Basic Information | |
---|---|
Family ID | F048531 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 148 |
Average Sequence Length | 45 residues |
Representative Sequence | VIARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQA |
Number of Associated Samples | 130 |
Number of Associated Scaffolds | 148 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.68 % |
% of genes near scaffold ends (potentially truncated) | 97.97 % |
% of genes from short scaffolds (< 2000 bps) | 91.89 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (69.595 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.378 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.297 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.892 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.44% β-sheet: 0.00% Coil/Unstructured: 83.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 148 Family Scaffolds |
---|---|---|
PF13649 | Methyltransf_25 | 28.38 |
PF02878 | PGM_PMM_I | 14.19 |
PF08242 | Methyltransf_12 | 8.11 |
PF02880 | PGM_PMM_III | 4.05 |
PF04542 | Sigma70_r2 | 2.70 |
PF03709 | OKR_DC_1_N | 2.70 |
PF13404 | HTH_AsnC-type | 2.03 |
PF00488 | MutS_V | 1.35 |
PF08281 | Sigma70_r4_2 | 1.35 |
PF02879 | PGM_PMM_II | 1.35 |
PF13193 | AMP-binding_C | 1.35 |
PF00730 | HhH-GPD | 0.68 |
PF00155 | Aminotran_1_2 | 0.68 |
PF04434 | SWIM | 0.68 |
PF11941 | DUF3459 | 0.68 |
PF11272 | DUF3072 | 0.68 |
PF00291 | PALP | 0.68 |
PF01411 | tRNA-synt_2c | 0.68 |
PF03711 | OKR_DC_1_C | 0.68 |
COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
---|---|---|---|
COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 19.59 |
COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 19.59 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.70 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.70 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.70 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.70 |
COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 1.35 |
COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 1.35 |
COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.68 |
COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.68 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.68 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.68 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.68 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.68 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.68 |
COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.68 |
COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 69.59 % |
All Organisms | root | All Organisms | 30.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003505|JGIcombinedJ51221_10224149 | Not Available | 763 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10470111 | Not Available | 507 | Open in IMG/M |
3300005172|Ga0066683_10484921 | Not Available | 756 | Open in IMG/M |
3300005434|Ga0070709_10222577 | Not Available | 1346 | Open in IMG/M |
3300005435|Ga0070714_100384134 | Not Available | 1324 | Open in IMG/M |
3300005435|Ga0070714_100893420 | Not Available | 862 | Open in IMG/M |
3300005437|Ga0070710_11129402 | Not Available | 576 | Open in IMG/M |
3300005439|Ga0070711_100663373 | Not Available | 875 | Open in IMG/M |
3300005445|Ga0070708_100426339 | Not Available | 1251 | Open in IMG/M |
3300005467|Ga0070706_101613930 | Not Available | 592 | Open in IMG/M |
3300005518|Ga0070699_101780250 | Not Available | 564 | Open in IMG/M |
3300005536|Ga0070697_100749537 | Not Available | 863 | Open in IMG/M |
3300005554|Ga0066661_10177478 | Not Available | 1313 | Open in IMG/M |
3300005558|Ga0066698_10898672 | Not Available | 567 | Open in IMG/M |
3300005577|Ga0068857_100131402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2258 | Open in IMG/M |
