Basic Information | |
---|---|
Family ID | F048549 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 148 |
Average Sequence Length | 39 residues |
Representative Sequence | MTVTVTPRPPVATAAHAFTLPTVRELPPVARPGTFDSTW |
Number of Associated Samples | 85 |
Number of Associated Scaffolds | 148 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 55.41 % |
% of genes near scaffold ends (potentially truncated) | 29.05 % |
% of genes from short scaffolds (< 2000 bps) | 87.16 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.054 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (32.432 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.541 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.135 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 4.48% β-sheet: 0.00% Coil/Unstructured: 95.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 148 Family Scaffolds |
---|---|---|
PF01035 | DNA_binding_1 | 29.73 |
PF00311 | PEPcase | 22.30 |
PF00171 | Aldedh | 5.41 |
PF03069 | FmdA_AmdA | 2.70 |
PF00903 | Glyoxalase | 1.35 |
PF00027 | cNMP_binding | 1.35 |
PF08031 | BBE | 1.35 |
PF01590 | GAF | 1.35 |
PF02417 | Chromate_transp | 1.35 |
PF13185 | GAF_2 | 1.35 |
PF13191 | AAA_16 | 0.68 |
PF00196 | GerE | 0.68 |
PF00353 | HemolysinCabind | 0.68 |
PF13602 | ADH_zinc_N_2 | 0.68 |
PF02870 | Methyltransf_1N | 0.68 |
PF00890 | FAD_binding_2 | 0.68 |
PF03992 | ABM | 0.68 |
PF12706 | Lactamase_B_2 | 0.68 |
PF00005 | ABC_tran | 0.68 |
PF00403 | HMA | 0.68 |
PF03372 | Exo_endo_phos | 0.68 |
PF00248 | Aldo_ket_red | 0.68 |
PF07995 | GSDH | 0.68 |
PF04234 | CopC | 0.68 |
PF13384 | HTH_23 | 0.68 |
PF16655 | PhoD_N | 0.68 |
PF00480 | ROK | 0.68 |
PF11139 | SfLAP | 0.68 |
PF13649 | Methyltransf_25 | 0.68 |
PF12697 | Abhydrolase_6 | 0.68 |
PF07690 | MFS_1 | 0.68 |
PF08734 | GYD | 0.68 |
PF01370 | Epimerase | 0.68 |
PF13411 | MerR_1 | 0.68 |
PF13473 | Cupredoxin_1 | 0.68 |
COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
---|---|---|---|
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 30.41 |
COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 29.73 |
COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 22.30 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 5.41 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 5.41 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 5.41 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 2.70 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.35 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.35 |
COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 1.35 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.68 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.68 |
COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 0.68 |
COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.68 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.05 % |
Unclassified | root | N/A | 20.95 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002568|C688J35102_119175051 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium Pan216 | 649 | Open in IMG/M |
3300002568|C688J35102_119349964 | Not Available | 678 | Open in IMG/M |
3300002568|C688J35102_120123629 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300003992|Ga0055470_10132753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 641 | Open in IMG/M |
3300004081|Ga0063454_101979851 | Not Available | 515 | Open in IMG/M |
3300004463|Ga0063356_105835029 | Not Available | 528 | Open in IMG/M |
3300005093|Ga0062594_100254635 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
3300005356|Ga0070674_101265405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 657 | Open in IMG/M |
3300005367|Ga0070667_101491613 | Not Available | 635 | Open in IMG/M |
3300005459|Ga0068867_101528971 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 622 | Open in IMG/M |
