10019706433300005842Switchgrass RhizosphereVTVTVTPRPPVASTAHAFSLPVVRELPPVVRPGTFSSTW*
Ga0081455_1024297433300005937Tabebuia Heterophylla RhizosphereVTVTVTPRRPAATAHAFSSPTVREIPPVQRPGTFDSTW*
Ga0081455_1029186713300005937Tabebuia Heterophylla RhizosphereMSPIVTPRPPVSAQHAFTTPVVRELPPVYRPGTFDSTW*
Ga0081538_10000242493300005981Tabebuia Heterophylla RhizosphereMSMTVTVTPRPPVATAAHAFTLPTVRELPPVARPGTFDSTW*
Ga0081538_1003426743300005981Tabebuia Heterophylla RhizosphereMTVVAPRPPIAAATHVFSTPIVRELPPVQRPGMFDSTW*
Ga0081538_1007382523300005981Tabebuia Heterophylla RhizosphereMTVTVTPRPPVATAAHAFTLPTVRELPPVARPGTFDSTW*
Ga0081538_1011213813300005981Tabebuia Heterophylla RhizosphereARASIRVVTVTVTPRPPAAAAHAFSLPLVREIPPVQRPGTFDSTW*
Ga0081538_1015260723300005981Tabebuia Heterophylla RhizosphereMSMTVTITPRPPVATAGHAFTLPVVRELPPVARPGTFDSTW*
Ga0081538_1017521543300005981Tabebuia Heterophylla RhizosphereVTVTVTPRRPAAAAHAFSLPTVREIPPVPRPGTFASTW*
Ga0081538_1017663913300005981Tabebuia Heterophylla RhizosphereVTATVTPRPPVATTAHAFQIPTVREIPPVPRPGTFSSIW*
Ga0081539_1001989653300005985Tabebuia Heterophylla RhizosphereMTIVVTPRPPAAAHAFSTPVVRELPPVQRPGMFDATW*
Ga0081539_1035554023300005985Tabebuia Heterophylla RhizosphereMTVTITPRPPVASAAHAFSLPTVREIPPVQRPGTFSSTW*
Ga0066652_10001610563300006046SoilMTIVVTPRPPISAAAHVFSMPVVRELPPVRRPGMFDTTW*
Ga0066652_10024783223300006046SoilVTVTVTPRPPVASTAHAFSLPTVREIPPVVRPGTFSSSW*
Ga0075432_1026021923300006058Populus RhizosphereAAGAAAEAMTVVVTPRPPIAAAHAFTTPVVREMPPVHRPGTFDSTW*
Ga0082029_178269023300006169Termite NestMSPTVTPRPLVSAQHAYTTPVVRELPPVYRPGTFDSTW*
Ga0075422_1039405123300006196Populus RhizosphereVTVTVTPRRPAAAHAFSLPTVREIPPVQRPGAFDSTW*
Ga0075428_10009279023300006844Populus RhizosphereMTVVAPRPPIAAATHAFSTPVVRELPPVQRPGMFDSTW*
Ga0075428_10017959723300006844Populus RhizosphereVTVTVTPRRPAASSPRFFTLPSVRELPPVQRPGTYASTW*
Ga0075428_10225427423300006844Populus RhizosphereMNSVTVTVTPRRPAAAHAFSLPTVREIPPVQRPGAFDSTW*
Ga0075421_10219060023300006845Populus RhizosphereMSMTVTVTPRPPVATAHAFTLPVVRELPPVARPGTFDSTW*
Ga0075429_10155494833300006880Populus RhizosphereVTVTVTPRRPVATAHAFALPVVREIPPVQRPGTFSSTW*
Ga0075419_1117883823300006969Populus RhizosphereVTVTVTPRRPALAAHAFSSPTVREIPPVQRPGTFDSTW*