3300005591|Ga0070761_10068927 | Not Available | 2005 | Open in IMG/M |
3300005617|Ga0068859_102176923 | Not Available | 612 | Open in IMG/M |
3300006028|Ga0070717_11702983 | Not Available | 570 | Open in IMG/M |
3300006028|Ga0070717_12167212 | Not Available | 500 | Open in IMG/M |
3300006102|Ga0075015_100627204 | Not Available | 632 | Open in IMG/M |
3300006172|Ga0075018_10854458 | Not Available | 503 | Open in IMG/M |
3300006175|Ga0070712_100385561 | Not Available | 1154 | Open in IMG/M |
3300006175|Ga0070712_100708999 | Not Available | 858 | Open in IMG/M |
3300006176|Ga0070765_101393679 | Not Available | 660 | Open in IMG/M |
3300006606|Ga0074062_13016712 | Not Available | 742 | Open in IMG/M |
3300006804|Ga0079221_10504884 | Not Available | 786 | Open in IMG/M |
3300006854|Ga0075425_101949134 | Not Available | 657 | Open in IMG/M |
3300006914|Ga0075436_100728613 | Not Available | 735 | Open in IMG/M |
3300009012|Ga0066710_104784037 | Not Available | 506 | Open in IMG/M |
3300009137|Ga0066709_104003858 | Not Available | 536 | Open in IMG/M |
3300009520|Ga0116214_1411138 | Not Available | 529 | Open in IMG/M |
3300009545|Ga0105237_10561288 | Not Available | 1148 | Open in IMG/M |
3300009683|Ga0116224_10166704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 1059 | Open in IMG/M |
3300009698|Ga0116216_10747521 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300009824|Ga0116219_10501701 | Not Available | 671 | Open in IMG/M |
3300010048|Ga0126373_11237601 | Not Available | 812 | Open in IMG/M |
3300010048|Ga0126373_11871420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 663 | Open in IMG/M |
3300010154|Ga0127503_10289051 | Not Available | 556 | Open in IMG/M |
3300010329|Ga0134111_10444905 | Not Available | 561 | Open in IMG/M |
3300010360|Ga0126372_12500500 | Not Available | 567 | Open in IMG/M |
3300010361|Ga0126378_12929270 | Not Available | 544 | Open in IMG/M |
3300010362|Ga0126377_13087436 | Not Available | 538 | Open in IMG/M |
3300010379|Ga0136449_103131741 | Not Available | 641 | Open in IMG/M |
3300010876|Ga0126361_11291660 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
3300010880|Ga0126350_12092034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 563 | Open in IMG/M |
3300012201|Ga0137365_10645786 | Not Available | 775 | Open in IMG/M |
3300012206|Ga0137380_10000601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 26735 | Open in IMG/M |
3300012207|Ga0137381_10273313 | Not Available | 1470 | Open in IMG/M |
3300012211|Ga0137377_11281651 | Not Available | 663 | Open in IMG/M |
3300012918|Ga0137396_11079131 | Not Available | 576 | Open in IMG/M |
3300013104|Ga0157370_11005869 | Not Available | 755 | Open in IMG/M |
3300014969|Ga0157376_12694309 | Not Available | 537 | Open in IMG/M |
3300015372|Ga0132256_101531872 | Not Available | 777 | Open in IMG/M |
3300016371|Ga0182034_10550505 | Not Available | 968 | Open in IMG/M |
3300017821|Ga0187812_1302423 | Not Available | 509 | Open in IMG/M |
3300017926|Ga0187807_1048824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 1311 | Open in IMG/M |
3300017932|Ga0187814_10070850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 1279 | Open in IMG/M |
3300017932|Ga0187814_10425526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 519 | Open in IMG/M |
3300017933|Ga0187801_10359988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 600 | Open in IMG/M |
3300017942|Ga0187808_10111493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 1193 | Open in IMG/M |
3300017961|Ga0187778_11090723 | Not Available | 556 | Open in IMG/M |
3300017961|Ga0187778_11151066 | Not Available | 542 | Open in IMG/M |
3300018001|Ga0187815_10222503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 799 | Open in IMG/M |
3300018058|Ga0187766_10984193 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300018433|Ga0066667_11200970 | Not Available | 660 | Open in IMG/M |