3300005530|Ga0070679_100801802 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300005543|Ga0070672_102034547 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300005547|Ga0070693_101485621 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 529 | Open in IMG/M |
3300005563|Ga0068855_100863636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
3300005564|Ga0070664_102161892 | Not Available | 528 | Open in IMG/M |
3300005615|Ga0070702_100401271 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300005840|Ga0068870_10393674 | Not Available | 900 | Open in IMG/M |
3300005842|Ga0068858_100197064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1904 | Open in IMG/M |
3300005937|Ga0081455_10242974 | Not Available | 1322 | Open in IMG/M |
3300005937|Ga0081455_10291867 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
3300005981|Ga0081538_10000242 | All Organisms → cellular organisms → Bacteria | 61803 | Open in IMG/M |
3300005981|Ga0081538_10034267 | All Organisms → cellular organisms → Bacteria | 3359 | Open in IMG/M |
3300005981|Ga0081538_10073825 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
3300005981|Ga0081538_10112138 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300005981|Ga0081538_10152607 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300005981|Ga0081538_10175215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 928 | Open in IMG/M |
3300005981|Ga0081538_10176639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces | 921 | Open in IMG/M |
3300005985|Ga0081539_10019896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 4571 | Open in IMG/M |
3300005985|Ga0081539_10355540 | Not Available | 615 | Open in IMG/M |
3300006046|Ga0066652_100016105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 4997 | Open in IMG/M |
3300006046|Ga0066652_100247832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1558 | Open in IMG/M |
3300006058|Ga0075432_10260219 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300006169|Ga0082029_1782690 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
3300006196|Ga0075422_10394051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
3300006844|Ga0075428_100092790 | All Organisms → cellular organisms → Bacteria | 3291 | Open in IMG/M |
3300006844|Ga0075428_100179597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2291 | Open in IMG/M |
3300006844|Ga0075428_102254274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
3300006845|Ga0075421_102190600 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300006880|Ga0075429_101554948 | Not Available | 575 | Open in IMG/M |
3300006969|Ga0075419_11178838 | Not Available | 564 | Open in IMG/M |
3300007004|Ga0079218_10231554 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
3300007004|Ga0079218_11288443 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300007004|Ga0079218_12093383 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300009094|Ga0111539_10282701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1931 | Open in IMG/M |
3300009094|Ga0111539_10448199 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
3300009094|Ga0111539_10937340 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300009094|Ga0111539_11016630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
3300009094|Ga0111539_11255952 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300009100|Ga0075418_10307837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1689 | Open in IMG/M |
3300009100|Ga0075418_13159294 | Not Available | 502 | Open in IMG/M |
3300009147|Ga0114129_11649344 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300009156|Ga0111538_10889778 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300009157|Ga0105092_10213878 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300009157|Ga0105092_10746183 | Not Available | 571 | Open in IMG/M |