Ga0079218_1023155423300007004Agricultural SoilMTVTITPRPPVAAGHAFTLPVVRELPPVARPGTFDSTW*
Ga0079218_1128844333300007004Agricultural SoilEPAMTVTITPRPPASGAPHVFSTPTVRELPPVARPGTFAATW*
Ga0079218_1209338323300007004Agricultural SoilMTVTVTPRPPVRTAAHAFTLPTVRELPPVARPGTFASTW*
Ga0111539_1028270133300009094Populus RhizosphereVTVTVTPRNPAATARHAFSLPTVRELPPVARPGTFASTW*
Ga0111539_1044819923300009094Populus RhizosphereMSPIVTPRPPVATHAYTLPVVRELPPVSRPGTFDSTW*
Ga0111539_1093734013300009094Populus RhizosphereMTVVVTPRPPIAAAHAFTTPVVREMPPVHRPGTFDSTW*
Ga0111539_1101663013300009094Populus RhizosphereSIPAMNSVTVTVTPRRPAAAHAFSLPTVREIPPVQRPGAFDSTW*
Ga0111539_1125595223300009094Populus RhizosphereMTVTVTPRPPVATAGHAFTLPVVRELPPVARPGTFDSTW*
Ga0075418_1030783713300009100Populus RhizosphereMTVVVTPRPPIAAAHAFTTPVVREMPPVHRPGTFDST
Ga0075418_1315929413300009100Populus RhizosphereGLPVTVTVTPRRPALAAHAFSSPTVREIPPVQRPGTFDSTW*
Ga0114129_1164934423300009147Populus RhizosphereMTAPPRPRITAAPHAYTIPVVRELPPVQRPGMFDTTW*
Ga0111538_1088977823300009156Populus RhizosphereMTVTVTPRPPVATAGHAFTLPVVREMPPVARPGMFDSTW*
Ga0105092_1021387833300009157Freshwater SedimentSLRVTANERVPPMSPTVTPRPPVSAQHAFSTPVVRELPPVYRPGTFDSTW*
Ga0105092_1074618333300009157Freshwater SedimentVTVTITPRRPAAAAHAFSFPTVREIPPVQRPGMFDS
Ga0075423_1314997013300009162Populus RhizosphereMTIVVTPRPPIAAAHVYSTPIVREIPPVQRPGLFDSTW*
Ga0105238_1026506123300009551Corn RhizosphereMTIVVTPRPPIAAAHAYSTPIVREIPPVQRPGMFDATW*
Ga0105249_1093654633300009553Switchgrass RhizosphereAAKAAMTIVVTPRPPITAAAHAYSTPVVRELPPVQRPGMFDTTW*
Ga0126304_1094381413300010037Serpentine SoilVTITPRPPVATAHAYSLPVVREIPPVQRPGTFSATW*
Ga0126315_1014766843300010038Serpentine SoilMTVLAPRPPIAAATHSFSTPVVRELPPVQRPGMFDSTW*
Ga0126308_1024594213300010040Serpentine SoilRLPAGSLVLVTATVTPRPPVSTTAHAFQLPTVREIPPVPRPGMFSSTW*
Ga0126314_1057232113300010042Serpentine SoilVTVTPRRPAASSPRYFTVPTVRELPPVARPGTYASTW*
Ga0126314_1081266213300010042Serpentine SoilSCIVTVTVTPRPPVANTAHAFTLPNVREIPPVFRPGTFSSTW*
Ga0126314_1137256013300010042Serpentine SoilMTIVVTPRPPLAAATHVFSTPVVRELPPVPRPGTFDFTW*
Ga0126310_1168726323300010044Serpentine SoilMTVLAPRPPIAAAAHTFSIPVVRELPPVQRPGMFDSTW*
Ga0126311_1142522523300010045Serpentine SoilMTVLAPRPPIAAAAHTFSIPVVRELPPVQRPGTFDSTW*