3300019890|Ga0193728_1313451 | Not Available | 587 | Open in IMG/M |
3300020581|Ga0210399_11166897 | Not Available | 613 | Open in IMG/M |
3300020581|Ga0210399_11210628 | Not Available | 599 | Open in IMG/M |
3300020582|Ga0210395_11402792 | Not Available | 509 | Open in IMG/M |
3300021401|Ga0210393_10216291 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
3300021402|Ga0210385_10068566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2410 | Open in IMG/M |
3300021404|Ga0210389_10453878 | Not Available | 1008 | Open in IMG/M |
3300021404|Ga0210389_10583820 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300021420|Ga0210394_10202006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1733 | Open in IMG/M |
3300021420|Ga0210394_11256897 | Not Available | 634 | Open in IMG/M |
3300021478|Ga0210402_10729760 | Not Available | 914 | Open in IMG/M |
3300021479|Ga0210410_10154354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 2046 | Open in IMG/M |
3300021559|Ga0210409_10101065 | All Organisms → cellular organisms → Bacteria | 2660 | Open in IMG/M |
3300021559|Ga0210409_11348897 | Not Available | 589 | Open in IMG/M |
3300021560|Ga0126371_10266337 | Not Available | 1832 | Open in IMG/M |
3300021560|Ga0126371_12273594 | Not Available | 655 | Open in IMG/M |
3300024290|Ga0247667_1055649 | Not Available | 733 | Open in IMG/M |
3300025321|Ga0207656_10313324 | Not Available | 778 | Open in IMG/M |
3300025905|Ga0207685_10280107 | Not Available | 818 | Open in IMG/M |
3300025915|Ga0207693_10792903 | Not Available | 730 | Open in IMG/M |
3300025917|Ga0207660_10112951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2047 | Open in IMG/M |
3300025920|Ga0207649_10683365 | Not Available | 795 | Open in IMG/M |
3300025922|Ga0207646_10450694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1161 | Open in IMG/M |
3300025922|Ga0207646_10697015 | Not Available | 908 | Open in IMG/M |
3300025928|Ga0207700_10816961 | Not Available | 834 | Open in IMG/M |
3300025929|Ga0207664_11152416 | Not Available | 692 | Open in IMG/M |
3300025939|Ga0207665_10414387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 1028 | Open in IMG/M |
3300025960|Ga0207651_10389160 | Not Available | 1183 | Open in IMG/M |
3300026142|Ga0207698_10541704 | Not Available | 1139 | Open in IMG/M |
3300027765|Ga0209073_10181710 | Not Available | 792 | Open in IMG/M |
3300027817|Ga0209112_10059033 | Not Available | 1185 | Open in IMG/M |
3300027855|Ga0209693_10498030 | Not Available | 583 | Open in IMG/M |
3300027879|Ga0209169_10464997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 664 | Open in IMG/M |
3300027908|Ga0209006_10537759 | Not Available | 971 | Open in IMG/M |
3300028536|Ga0137415_10569423 | Not Available | 943 | Open in IMG/M |
3300028718|Ga0307307_10287052 | Not Available | 529 | Open in IMG/M |
3300028879|Ga0302229_10414834 | Not Available | 598 | Open in IMG/M |
3300028884|Ga0307308_10649334 | Not Available | 506 | Open in IMG/M |
3300028906|Ga0308309_11666728 | Not Available | 542 | Open in IMG/M |
3300030490|Ga0302184_10083950 | Not Available | 1469 | Open in IMG/M |
3300031090|Ga0265760_10178269 | Not Available | 709 | Open in IMG/M |
3300031226|Ga0307497_10241199 | Not Available | 803 | Open in IMG/M |
3300031543|Ga0318516_10119062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1504 | Open in IMG/M |
3300031561|Ga0318528_10157463 | Not Available | 1211 | Open in IMG/M |
3300031561|Ga0318528_10452497 | Not Available | 689 | Open in IMG/M |
3300031564|Ga0318573_10252541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 940 | Open in IMG/M |
3300031573|Ga0310915_10837400 | Not Available | 646 | Open in IMG/M |
3300031668|Ga0318542_10187796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 1039 | Open in IMG/M |