3300009162|Ga0075423_13149970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 505 | Open in IMG/M |
3300009551|Ga0105238_10265061 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
3300009553|Ga0105249_10936546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
3300010037|Ga0126304_10943814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Actinomarinicola → Actinomarinicola tropica | 587 | Open in IMG/M |
3300010038|Ga0126315_10147668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1390 | Open in IMG/M |
3300010040|Ga0126308_10245942 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300010042|Ga0126314_10572321 | Not Available | 823 | Open in IMG/M |
3300010042|Ga0126314_10812662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces | 688 | Open in IMG/M |
3300010042|Ga0126314_11372560 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 531 | Open in IMG/M |
3300010044|Ga0126310_11687263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 526 | Open in IMG/M |
3300010045|Ga0126311_11425225 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300010371|Ga0134125_10492600 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
3300010396|Ga0134126_11477027 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300010399|Ga0134127_11344378 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300010401|Ga0134121_12604308 | Not Available | 549 | Open in IMG/M |
3300010403|Ga0134123_10551605 | Not Available | 1097 | Open in IMG/M |
3300010403|Ga0134123_11218887 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300010403|Ga0134123_12456350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300012469|Ga0150984_100621498 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300012469|Ga0150984_110391618 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300014311|Ga0075322_1170536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
3300015374|Ga0132255_104311780 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300017965|Ga0190266_11015308 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300018061|Ga0184619_10212786 | Not Available | 889 | Open in IMG/M |
3300018422|Ga0190265_10043334 | All Organisms → cellular organisms → Bacteria | 3861 | Open in IMG/M |
3300018422|Ga0190265_10077332 | All Organisms → cellular organisms → Bacteria | 3031 | Open in IMG/M |
3300018422|Ga0190265_10097990 | All Organisms → cellular organisms → Bacteria | 2738 | Open in IMG/M |
3300018422|Ga0190265_10113061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2575 | Open in IMG/M |
3300018422|Ga0190265_10129988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2424 | Open in IMG/M |
3300018422|Ga0190265_10203633 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
3300018422|Ga0190265_10330070 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
3300018422|Ga0190265_10413970 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
3300018422|Ga0190265_10923119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 995 | Open in IMG/M |
3300018422|Ga0190265_11053976 | Not Available | 934 | Open in IMG/M |
3300018422|Ga0190265_11147996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
3300018422|Ga0190265_11574257 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300018422|Ga0190265_11659927 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300018422|Ga0190265_11664098 | Not Available | 749 | Open in IMG/M |
3300018422|Ga0190265_11839926 | Not Available | 713 | Open in IMG/M |
3300018422|Ga0190265_12541552 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300018422|Ga0190265_12680374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
3300018422|Ga0190265_13658342 | Not Available | 513 | Open in IMG/M |
3300018422|Ga0190265_13722379 | Not Available | 508 | Open in IMG/M |
3300018429|Ga0190272_10510886 | Not Available | 1024 | Open in IMG/M |
3300018429|Ga0190272_11367075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis | 709 | Open in IMG/M |