Ga0134125_1049260033300010371Terrestrial SoilMTIVVTPRPPIAAAAHTFSTPVVRELPPVQRPGMFDTTW*
Ga0134126_1147702733300010396Terrestrial SoilVTPRPPIAAAHAFSTPVVRELPPVQRPGMFDTTW*
Ga0134127_1134437833300010399Terrestrial SoilMTIVVTPRPPIAAAAHVFTTPVVRELPPVQRPGMFDSTW*
Ga0134121_1260430823300010401Terrestrial SoilMTIVVTPRPPIAAAAHAFSTPVVRELPPVQRPGMFDSTW*
Ga0134123_1055160523300010403Terrestrial SoilTVTPRPPAAITAHAFSLPTVREIPPVPRPGTFSSAW*
Ga0134123_1121888733300010403Terrestrial SoilVVTPRPPIAAAHVYSTPIVREIPPVQRPGMFDATW*
Ga0134123_1245635023300010403Terrestrial SoilMTVVAPRPPIAAATHVFSTPVVRELPPVQRPGMFDST
Ga0150984_10062149823300012469Avena Fatua RhizosphereTVVAPRPPIAAATHTFSTPVVRELPPVQRPGMFDSTW*
Ga0150984_11039161813300012469Avena Fatua RhizosphereRHQPRPPIAAAHAYSTPIVREIPPVQRPGMFDATW*
Ga0075322_117053623300014311Natural And Restored WetlandsVTVTVTPRPPVASTAHAFSLPVAREIPPVVRPGMFS
Ga0132255_10431178023300015374Arabidopsis RhizosphereMTLVVTPRPPIAAAPAFTTPVVRELPPVNRPGMFDATW*
Ga0190266_1101530823300017965SoilKTMTIMVTPRPPIAAAAHVFTTPVVRELPPVQRPGMFDSTW
Ga0184619_1021278623300018061Groundwater SedimentVPVTVTPRRPSANASHAFGLPTVRELPSVARPGTFD
Ga0190265_1004333443300018422SoilVPVTVTPRRPAATAPHVYMLATVRELPPVARPGTFDSTW
Ga0190265_1007733243300018422SoilMTVVVTPRQPIAAASHVYTTPVVRELPPVQRPGTFSATW
Ga0190265_1009799033300018422SoilMSMTVTVTPRPPVRSAAHAFTLPTVRELPPVARPGTFDSTW
Ga0190265_1011306133300018422SoilMTVTITPRPPASGAPHVYSTATVRELPPVARPGTFAATW
Ga0190265_1012998843300018422SoilVTVTVTPRPPVATTAHAFSLPTVREIPPVYRPGTFASTW
Ga0190265_1020363323300018422SoilMTVTITPRPPAAGTTHMFSAPTVRELPPVARPGTFAATW
Ga0190265_1033007033300018422SoilMSPIVTSRPPMTAQHAYTTPVVRELPPVYRPGTFDSTW
Ga0190265_1041397033300018422SoilMTQMVTPRPPVQTSQHVFTLPTVREMPPVARPGTFDSTW
Ga0190265_1092311913300018422SoilVPVTVTPRRPAANAPHAFMLATVRELPPVTRPGTFDATW
Ga0190265_1105397613300018422SoilMTVVATPRPPAAASHTYTLPVVRELPPVARPGMFDATW
Ga0190265_1114799623300018422SoilVPVTVTPRRPAANAPHAFMLATVRELPPVARPGTFDATW
Ga0190265_1157425723300018422SoilVVTVTITPRVPVATAHVYTLPTVREIPPVQRPGTFDSTW
Ga0190265_1165992723300018422SoilMTVTTTPRPPVDAAGHAFTFPTVRELPPVSRPGTFDSTW
Ga0190265_1166409823300018422SoilMTVTVTPRPPIAAAAHVYTTPVVRELPPVQRPGTFASTW