3300031681|Ga0318572_10182519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1221 | Open in IMG/M |
3300031681|Ga0318572_10719274 | Not Available | 594 | Open in IMG/M |
3300031708|Ga0310686_101341199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 592 | Open in IMG/M |
3300031723|Ga0318493_10219263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 1009 | Open in IMG/M |
3300031736|Ga0318501_10333517 | Not Available | 813 | Open in IMG/M |
3300031736|Ga0318501_10524606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 647 | Open in IMG/M |
3300031744|Ga0306918_10691833 | Not Available | 798 | Open in IMG/M |
3300031747|Ga0318502_10483791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 741 | Open in IMG/M |
3300031751|Ga0318494_10253037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 1010 | Open in IMG/M |
3300031764|Ga0318535_10020069 | All Organisms → cellular organisms → Bacteria | 2562 | Open in IMG/M |
3300031769|Ga0318526_10012860 | All Organisms → cellular organisms → Bacteria | 2760 | Open in IMG/M |
3300031778|Ga0318498_10335896 | Not Available | 676 | Open in IMG/M |
3300031781|Ga0318547_10009461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4393 | Open in IMG/M |
3300031782|Ga0318552_10224711 | Not Available | 952 | Open in IMG/M |
3300031793|Ga0318548_10427885 | Not Available | 649 | Open in IMG/M |
3300031793|Ga0318548_10446266 | Not Available | 633 | Open in IMG/M |
3300031833|Ga0310917_10223960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 1262 | Open in IMG/M |
3300031879|Ga0306919_11468186 | Not Available | 514 | Open in IMG/M |
3300031894|Ga0318522_10390003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 527 | Open in IMG/M |
3300031896|Ga0318551_10515657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 686 | Open in IMG/M |
3300031897|Ga0318520_10669578 | Not Available | 647 | Open in IMG/M |
3300031910|Ga0306923_10375308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1621 | Open in IMG/M |
3300031954|Ga0306926_10490207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1511 | Open in IMG/M |
3300032009|Ga0318563_10110050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 1461 | Open in IMG/M |
3300032060|Ga0318505_10457479 | Not Available | 603 | Open in IMG/M |
3300032065|Ga0318513_10349626 | Not Available | 720 | Open in IMG/M |
3300032089|Ga0318525_10025081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2869 | Open in IMG/M |
3300032160|Ga0311301_11852810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 714 | Open in IMG/M |
3300032515|Ga0348332_14724161 | Not Available | 1790 | Open in IMG/M |
3300032770|Ga0335085_10887323 | Not Available | 973 | Open in IMG/M |
3300032770|Ga0335085_11777998 | Not Available | 632 | Open in IMG/M |
3300032782|Ga0335082_11232919 | Not Available | 616 | Open in IMG/M |
3300032805|Ga0335078_12230245 | Not Available | 576 | Open in IMG/M |
3300032896|Ga0335075_11333646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
3300033134|Ga0335073_11322756 | Not Available | 711 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.38% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.49% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.05% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.05% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.05% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.38% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.03% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.03% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.03% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.03% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.35% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.35% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.35% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.35% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.35% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.68% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ51221_102241491 | 3300003505 | Forest Soil | IAVLGKLQRVIARGRDYVPDSGRFDVSAPGTPFACAEQSADLLIIEATRRRPV* |