3300018429|Ga0190272_11605528 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300018429|Ga0190272_11935876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 621 | Open in IMG/M |
3300018432|Ga0190275_10133634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2260 | Open in IMG/M |
3300018432|Ga0190275_10668158 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300018465|Ga0190269_11402847 | Not Available | 567 | Open in IMG/M |
3300018466|Ga0190268_10031517 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
3300018466|Ga0190268_10228349 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300018469|Ga0190270_11659069 | Not Available | 692 | Open in IMG/M |
3300018469|Ga0190270_13441597 | Not Available | 502 | Open in IMG/M |
3300018476|Ga0190274_12225108 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300018481|Ga0190271_10078023 | All Organisms → cellular organisms → Bacteria | 2958 | Open in IMG/M |
3300018481|Ga0190271_10274315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1734 | Open in IMG/M |
3300019255|Ga0184643_1430085 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300019279|Ga0184642_1425344 | Not Available | 520 | Open in IMG/M |
3300019377|Ga0190264_10538606 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300019377|Ga0190264_12037375 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300019377|Ga0190264_12220798 | Not Available | 512 | Open in IMG/M |
3300022756|Ga0222622_10263409 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300022756|Ga0222622_10359296 | Not Available | 1017 | Open in IMG/M |
3300024430|Ga0196962_10015219 | All Organisms → cellular organisms → Bacteria | 2301 | Open in IMG/M |
3300024430|Ga0196962_10046198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708 | 1314 | Open in IMG/M |
3300024430|Ga0196962_10059407 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300024430|Ga0196962_10233531 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300025935|Ga0207709_10162691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1558 | Open in IMG/M |
3300025937|Ga0207669_11016818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 697 | Open in IMG/M |
3300027636|Ga0214469_1056793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1206 | Open in IMG/M |
3300027907|Ga0207428_10070450 | All Organisms → cellular organisms → Bacteria | 2748 | Open in IMG/M |
3300027907|Ga0207428_10155741 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
3300027907|Ga0207428_11231219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300027909|Ga0209382_11861960 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300028705|Ga0307276_10153194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300028719|Ga0307301_10092436 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300028744|Ga0307318_10050107 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300028784|Ga0307282_10427364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
3300028796|Ga0307287_10330559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
3300028814|Ga0307302_10362741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces | 715 | Open in IMG/M |
3300028814|Ga0307302_10571601 | Not Available | 562 | Open in IMG/M |
3300028876|Ga0307286_10290003 | Not Available | 604 | Open in IMG/M |
3300030006|Ga0299907_10260754 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300030619|Ga0268386_10073863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2663 | Open in IMG/M |
3300030785|Ga0102757_11106154 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300031152|Ga0307501_10281193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 506 | Open in IMG/M |
3300031228|Ga0299914_10425013 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300031901|Ga0307406_10061976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2418 | Open in IMG/M |