Ga0190265_1183992623300018422SoilMSVTLTPRLPAPIVHAFSLPTVREIPPVTRPGTFDSTW
Ga0190265_1254155213300018422SoilAKDFVVTVTVTPRVPVATAHVYTIPTVREILPVQRPGTFDSTW
Ga0190265_1268037423300018422SoilMTVVTPRPPAASAPHAYSTPVVREMPPVQRPGTFAATW
Ga0190265_1365834213300018422SoilVTVTITPRMPVATAHAYTLPTVREIPPVQRPGTFDS
Ga0190265_1372237923300018422SoilFAVTVTVTPRMPVATAHAYSLPTVREIPPVQRPGTFASTW
Ga0190272_1051088623300018429SoilMTVTVTPRTPISAASHVFTTPVVREMPPVQRPGTYASTW
Ga0190272_1136707513300018429SoilMTVTVTPRPPVVTAHTFTLPTVRELPPVARPGTFDPTW
Ga0190272_1160552813300018429SoilMTVVITPRQPSAAASHVYTTPVVREMPPVYRPGTFDSTW
Ga0190272_1193587613300018429SoilATVPVTVTPRRPSANAPHAFMLPTVRELPPVARPGTFDATW
Ga0190275_1013363423300018432SoilMTLVAPPRPRTIQHVYSLPVVREVPPVARPGTFAAGW
Ga0190275_1066815813300018432SoilMTVTITPRPPAATAPHVYSTPTVRELPPVARPGTFASTW
Ga0190269_1140284713300018465SoilTVPVTITPRRPAANASHAFGLPTVRELPPVARPGTFDATW
Ga0190268_1003151723300018466SoilMTVTVTPRPPVTAAAHTFTFPTVRELPPVSRPGTFDSTW
Ga0190268_1022834923300018466SoilMSPIVTPRPPVSAQHAYSTPVVRELPPVYRPGTFDSTW
Ga0190270_1165906923300018469SoilMTVVITPRQPSAAASHVYTTPVVREMPPVNRPGTFDSTW
Ga0190270_1344159723300018469SoilMTITVTPRPPIAAAAHVYTTPVVRELPPVQRPGTFASTW
Ga0190274_1222510823300018476SoilMTVVAPRPPIAAATHVFSTPVVRELPPVQRPGMFDSTW
Ga0190271_1007802323300018481SoilMTVTITPRPPVAAAGHAFTLPVVRELPPVARPGTFDSTW
Ga0190271_1027431513300018481SoilVTVTVTPRNPAATARHGFTLPTVRELPPVSRPGTFSSTW
Ga0184643_143008513300019255Groundwater SedimentMTVLVTPRQPTAAASHVYTTPVVREMPPVYRPGMFDSTW
Ga0184642_142534423300019279Groundwater SedimentMTVVVTPRQPTAAASHVYTTPVVREMPPVYRPGMFDSTW
Ga0190264_1053860623300019377SoilMTVTVTPRPPVTAANHTFTFPTVRELPPVSRPGTFDSTW
Ga0190264_1203737523300019377SoilMPVTITPRPPASTAPHVYSTPTVRELPPVARPGTFAATW
Ga0190264_1222079823300019377SoilKDFAVTVTVTPRMPVATAHAYSLPTVREIPPVQRPGTFASTW
Ga0222622_1026340933300022756Groundwater SedimentMTIVVTPRPPISAAAHVFSTPVVRELPPVQRPGMFDTTW
Ga0222622_1035929613300022756Groundwater SedimentVTVTVTPRRPAAAAHAFSLPTVREIPPVQRPGTFDSIW
Ga0196962_1001521933300024430SoilMTVTVTPRPPVATAGHAFTLPVVRELPPVARPGMFDSTW
Ga0196962_1004619823300024430SoilMTVTVTPRPPVATAGHAFTLPVVRELPPVARPGTFDSTW
Ga0196962_1005940723300024430SoilMSPIVTPRPPASAAQHAFTTPVVRELPPVYRPGMFDSTW