JGIcombinedJ51221_104701112 | 3300003505 | Forest Soil | VMARGRDYVPDSGRFDVSAPGTPFADREHPVGLRLLREATRRRQA* |
Ga0066683_104849212 | 3300005172 | Soil | RRVIARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARAARRRQA* |
Ga0070709_102225771 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRKA* |
Ga0070714_1003841341 | 3300005435 | Agricultural Soil | RDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQV* |
Ga0070714_1008934202 | 3300005435 | Agricultural Soil | RDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQA* |
Ga0070710_111294022 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VIARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRKA* |
Ga0070711_1006633731 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VIARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQA* |
Ga0070708_1004263393 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LHRADPDSGRFDVSAPGTPFADPERSVDLRLLIEANRRRRA* |
Ga0070706_1016139301 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRVIARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLAQATRRRQA* |
Ga0070699_1017802501 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRVIARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLTYATRRRQAQARVSGDGARRR |
Ga0070697_1007495371 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VIARGRDYVPDSGRFDVSAPGSPFAAPEHAIDLRLLTEASRRRTVKR* |
Ga0066661_101774781 | 3300005554 | Soil | ALGQLRRVIARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQV* |
Ga0066698_108986722 | 3300005558 | Soil | QLRRVIARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQV* |
Ga0068857_1001314024 | 3300005577 | Corn Rhizosphere | RVMARGRDYVPDSGRFDVSAPGTPFASPDRAVNLDLLARATRRRQV* |
Ga0070761_100689271 | 3300005591 | Soil | LGKLQRVIARGRDYVPDSGRFDVSAPGTPFASAEQGADLLIIEATRRRPV* |
Ga0068859_1021769232 | 3300005617 | Switchgrass Rhizosphere | RRVIARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLAQATRRRQA* |
Ga0070717_117029831 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQA* |
Ga0070717_121672121 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RVIARGRDYVPDSGRFDVSAPGSPFASPDFRLDTRLVSLATTRRQVPAVAARRR* |
Ga0075015_1006272042 | 3300006102 | Watersheds | RVIARGRDYLPDSGRFDVSAPGTPFASPDHAVDLRLLTEATKRRRA* |
Ga0075018_108544581 | 3300006172 | Watersheds | RDYVPDSGRFDVSAPGTPFASPDHSVNLDLLARATKRRQA* |
Ga0070712_1003855611 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQA* |
Ga0070712_1007089991 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRKA* |
Ga0070765_1013936793 | 3300006176 | Soil | RGRDYVPDSGRFDVSAPGTPFASPDHAVDLRLIHEATRLRQPGGRVRT* |
Ga0074062_130167122 | 3300006606 | Soil | RRVIARGRDYVPDSGRFDVSEPGTPFASPDHAVNLDLLARATRRRQA* |
Ga0079221_105048842 | 3300006804 | Agricultural Soil | DYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQA* |
Ga0075425_1019491341 | 3300006854 | Populus Rhizosphere | RDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATMRRQV* |
Ga0075436_1007286131 | 3300006914 | Populus Rhizosphere | DSGRFDVSAPGTPFASPDRAVNLDLLARATRRRQV* |
Ga0066710_1047840372 | 3300009012 | Grasslands Soil | ITALGRLRRVIARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQV |
Ga0066709_1040038582 | 3300009137 | Grasslands Soil | LRRVIARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARAARRRQA* |
Ga0116214_14111382 | 3300009520 | Peatlands Soil | KLQRVIARGRDYLPDSGRFDVSAPGTPFASPDHAVDLRLLTEATKRRQA* |
Ga0105237_105612883 | 3300009545 | Corn Rhizosphere | RVVARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRKA* |