3300031901|Ga0307406_10244563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1348 | Open in IMG/M |
3300031901|Ga0307406_10685585 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300031901|Ga0307406_11345199 | Not Available | 625 | Open in IMG/M |
3300032002|Ga0307416_100167336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2041 | Open in IMG/M |
3300032126|Ga0307415_100673757 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 32.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.86% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.41% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.73% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 4.73% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.05% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.70% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 2.70% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.70% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.03% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.03% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.35% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.35% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.35% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.35% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.35% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.68% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J35102_1191750512 | 3300002568 | Soil | MTIVVTPRPPISAAAHVFSMPVVRELPPVQRPGMFDTTW* |
C688J35102_1193499642 | 3300002568 | Soil | MTLTVTPRPPVASTAHAFSLPTVREIPPVQRPGTFSSIW* |
C688J35102_1201236292 | 3300002568 | Soil | LEMPRRWSIRAMTIVVTPRPPIAAAHAYSTPIVREIPPVQRPGMFDATW* |
Ga0055470_101327531 | 3300003992 | Natural And Restored Wetlands | VTVTVTPRPPVASTAHAFSLPVAREIPPVVRPGMFSSTW* |
Ga0063454_1019798511 | 3300004081 | Soil | AGAKGLLPMTLTVTPRPPVASTAHAFSLPTVREIPPVQRPGTFSSIW* |
Ga0063356_1058350291 | 3300004463 | Arabidopsis Thaliana Rhizosphere | FAVTVTITSRVPVATAHVYTRPTVRELPPLPRPGTFDSTW* |
Ga0062594_1002546353 | 3300005093 | Soil | LEMSHRWSIRAMTIVVTPRPPIAAAHVYSTPIVREIPPVQRPGMFDATW* |
Ga0070674_1012654052 | 3300005356 | Miscanthus Rhizosphere | TAHPHPTMSPLPTPRPPAHRHVYVAAVVRELPPVSRPGQFASTW* |
Ga0070667_1014916131 | 3300005367 | Switchgrass Rhizosphere | LEMSHRWSIRTMTIIVTPRPPIAAAHVYSTPIVREIPPVQRPGMFDATW* |
Ga0068867_1015289712 | 3300005459 | Miscanthus Rhizosphere | MTIVVTPRRPIAAAEHVFTTPVVRELPPVQRPGMYDSTW* |
Ga0070679_1008018021 | 3300005530 | Corn Rhizosphere | MTIVVTPRPPIAAAAHAFSTPVVRELPPVQRPGMFDTTW* |
Ga0070672_1020345472 | 3300005543 | Miscanthus Rhizosphere | MTIVVTPRPPIAAAHVYSTPIVREIPPVQRPGMFDATW* |
Ga0070693_1014856211 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIVVTPRPPIAAAAHVFTTPVVRELPPVQRPGMYDSTW* |
Ga0068855_1008636361 | 3300005563 | Corn Rhizosphere | AAAKGLPPVTVTVTPRPPVASTAHAFSLPVVRELPPVVRPGTFSSTW* |
Ga0070664_1021618922 | 3300005564 | Corn Rhizosphere | MSPLPTPRPPAHRHVYVAAVVRELPPVSRPGQFASTW* |
Ga0070702_1004012713 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AMTIVVTPRPPIAAAHVYSTPIVREIPPVQRPGMFDATW* |
Ga0068870_103936743 | 3300005840 | Miscanthus Rhizosphere | MTVVAPRPPIAAATHVFSTPVVRELPPVQRPGMFDSTW* |
Ga0068858_1001970643 | 3300005842 | Switchgrass Rhizosphere | VTVTVTPRPPVASTAHAFSLPVVRELPPVVRPGTFSSTW* |
Ga0081455_102429743 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VTVTVTPRRPAATAHAFSSPTVREIPPVQRPGTFDSTW* |
Ga0081455_102918671 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSPIVTPRPPVSAQHAFTTPVVRELPPVYRPGTFDSTW* |
Ga0081538_1000024249 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSMTVTVTPRPPVATAAHAFTLPTVRELPPVARPGTFDSTW* |
Ga0081538_100342674 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MTVVAPRPPIAAATHVFSTPIVRELPPVQRPGMFDSTW* |
Ga0081538_100738252 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MTVTVTPRPPVATAAHAFTLPTVRELPPVARPGTFDSTW* |