Ga0196962_1023353123300024430SoilVTVTPRPPVRTAAHTFTLPTVRELPPVARPGTFDSTW
Ga0207709_1016269123300025935Miscanthus RhizosphereMTIVVTPRLSVAAAHVYSTPIVREIPPVQRPGMFDATW
Ga0207669_1101681813300025937Miscanthus RhizosphereTAHPHPTMSPLPTPRPPAHRHVYVAAVVRELPPVSRPGQFASTW
Ga0214469_105679333300027636SoilMTVTVTPRPPVRSAAHAFTLPTVRELPPVARPGTFDSTW
Ga0207428_1007045023300027907Populus RhizosphereMTVVAPRPPIAAATHAFSTPVVRELPPVQRPGMFDSTW
Ga0207428_1015574123300027907Populus RhizosphereMTVVVTPRPPIAAAHAFTTPVVREMPPVHRPGTFDSTW
Ga0207428_1123121913300027907Populus RhizosphereMSPIVTPRPPVATHAYTLPVVRELPPVSRPGTFDSTW
Ga0209382_1186196013300027909Populus RhizosphereMTIVVTPRPPIAAAAHAFSMPVVRELPPVQRPGLFDSTW
Ga0307276_1015319413300028705SoilMTIVVTPRPPIAAAAHAYSTPVVRELPPVQRPGMFDATW
Ga0307301_1009243623300028719SoilMTVVVPRPPIAAAAHAFSTPVVRELPPVQRPGMFDATW
Ga0307318_1005010723300028744SoilMSPTVTPRRPTSAASHAFTTPVVRELPPVRRPGMFDATW
Ga0307282_1042736423300028784SoilMTIVVTPRPPAAAHAYSTPVVRELPPVQRPGMFDATW
Ga0307287_1033055913300028796SoilMTVTVTPRPPVAAAHAFSLPVVREIPPVQRPSTFAA
Ga0307302_1036274123300028814SoilVTVTITPRRPAASAHAFALPVVREIPPVQRPGTFDATW
Ga0307302_1057160123300028814SoilMTVVVTPRQPTAAASHVYTTPVVREMPPVYRPGTFDSTW
Ga0307286_1029000333300028876SoilCDRRSLARHPAAAARADSFPAVREIPPVLRPGRFDSTW
Ga0299907_1026075423300030006SoilMTVTITPRPPAAGATHMFSAPTVRELPPVARPGTFAATW
Ga0268386_1007386353300030619SoilVTVTVTPRQPAASAPHFFSTPTVRELPPVRRPGTFASTW
Ga0102757_1110615413300030785SoilMTIVVTPRPPIASAHAFTTPVVRELPPVQRPGVFDSTW
Ga0307501_1028119313300031152SoilMTIVVTPRQPIAAAHAYSTPVVRELPPVYRPGMFDTTW
Ga0299914_1042501323300031228SoilMTVTVTPRPPVRTAAHAFTLPTVRELPPVARPGTFDSTW
Ga0307406_1006197623300031901RhizosphereVTVTVTPRRPAASSPRFFTLPTVRELPPVLRSGTYASTW
Ga0307406_1024456333300031901RhizosphereGRWESSLIVTVTPRPPIAITAHAFDLPTVREIPPVQRPGTFSSTW
Ga0307406_1068558523300031901RhizosphereMTVMAPRPPIAAAAHAFSIPVVRELPPVQRPGIFDSTW
Ga0307406_1134519923300031901RhizosphereTATVTPRPPVATAAHAFQLPTVREIPPVPRPGTFSSTW
Ga0307416_10016733623300032002RhizosphereVTVTVTPRPPVATASHAYTLPTVRELPPVSRPGTFASIW
Ga0307415_10067375723300032126RhizosphereMTVLAPRPPIAAAAHSFSTPVVRELPPVQRPGMFDSTW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.