Ga0116224_101667042 | 3300009683 | Peatlands Soil | DYVPDSGRFDVSAPGTPFADPEHPVDLRLLTEATQRRQV* |
Ga0116216_107475212 | 3300009698 | Peatlands Soil | GRDYVPDSGRFDVSAPGTPFADPEHPVDLRLLTEATQRRQV* |
Ga0116219_105017011 | 3300009824 | Peatlands Soil | IAALGKLQRVIARGRDYLPDSGRFDVSAPGTPFASPDHAVDLRLLTEATKRRQA* |
Ga0126373_112376012 | 3300010048 | Tropical Forest Soil | IARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQA* |
Ga0126373_118714201 | 3300010048 | Tropical Forest Soil | VPDSGRFDVSAPGTPFADPDHPVDMRLITEATRRRRA* |
Ga0127503_102890511 | 3300010154 | Soil | GEWGESDSGRFDVSAPGTPFASPDHSVNLDLLTRATRRRQA* |
Ga0134111_104449052 | 3300010329 | Grasslands Soil | ALGQLRRVIARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQAPP* |
Ga0126372_125005002 | 3300010360 | Tropical Forest Soil | PDSGRFDVSAPGTPFASPDHPVNLDLLTRATRRRQA* |
Ga0126378_129292702 | 3300010361 | Tropical Forest Soil | PDSGRFDVSAPGTPFADPDHHVNLRLITEATRRRRA* |
Ga0126377_130874361 | 3300010362 | Tropical Forest Soil | VPDSGRFDVSAPGTPFASPDHEIDLRLITEATKVRRAPV* |
Ga0136449_1031317412 | 3300010379 | Peatlands Soil | VIARGRDYLPDSGRFDVSAPGTPFASPDHAVDLRLLTEATRRRRA* |
Ga0126361_112916601 | 3300010876 | Boreal Forest Soil | RVIARGRDYLPDSGRFDVSAPGTPFASADHVIDLRLLTEATRRRRV* |
Ga0126350_120920341 | 3300010880 | Boreal Forest Soil | PESGRFDVSAPGTPYADPDRRAHLRQLTEAARRRRL* |
Ga0137365_106457861 | 3300012201 | Vadose Zone Soil | RDYVPDSGRFDVSAPGPPFASPDHAVSLDLLARAARRRQA* |
Ga0137380_1000060129 | 3300012206 | Vadose Zone Soil | VPDSGRFDVSAPGTPFAAPDHNLDLRLLTAARTRRKA* |
Ga0137381_102733131 | 3300012207 | Vadose Zone Soil | RVVARGQDYVPDSGRFDVSAPGTPFASGDHHIDLRLLTAATRRRRIP* |
Ga0137377_112816512 | 3300012211 | Vadose Zone Soil | VIARGRDYLPDSGRFDVSAPGTPFASPDRSIDLRLLTEATRRRQA* |
Ga0137396_110791311 | 3300012918 | Vadose Zone Soil | LRRVIARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQA* |
Ga0157370_110058691 | 3300013104 | Corn Rhizosphere | QLQRVMARGRDYVPDSGRFDVSAPGTPFASPDRAVNLDLLARATRRRQV* |
Ga0157376_126943092 | 3300014969 | Miscanthus Rhizosphere | LSQLRRIMARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQV* |
Ga0132256_1015318722 | 3300015372 | Arabidopsis Rhizosphere | VIARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQV* |
Ga0182034_105505051 | 3300016371 | Soil | RDYVPDSGRFDVSAPGTPFASPDRSVNLDLLTRATRRRQA |
Ga0187812_13024232 | 3300017821 | Freshwater Sediment | ARGRDYVPDSGRFDVSAPGTPFADPDRPVDLRLITKATRRRQAR |
Ga0187807_10488242 | 3300017926 | Freshwater Sediment | GRLRRVIARGRDYVPDSGRFDVSAPGTPFADPDHPVDLRLITAATRRRQA |
Ga0187814_100708502 | 3300017932 | Freshwater Sediment | VIARGRDYVPDSGRFDVSAPGTPFADPEHPVDLRLLTEATQRRQV |
Ga0187814_104255261 | 3300017932 | Freshwater Sediment | VIARGRDYVPDSGRFDVSAPGTPFADPEHPVDLRLLTEATRRRQA |
Ga0187801_103599882 | 3300017933 | Freshwater Sediment | DYVPDSGRFDVSAPGTPFADPDHPVDLRLLSEATRRRQAHS |
Ga0187808_101114932 | 3300017942 | Freshwater Sediment | RLRRVIARGRDYVPDSGRFDVSAPGTPFADPDHPVDLRLITEATRRRQAR |
Ga0187778_110907231 | 3300017961 | Tropical Peatland | RGRDYVPDTGRFDVSEPGTPFARPGASIDLTLLTEARKLRRPS |
Ga0187778_111510662 | 3300017961 | Tropical Peatland | ALGQLRRVVARGRDYVPDSGRFDVSAPGTPFASGEHVDLRLLTEATRRRRA |
Ga0187815_102225032 | 3300018001 | Freshwater Sediment | YVPDSGRFDVSAPGTPFADPDHPVDLRLITEATRRRQAR |
Ga0187766_109841932 | 3300018058 | Tropical Peatland | PDSGRFDVSAPGTPFASPDHVASLRFLTEATRRRRA |
Ga0066667_112009702 | 3300018433 | Grasslands Soil | LRRVIARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLAAATRRRQA |
Ga0193728_13134511 | 3300019890 | Soil | YVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQV |
Ga0210399_111668971 | 3300020581 | Soil | VIARGRDYVPDSGRFDVSAPGTPFASPDGAVNLDLLTRATRRRRA |
Ga0210399_112106281 | 3300020581 | Soil | DSGRFDVSAPGTPFASPDHAVNLDLLTRATRRRQV |
Ga0210395_114027922 | 3300020582 | Soil | GRNYVPDSGRFDVSAPGTPFADPDHRLNLRLLTIATKRRQV |