Ga0081538_101121381 | 3300005981 | Tabebuia Heterophylla Rhizosphere | ARASIRVVTVTVTPRPPAAAAHAFSLPLVREIPPVQRPGTFDSTW* |
Ga0081538_101526072 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSMTVTITPRPPVATAGHAFTLPVVRELPPVARPGTFDSTW* |
Ga0081538_101752154 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VTVTVTPRRPAAAAHAFSLPTVREIPPVPRPGTFASTW* |
Ga0081538_101766391 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VTATVTPRPPVATTAHAFQIPTVREIPPVPRPGTFSSIW* |
Ga0081539_100198965 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTIVVTPRPPAAAHAFSTPVVRELPPVQRPGMFDATW* |
Ga0081539_103555402 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTVTITPRPPVASAAHAFSLPTVREIPPVQRPGTFSSTW* |
Ga0066652_1000161056 | 3300006046 | Soil | MTIVVTPRPPISAAAHVFSMPVVRELPPVRRPGMFDTTW* |
Ga0066652_1002478322 | 3300006046 | Soil | VTVTVTPRPPVASTAHAFSLPTVREIPPVVRPGTFSSSW* |
Ga0075432_102602192 | 3300006058 | Populus Rhizosphere | AAGAAAEAMTVVVTPRPPIAAAHAFTTPVVREMPPVHRPGTFDSTW* |
Ga0082029_17826902 | 3300006169 | Termite Nest | MSPTVTPRPLVSAQHAYTTPVVRELPPVYRPGTFDSTW* |
Ga0075422_103940512 | 3300006196 | Populus Rhizosphere | VTVTVTPRRPAAAHAFSLPTVREIPPVQRPGAFDSTW* |
Ga0075428_1000927902 | 3300006844 | Populus Rhizosphere | MTVVAPRPPIAAATHAFSTPVVRELPPVQRPGMFDSTW* |
Ga0075428_1001795972 | 3300006844 | Populus Rhizosphere | VTVTVTPRRPAASSPRFFTLPSVRELPPVQRPGTYASTW* |
Ga0075428_1022542742 | 3300006844 | Populus Rhizosphere | MNSVTVTVTPRRPAAAHAFSLPTVREIPPVQRPGAFDSTW* |
Ga0075421_1021906002 | 3300006845 | Populus Rhizosphere | MSMTVTVTPRPPVATAHAFTLPVVRELPPVARPGTFDSTW* |
Ga0075429_1015549483 | 3300006880 | Populus Rhizosphere | VTVTVTPRRPVATAHAFALPVVREIPPVQRPGTFSSTW* |
Ga0075419_111788382 | 3300006969 | Populus Rhizosphere | VTVTVTPRRPALAAHAFSSPTVREIPPVQRPGTFDSTW* |
Ga0079218_102315542 | 3300007004 | Agricultural Soil | MTVTITPRPPVAAGHAFTLPVVRELPPVARPGTFDSTW* |
Ga0079218_112884433 | 3300007004 | Agricultural Soil | EPAMTVTITPRPPASGAPHVFSTPTVRELPPVARPGTFAATW* |
Ga0079218_120933832 | 3300007004 | Agricultural Soil | MTVTVTPRPPVRTAAHAFTLPTVRELPPVARPGTFASTW* |
Ga0111539_102827013 | 3300009094 | Populus Rhizosphere | VTVTVTPRNPAATARHAFSLPTVRELPPVARPGTFASTW* |
Ga0111539_104481992 | 3300009094 | Populus Rhizosphere | MSPIVTPRPPVATHAYTLPVVRELPPVSRPGTFDSTW* |
Ga0111539_109373401 | 3300009094 | Populus Rhizosphere | MTVVVTPRPPIAAAHAFTTPVVREMPPVHRPGTFDSTW* |
Ga0111539_110166301 | 3300009094 | Populus Rhizosphere | SIPAMNSVTVTVTPRRPAAAHAFSLPTVREIPPVQRPGAFDSTW* |
Ga0111539_112559522 | 3300009094 | Populus Rhizosphere | MTVTVTPRPPVATAGHAFTLPVVRELPPVARPGTFDSTW* |
Ga0075418_103078371 | 3300009100 | Populus Rhizosphere | MTVVVTPRPPIAAAHAFTTPVVREMPPVHRPGTFDST |
Ga0075418_131592941 | 3300009100 | Populus Rhizosphere | GLPVTVTVTPRRPALAAHAFSSPTVREIPPVQRPGTFDSTW* |
Ga0114129_116493442 | 3300009147 | Populus Rhizosphere | MTAPPRPRITAAPHAYTIPVVRELPPVQRPGMFDTTW* |
Ga0111538_108897782 | 3300009156 | Populus Rhizosphere | MTVTVTPRPPVATAGHAFTLPVVREMPPVARPGMFDSTW* |
Ga0105092_102138783 | 3300009157 | Freshwater Sediment | SLRVTANERVPPMSPTVTPRPPVSAQHAFSTPVVRELPPVYRPGTFDSTW* |
Ga0105092_107461833 | 3300009157 | Freshwater Sediment | VTVTITPRRPAAAAHAFSFPTVREIPPVQRPGMFDS |
Ga0075423_131499701 | 3300009162 | Populus Rhizosphere | MTIVVTPRPPIAAAHVYSTPIVREIPPVQRPGLFDSTW* |
Ga0105238_102650612 | 3300009551 | Corn Rhizosphere | MTIVVTPRPPIAAAHAYSTPIVREIPPVQRPGMFDATW* |
Ga0105249_109365463 | 3300009553 | Switchgrass Rhizosphere | AAKAAMTIVVTPRPPITAAAHAYSTPVVRELPPVQRPGMFDTTW* |
Ga0126304_109438141 | 3300010037 | Serpentine Soil | VTITPRPPVATAHAYSLPVVREIPPVQRPGTFSATW* |
Ga0126315_101476684 | 3300010038 | Serpentine Soil | MTVLAPRPPIAAATHSFSTPVVRELPPVQRPGMFDSTW* |
Ga0126308_102459421 | 3300010040 | Serpentine Soil | RLPAGSLVLVTATVTPRPPVSTTAHAFQLPTVREIPPVPRPGMFSSTW* |
Ga0126314_105723211 | 3300010042 | Serpentine Soil | VTVTPRRPAASSPRYFTVPTVRELPPVARPGTYASTW* |