Ga0210393_102162911 | 3300021401 | Soil | RDYLPDTGRFDVSAPGTPFASPDHVIDLRLLTEATKRRQA |
Ga0210385_100685661 | 3300021402 | Soil | VSRLRRVVARGRNYVPDSGRFDVSAPGTPFADPDHRLNLRLLTIATKRRQV |
Ga0210389_104538781 | 3300021404 | Soil | DYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQAPP |
Ga0210389_105838203 | 3300021404 | Soil | VVARGRDYVPDSGRFDVSAPGTPFASPDHAVDVRRLIEATRLRQPGGRVRPGDP |
Ga0210394_102020061 | 3300021420 | Soil | LRRVVARGRDYVPDSGRFDVSAPGTPFASPDHAVDVRRLIEATRLRQPGGRVR |
Ga0210394_112568971 | 3300021420 | Soil | LGKLQRVIARGRDYLPDTGRFDVSAPGTPFASPDHVIDLRLLTEATRRRQA |
Ga0210402_107297601 | 3300021478 | Soil | LRRVVARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLTRATRRRQV |
Ga0210410_101543541 | 3300021479 | Soil | ARGRDYVPDSGRFDVSAPGTPFASPDHAVDVRRLIEATRLRQPGGRVR |
Ga0210409_101010655 | 3300021559 | Soil | VPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQAPP |
Ga0210409_113488972 | 3300021559 | Soil | AALGKLQRVVARGRDYLPDSGRFDVSAPGTPFASPDHAVDLRLLAMATKRRQA |
Ga0126371_102663374 | 3300021560 | Tropical Forest Soil | YVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQA |
Ga0126371_122735941 | 3300021560 | Tropical Forest Soil | RDYVPDSGRFDVSAPGTPFASPDHFVNLDLLTRATKRRKA |
Ga0247667_10556492 | 3300024290 | Soil | QLRRVMARGRDYVPDSGRFDVSAPGTPFASPDRAVNLDLLARATRRRQV |
Ga0207656_103133241 | 3300025321 | Corn Rhizosphere | VMTRGRDYVPDSGRFDVSAPGTPFASPDRAVNLDLLARATRRRQV |
Ga0207685_102801071 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQV |
Ga0207693_107929031 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RVMARGRDYVPDSGRFDVSAPGTPFASPDRAVNLDLLARATRRRQV |
Ga0207660_101129514 | 3300025917 | Corn Rhizosphere | YVPDSGRFDVSAPGTPFASPDRAVNLDLLARATRRRQV |
Ga0207649_106833652 | 3300025920 | Corn Rhizosphere | YVPDSGRFDVSVPGTPFASPDRAVNLDLLARATRRRQV |
Ga0207646_104506942 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LHRADPDSGRFDVSAPGTPFADPERSVDLRLLIEANRRRRA |
Ga0207646_106970152 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VIARGRDYVPDSGRFDVSAPGTPFASPDHVIDMRLITEATKLRKA |
Ga0207700_108169612 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQA |
Ga0207664_111524161 | 3300025929 | Agricultural Soil | GQLRRVIARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQV |
Ga0207665_104143871 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | IAALGNLRRVLARGQDYVPDSGRFDVSAPGTPYASPDQAIDMQLLTDVTRRRQV |
Ga0207651_103891604 | 3300025960 | Switchgrass Rhizosphere | AALGQLQRVMARGRDYVPDSGRFDVSAPGTPFASPDRAVNLDLLARATRRRQV |
Ga0207698_105417041 | 3300026142 | Corn Rhizosphere | VMARGRDYVPDSGRFDVSAPGTPFASPDRAVNLDLLARATRRRQV |
Ga0209073_101817102 | 3300027765 | Agricultural Soil | RVMVRGGDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQV |
Ga0209112_100590332 | 3300027817 | Forest Soil | GRLRRVVARGRDYVPDSGQFDVSAPGTPFADPGHTPNMDLLRHATQRRQA |
Ga0209693_104980301 | 3300027855 | Soil | LRRVVARGRDYVPDSGRFDVSAPGTPFASPDHAVDLRRLIEATRLRQPGGRVRPGDP |
Ga0209169_104649972 | 3300027879 | Soil | LRRVVARGRDYVPDSGRFDVSAPGTPFASPDHAVDLRLIHEATRVRQPGGGAGRPVPG |
Ga0209006_105377593 | 3300027908 | Forest Soil | LPDSGRFDVAEPGTPFASPEHRVDLRLLTEATRRRQV |
Ga0137415_105694231 | 3300028536 | Vadose Zone Soil | DYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQA |
Ga0307307_102870521 | 3300028718 | Soil | RRVIARGRDYVPDSGRFDVSAPGTPFASPEHAVSLDLLARATRRRQA |
Ga0302229_104148342 | 3300028879 | Palsa | KLHRVIARGRGYLPDSGRFDVSAPGTPYASPGHSVDLRRLTEATRRRQA |
Ga0307308_106493341 | 3300028884 | Soil | LGQLRRVIARGRDYVPDSGRFDVSAPGTPFASPEHAVNLDLLTRATRRRQA |
Ga0308309_116667281 | 3300028906 | Soil | RRVIARGRDYVPDSGRFDVSAPGTPFASPDHTVNLDLLARATRRRQA |
Ga0302184_100839501 | 3300030490 | Palsa | RGRGYLPDSGRFDVSAPGTPYASPGHSVDLRRLTEATRRRQA |
Ga0265760_101782691 | 3300031090 | Soil | DSGRFDVSAPGTPFASPDHAIDLRLLTAATRRRQA |
Ga0307497_102411992 | 3300031226 | Soil | ALGQLRRVIARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQV |
Ga0318516_101190622 | 3300031543 | Soil | LRRVIARGRDYVPDTGRFDVSAPGTPFADPDHHVDLRLITEATRRRHV |
Ga0318528_101574633 | 3300031561 | Soil | LRRVIGRGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQA |
Ga0318528_104524971 | 3300031561 | Soil | ITAIGRLQRVIARGRDYVPDSGRFDVSTPGTPFASPDHTVNLDLLTRATRRRQA |
Ga0318573_102525411 | 3300031564 | Soil | VAALGRLRRVIARGRDYVPDSGRFDVSAPGTPFADPDRLVDLRLIIEATRRRRA |
Ga0310915_108374001 | 3300031573 | Soil | RDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQA |
Ga0318542_101877962 | 3300031668 | Soil | VIARGRDYVPDTGRFDVSAPGTPFADPDHPVDLRLITEATRRRQA |
Ga0318572_101825191 | 3300031681 | Soil | TAVGRLRRVIARGRDYVPDTGRFDVSAPGTPFADPDHHVDLRLITEATRRRHV |
Ga0318572_107192742 | 3300031681 | Soil | GRLRRVIARGRDYVPDSGRFDVSTPGTPFASPDHTVNLDLLTRATRRRQA |
Ga0310686_1013411991 | 3300031708 | Soil | DSGRFDVSAPGTPYASNPAALNLRLLTEATRPRQP |
Ga0318493_102192632 | 3300031723 | Soil | DSGRFDVSAPGTPFADPDHPVDLRLITEATRRRPA |
Ga0318501_103335172 | 3300031736 | Soil | RRVIARGRDYVPDSGNFDVSAPGTPFASPDHTVNLDLLTRATARRRV |
Ga0318501_105246062 | 3300031736 | Soil | YVPDSGRFDVSAPGTPFADPDHPVDLRLITEATRRRPA |
Ga0306918_106918331 | 3300031744 | Soil | DYMPDSGRFDVSAPGTPFASPDRSVNLDLLTRATRRRQA |
Ga0318502_104837912 | 3300031747 | Soil | YLPDSGRFDVSAPGTPFASPDHTVNLDLLTRATRRRQA |
Ga0318494_102530372 | 3300031751 | Soil | RDYVPDTGRFDVSAPGTPFADPDHPVDLRLITEATRRRQA |
Ga0318535_100200695 | 3300031764 | Soil | QLRRVIGRGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQA |
Ga0318526_100128603 | 3300031769 | Soil | YVPDTGRFDVSAPGTPFADPDHHVDLRLITEATRRRHI |
Ga0318498_103358962 | 3300031778 | Soil | LRRVIARGRDYMPDSGRFDVSAPGTPFASPDRSVNLDLLTRATRRRQA |
Ga0318547_100094614 | 3300031781 | Soil | PDTGRFDVSAPGTPFADPDHPVDLRLITEATRRRQA |
Ga0318552_102247112 | 3300031782 | Soil | DITAVGRLRRVIARGRDYVPDTGRFDVSAPGTPFADPDHHVDLRLITEATRRRHV |
Ga0318548_104278851 | 3300031793 | Soil | GRDYVPDSGRFDVSAPGTPFADPGNRVNLRLITEATRRRRA |
Ga0318548_104462662 | 3300031793 | Soil | LRRVIARGRDYVPDSGRFDVSTPGTPFASPDHTVNLDLLTRATRRRQA |
Ga0310917_102239601 | 3300031833 | Soil | RGRDYVPDTGRFDVSAPGTPFADPDHPVDLRLITEATRRRQV |
Ga0306919_114681862 | 3300031879 | Soil | RVIARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLTRATRRRQV |
Ga0318522_103900031 | 3300031894 | Soil | RLRRVIARGRDYVPDSGRFDVSAPGTPLADPAYRVDLPLLARHARRRKAT |
Ga0318551_105156571 | 3300031896 | Soil | VIARGRDYVPDSGRFDVSAPGTPFADPDHPVDLRLITEATRRRPA |
Ga0318520_106695782 | 3300031897 | Soil | AIGRLRRVIARGRDYVPDSGRFDVSTPGTPFASPDHTVNLDLLTRATRRRQA |
Ga0306923_103753081 | 3300031910 | Soil | LPDSGRFDVSAPGTPFASPGHTVNLDLLTRATRRRQA |
Ga0306926_104902072 | 3300031954 | Soil | ARGRDYVPDTGRFDVSAPGTPFADPDHHVDLRLITEATRRRHV |
Ga0318563_101100502 | 3300032009 | Soil | RGRDYVPDTGRFDVSAPGTPFADPDHPVDLRLITEATRRRQA |
Ga0318505_104574791 | 3300032060 | Soil | VIARGRDYVPDSGRFDVSAPGTPFASPDHAVNLDLLARATRRRQA |
Ga0318513_103496261 | 3300032065 | Soil | PDSGRFDVSAPGTPFASPDRSVNLDLLTRATRRRQA |
Ga0318525_100250811 | 3300032089 | Soil | RDYVPDGGRFDVSAPGTPFASPGHTVNLDLLTHATRRRQA |
Ga0311301_118528102 | 3300032160 | Peatlands Soil | LTRLRRVIARGRDYVPDSGRFDVSAPGTPLADPAYRVNLPLLARHARRRKAT |
Ga0348332_147241611 | 3300032515 | Plant Litter | VIARGRDYVPDSGRFDVSAPGTPFASAEQGADLLIIEATRRRPV |
Ga0335085_108873232 | 3300032770 | Soil | GYLPDSGRFDVSAPGTPFASPDHTVNLSLLTEATRRRQA |
Ga0335085_117779982 | 3300032770 | Soil | YLPDSGRFDVSAPGTPFASPGHAVNLDLITEATRRRRA |
Ga0335082_112329192 | 3300032782 | Soil | RDYLPDSGRFDVSAPGTPFASPDHTVNLGLLTEATRRRQARRG |
Ga0335078_122302451 | 3300032805 | Soil | ARGRDYVPDSGRFDVSAPGTPFASAEQGADLLITEATKRRPA |
Ga0335075_113336462 | 3300032896 | Soil | VRVVARGRDYVPDSGRFDVSAPGTPFASGAGAVDIQRIKELTKRRQPPAQNDIST |
Ga0335073_113227562 | 3300033134 | Soil | MARGRDYVPDSGRFDVSAPGTPFASPDRAVNLDLLARATRLRQV |
⦗Top⦘ |