Ga0126314_108126621 | 3300010042 | Serpentine Soil | SCIVTVTVTPRPPVANTAHAFTLPNVREIPPVFRPGTFSSTW* |
Ga0126314_113725601 | 3300010042 | Serpentine Soil | MTIVVTPRPPLAAATHVFSTPVVRELPPVPRPGTFDFTW* |
Ga0126310_116872632 | 3300010044 | Serpentine Soil | MTVLAPRPPIAAAAHTFSIPVVRELPPVQRPGMFDSTW* |
Ga0126311_114252252 | 3300010045 | Serpentine Soil | MTVLAPRPPIAAAAHTFSIPVVRELPPVQRPGTFDSTW* |
Ga0134125_104926003 | 3300010371 | Terrestrial Soil | MTIVVTPRPPIAAAAHTFSTPVVRELPPVQRPGMFDTTW* |
Ga0134126_114770273 | 3300010396 | Terrestrial Soil | VTPRPPIAAAHAFSTPVVRELPPVQRPGMFDTTW* |
Ga0134127_113443783 | 3300010399 | Terrestrial Soil | MTIVVTPRPPIAAAAHVFTTPVVRELPPVQRPGMFDSTW* |
Ga0134121_126043082 | 3300010401 | Terrestrial Soil | MTIVVTPRPPIAAAAHAFSTPVVRELPPVQRPGMFDSTW* |
Ga0134123_105516052 | 3300010403 | Terrestrial Soil | TVTPRPPAAITAHAFSLPTVREIPPVPRPGTFSSAW* |
Ga0134123_112188873 | 3300010403 | Terrestrial Soil | VVTPRPPIAAAHVYSTPIVREIPPVQRPGMFDATW* |
Ga0134123_124563502 | 3300010403 | Terrestrial Soil | MTVVAPRPPIAAATHVFSTPVVRELPPVQRPGMFDST |
Ga0150984_1006214982 | 3300012469 | Avena Fatua Rhizosphere | TVVAPRPPIAAATHTFSTPVVRELPPVQRPGMFDSTW* |
Ga0150984_1103916181 | 3300012469 | Avena Fatua Rhizosphere | RHQPRPPIAAAHAYSTPIVREIPPVQRPGMFDATW* |
Ga0075322_11705362 | 3300014311 | Natural And Restored Wetlands | VTVTVTPRPPVASTAHAFSLPVAREIPPVVRPGMFS |
Ga0132255_1043117802 | 3300015374 | Arabidopsis Rhizosphere | MTLVVTPRPPIAAAPAFTTPVVRELPPVNRPGMFDATW* |
Ga0190266_110153082 | 3300017965 | Soil | KTMTIMVTPRPPIAAAAHVFTTPVVRELPPVQRPGMFDSTW |
Ga0184619_102127862 | 3300018061 | Groundwater Sediment | VPVTVTPRRPSANASHAFGLPTVRELPSVARPGTFD |
Ga0190265_100433344 | 3300018422 | Soil | VPVTVTPRRPAATAPHVYMLATVRELPPVARPGTFDSTW |
Ga0190265_100773324 | 3300018422 | Soil | MTVVVTPRQPIAAASHVYTTPVVRELPPVQRPGTFSATW |
Ga0190265_100979903 | 3300018422 | Soil | MSMTVTVTPRPPVRSAAHAFTLPTVRELPPVARPGTFDSTW |
Ga0190265_101130613 | 3300018422 | Soil | MTVTITPRPPASGAPHVYSTATVRELPPVARPGTFAATW |
Ga0190265_101299884 | 3300018422 | Soil | VTVTVTPRPPVATTAHAFSLPTVREIPPVYRPGTFASTW |
Ga0190265_102036332 | 3300018422 | Soil | MTVTITPRPPAAGTTHMFSAPTVRELPPVARPGTFAATW |
Ga0190265_103300703 | 3300018422 | Soil | MSPIVTSRPPMTAQHAYTTPVVRELPPVYRPGTFDSTW |
Ga0190265_104139703 | 3300018422 | Soil | MTQMVTPRPPVQTSQHVFTLPTVREMPPVARPGTFDSTW |
Ga0190265_109231191 | 3300018422 | Soil | VPVTVTPRRPAANAPHAFMLATVRELPPVTRPGTFDATW |
Ga0190265_110539761 | 3300018422 | Soil | MTVVATPRPPAAASHTYTLPVVRELPPVARPGMFDATW |
Ga0190265_111479962 | 3300018422 | Soil | VPVTVTPRRPAANAPHAFMLATVRELPPVARPGTFDATW |
Ga0190265_115742572 | 3300018422 | Soil | VVTVTITPRVPVATAHVYTLPTVREIPPVQRPGTFDSTW |
Ga0190265_116599272 | 3300018422 | Soil | MTVTTTPRPPVDAAGHAFTFPTVRELPPVSRPGTFDSTW |
Ga0190265_116640982 | 3300018422 | Soil | MTVTVTPRPPIAAAAHVYTTPVVRELPPVQRPGTFASTW |
Ga0190265_118399262 | 3300018422 | Soil | MSVTLTPRLPAPIVHAFSLPTVREIPPVTRPGTFDSTW |
Ga0190265_125415521 | 3300018422 | Soil | AKDFVVTVTVTPRVPVATAHVYTIPTVREILPVQRPGTFDSTW |
Ga0190265_126803742 | 3300018422 | Soil | MTVVTPRPPAASAPHAYSTPVVREMPPVQRPGTFAATW |
Ga0190265_136583421 | 3300018422 | Soil | VTVTITPRMPVATAHAYTLPTVREIPPVQRPGTFDS |
Ga0190265_137223792 | 3300018422 | Soil | FAVTVTVTPRMPVATAHAYSLPTVREIPPVQRPGTFASTW |
Ga0190272_105108862 | 3300018429 | Soil | MTVTVTPRTPISAASHVFTTPVVREMPPVQRPGTYASTW |
Ga0190272_113670751 | 3300018429 | Soil | MTVTVTPRPPVVTAHTFTLPTVRELPPVARPGTFDPTW |
Ga0190272_116055281 | 3300018429 | Soil | MTVVITPRQPSAAASHVYTTPVVREMPPVYRPGTFDSTW |
Ga0190272_119358761 | 3300018429 | Soil | ATVPVTVTPRRPSANAPHAFMLPTVRELPPVARPGTFDATW |
Ga0190275_101336342 | 3300018432 | Soil | MTLVAPPRPRTIQHVYSLPVVREVPPVARPGTFAAGW |
Ga0190275_106681581 | 3300018432 | Soil | MTVTITPRPPAATAPHVYSTPTVRELPPVARPGTFASTW |
Ga0190269_114028471 | 3300018465 | Soil | TVPVTITPRRPAANASHAFGLPTVRELPPVARPGTFDATW |
Ga0190268_100315172 | 3300018466 | Soil | MTVTVTPRPPVTAAAHTFTFPTVRELPPVSRPGTFDSTW |
Ga0190268_102283492 | 3300018466 | Soil | MSPIVTPRPPVSAQHAYSTPVVRELPPVYRPGTFDSTW |
Ga0190270_116590692 | 3300018469 | Soil | MTVVITPRQPSAAASHVYTTPVVREMPPVNRPGTFDSTW |
Ga0190270_134415972 | 3300018469 | Soil | MTITVTPRPPIAAAAHVYTTPVVRELPPVQRPGTFASTW |
Ga0190274_122251082 | 3300018476 | Soil | MTVVAPRPPIAAATHVFSTPVVRELPPVQRPGMFDSTW |
Ga0190271_100780232 | 3300018481 | Soil | MTVTITPRPPVAAAGHAFTLPVVRELPPVARPGTFDSTW |
Ga0190271_102743151 | 3300018481 | Soil | VTVTVTPRNPAATARHGFTLPTVRELPPVSRPGTFSSTW |
Ga0184643_14300851 | 3300019255 | Groundwater Sediment | MTVLVTPRQPTAAASHVYTTPVVREMPPVYRPGMFDSTW |
Ga0184642_14253442 | 3300019279 | Groundwater Sediment | MTVVVTPRQPTAAASHVYTTPVVREMPPVYRPGMFDSTW |
Ga0190264_105386062 | 3300019377 | Soil | MTVTVTPRPPVTAANHTFTFPTVRELPPVSRPGTFDSTW |
Ga0190264_120373752 | 3300019377 | Soil | MPVTITPRPPASTAPHVYSTPTVRELPPVARPGTFAATW |
Ga0190264_122207982 | 3300019377 | Soil | KDFAVTVTVTPRMPVATAHAYSLPTVREIPPVQRPGTFASTW |
Ga0222622_102634093 | 3300022756 | Groundwater Sediment | MTIVVTPRPPISAAAHVFSTPVVRELPPVQRPGMFDTTW |
Ga0222622_103592961 | 3300022756 | Groundwater Sediment | VTVTVTPRRPAAAAHAFSLPTVREIPPVQRPGTFDSIW |
Ga0196962_100152193 | 3300024430 | Soil | MTVTVTPRPPVATAGHAFTLPVVRELPPVARPGMFDSTW |
Ga0196962_100461982 | 3300024430 | Soil | MTVTVTPRPPVATAGHAFTLPVVRELPPVARPGTFDSTW |
Ga0196962_100594072 | 3300024430 | Soil | MSPIVTPRPPASAAQHAFTTPVVRELPPVYRPGMFDSTW |
Ga0196962_102335312 | 3300024430 | Soil | VTVTPRPPVRTAAHTFTLPTVRELPPVARPGTFDSTW |
Ga0207709_101626912 | 3300025935 | Miscanthus Rhizosphere | MTIVVTPRLSVAAAHVYSTPIVREIPPVQRPGMFDATW |
Ga0207669_110168181 | 3300025937 | Miscanthus Rhizosphere | TAHPHPTMSPLPTPRPPAHRHVYVAAVVRELPPVSRPGQFASTW |
Ga0214469_10567933 | 3300027636 | Soil | MTVTVTPRPPVRSAAHAFTLPTVRELPPVARPGTFDSTW |
Ga0207428_100704502 | 3300027907 | Populus Rhizosphere | MTVVAPRPPIAAATHAFSTPVVRELPPVQRPGMFDSTW |
Ga0207428_101557412 | 3300027907 | Populus Rhizosphere | MTVVVTPRPPIAAAHAFTTPVVREMPPVHRPGTFDSTW |
Ga0207428_112312191 | 3300027907 | Populus Rhizosphere | MSPIVTPRPPVATHAYTLPVVRELPPVSRPGTFDSTW |
Ga0209382_118619601 | 3300027909 | Populus Rhizosphere | MTIVVTPRPPIAAAAHAFSMPVVRELPPVQRPGLFDSTW |
Ga0307276_101531941 | 3300028705 | Soil | MTIVVTPRPPIAAAAHAYSTPVVRELPPVQRPGMFDATW |
Ga0307301_100924362 | 3300028719 | Soil | MTVVVPRPPIAAAAHAFSTPVVRELPPVQRPGMFDATW |
Ga0307318_100501072 | 3300028744 | Soil | MSPTVTPRRPTSAASHAFTTPVVRELPPVRRPGMFDATW |
Ga0307282_104273642 | 3300028784 | Soil | MTIVVTPRPPAAAHAYSTPVVRELPPVQRPGMFDATW |
Ga0307287_103305591 | 3300028796 | Soil | MTVTVTPRPPVAAAHAFSLPVVREIPPVQRPSTFAA |
Ga0307302_103627412 | 3300028814 | Soil | VTVTITPRRPAASAHAFALPVVREIPPVQRPGTFDATW |
Ga0307302_105716012 | 3300028814 | Soil | MTVVVTPRQPTAAASHVYTTPVVREMPPVYRPGTFDSTW |
Ga0307286_102900033 | 3300028876 | Soil | CDRRSLARHPAAAARADSFPAVREIPPVLRPGRFDSTW |
Ga0299907_102607542 | 3300030006 | Soil | MTVTITPRPPAAGATHMFSAPTVRELPPVARPGTFAATW |
Ga0268386_100738635 | 3300030619 | Soil | VTVTVTPRQPAASAPHFFSTPTVRELPPVRRPGTFASTW |
Ga0102757_111061541 | 3300030785 | Soil | MTIVVTPRPPIASAHAFTTPVVRELPPVQRPGVFDSTW |
Ga0307501_102811931 | 3300031152 | Soil | MTIVVTPRQPIAAAHAYSTPVVRELPPVYRPGMFDTTW |
Ga0299914_104250132 | 3300031228 | Soil | MTVTVTPRPPVRTAAHAFTLPTVRELPPVARPGTFDSTW |
Ga0307406_100619762 | 3300031901 | Rhizosphere | VTVTVTPRRPAASSPRFFTLPTVRELPPVLRSGTYASTW |
Ga0307406_102445633 | 3300031901 | Rhizosphere | GRWESSLIVTVTPRPPIAITAHAFDLPTVREIPPVQRPGTFSSTW |
Ga0307406_106855852 | 3300031901 | Rhizosphere | MTVMAPRPPIAAAAHAFSIPVVRELPPVQRPGIFDSTW |
Ga0307406_113451992 | 3300031901 | Rhizosphere | TATVTPRPPVATAAHAFQLPTVREIPPVPRPGTFSSTW |
Ga0307416_1001673362 | 3300032002 | Rhizosphere | VTVTVTPRPPVATASHAYTLPTVRELPPVSRPGTFASIW |
Ga0307415_1006737572 | 3300032126 | Rhizosphere | MTVLAPRPPIAAAAHSFSTPVVRELPPVQRPGMFDSTW |
⦗Top⦘ |