Basic Information | |
---|---|
Family ID | F048510 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 148 |
Average Sequence Length | 37 residues |
Representative Sequence | MQRVRSLLRSTPSRIGRRIAQFVAIAAASLPDAGA |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 148 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 69.23 % |
% of genes near scaffold ends (potentially truncated) | 27.70 % |
% of genes from short scaffolds (< 2000 bps) | 75.68 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.784 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.568 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.351 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.946 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 148 Family Scaffolds |
---|---|---|
PF02518 | HATPase_c | 22.30 |
PF02826 | 2-Hacid_dh_C | 20.27 |
PF08521 | 2CSK_N | 5.41 |
PF00486 | Trans_reg_C | 3.38 |
PF12833 | HTH_18 | 2.70 |
PF01145 | Band_7 | 2.03 |
PF13420 | Acetyltransf_4 | 2.03 |
PF03466 | LysR_substrate | 2.03 |
PF07729 | FCD | 1.35 |
PF13278 | Obsolete Pfam Family | 1.35 |
PF03972 | MmgE_PrpD | 1.35 |
PF00920 | ILVD_EDD | 1.35 |
PF03401 | TctC | 0.68 |
PF00106 | adh_short | 0.68 |
PF01494 | FAD_binding_3 | 0.68 |
PF00389 | 2-Hacid_dh | 0.68 |
PF12700 | HlyD_2 | 0.68 |
PF02776 | TPP_enzyme_N | 0.68 |
PF13407 | Peripla_BP_4 | 0.68 |
COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
---|---|---|---|
COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 5.41 |
COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 2.70 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.35 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.35 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 1.35 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.35 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.68 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.68 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.68 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.78 % |
Unclassified | root | N/A | 16.22 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459004|F62QY1Z02HP3CQ | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
2170459010|GIO7OMY02HCBD0 | Not Available | 509 | Open in IMG/M |
3300001661|JGI12053J15887_10284094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 813 | Open in IMG/M |
3300001686|C688J18823_10502489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 778 | Open in IMG/M |
3300001867|JGI12627J18819_10090961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1263 | Open in IMG/M |
3300004799|Ga0058863_11534226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 546 | Open in IMG/M |
3300005434|Ga0070709_10255624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1264 | Open in IMG/M |
3300005437|Ga0070710_10980211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 615 | Open in IMG/M |
3300005529|Ga0070741_10063401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 4266 | Open in IMG/M |
3300005529|Ga0070741_10320155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1449 | Open in IMG/M |
3300005529|Ga0070741_10362385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1342 | Open in IMG/M |
3300005529|Ga0070741_10460606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1157 | Open in IMG/M |
3300005533|Ga0070734_10017078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 4931 | Open in IMG/M |
3300005533|Ga0070734_10056197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2371 | Open in IMG/M |
3300005533|Ga0070734_10464695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 721 | Open in IMG/M |
3300005537|Ga0070730_10000079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 124437 | Open in IMG/M |
3300005548|Ga0070665_100064194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 3682 | Open in IMG/M |
3300005563|Ga0068855_100191514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2306 | Open in IMG/M |
3300005563|Ga0068855_100298893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1783 | Open in IMG/M |
3300005563|Ga0068855_100362388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 1595 | Open in IMG/M |
3300005563|Ga0068855_100418163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1467 | Open in IMG/M |
3300005577|Ga0068857_101741209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 609 | Open in IMG/M |
3300005598|Ga0066706_10961876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 661 | Open in IMG/M |
3300005610|Ga0070763_10359132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 812 | Open in IMG/M |
3300005614|Ga0068856_102433999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 531 | Open in IMG/M |
3300005764|Ga0066903_100161736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 3248 | Open in IMG/M |
3300005764|Ga0066903_101330210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1344 | Open in IMG/M |
3300005764|Ga0066903_108800553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 512 | Open in IMG/M |
3300005921|Ga0070766_10113897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1618 | Open in IMG/M |
3300005944|Ga0066788_10007805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2209 | Open in IMG/M |
3300006028|Ga0070717_10833697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 839 | Open in IMG/M |
3300006028|Ga0070717_11225275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 683 | Open in IMG/M |
3300006028|Ga0070717_11555669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 600 | Open in IMG/M |
3300006041|Ga0075023_100015163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2059 | Open in IMG/M |
3300006173|Ga0070716_100520465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 881 | Open in IMG/M |
3300006354|Ga0075021_10202393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1212 | Open in IMG/M |
3300006755|Ga0079222_10218380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1165 | Open in IMG/M |
3300006804|Ga0079221_10046706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 1921 | Open in IMG/M |
3300006893|Ga0073928_10714069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 698 | Open in IMG/M |
3300007265|Ga0099794_10243569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 926 | Open in IMG/M |
3300009093|Ga0105240_10141693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 2873 | Open in IMG/M |
3300009093|Ga0105240_10741509 | Not Available | 1069 | Open in IMG/M |
3300009093|Ga0105240_11961860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
3300009093|Ga0105240_12193240 | Not Available | 573 | Open in IMG/M |
3300009143|Ga0099792_10400017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 840 | Open in IMG/M |
3300009551|Ga0105238_10003445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 15739 | Open in IMG/M |
3300009660|Ga0105854_1070930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1068 | Open in IMG/M |
3300010046|Ga0126384_12294444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 521 | Open in IMG/M |
3300010154|Ga0127503_10969069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 625 | Open in IMG/M |
3300010159|Ga0099796_10108041 | Not Available | 1056 | Open in IMG/M |
3300010361|Ga0126378_10012457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 7042 | Open in IMG/M |
3300010366|Ga0126379_11301423 | Not Available | 833 | Open in IMG/M |
3300010366|Ga0126379_11951327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 690 | Open in IMG/M |
3300010376|Ga0126381_104708151 | Not Available | 525 | Open in IMG/M |
3300010376|Ga0126381_104957959 | Not Available | 511 | Open in IMG/M |
3300010379|Ga0136449_102197076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 805 | Open in IMG/M |
3300010867|Ga0126347_1424515 | Not Available | 523 | Open in IMG/M |
3300011269|Ga0137392_10221573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1552 | Open in IMG/M |
3300012200|Ga0137382_10264619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1194 | Open in IMG/M |
3300012201|Ga0137365_11355295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 502 | Open in IMG/M |
3300012207|Ga0137381_10993861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 724 | Open in IMG/M |
3300012212|Ga0150985_117818804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 668 | Open in IMG/M |
3300012923|Ga0137359_10198559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1792 | Open in IMG/M |
3300013104|Ga0157370_10127920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2371 | Open in IMG/M |
3300014657|Ga0181522_10469832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 756 | Open in IMG/M |
3300017944|Ga0187786_10130989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 884 | Open in IMG/M |
3300017947|Ga0187785_10014260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2747 | Open in IMG/M |
3300017947|Ga0187785_10424639 | Not Available | 645 | Open in IMG/M |
3300018035|Ga0187875_10603709 | Not Available | 579 | Open in IMG/M |
3300020076|Ga0206355_1265808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 842 | Open in IMG/M |
3300020170|Ga0179594_10000536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 8470 | Open in IMG/M |
3300020170|Ga0179594_10368945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 545 | Open in IMG/M |
3300020199|Ga0179592_10007508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4672 | Open in IMG/M |
3300020579|Ga0210407_10039254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3521 | Open in IMG/M |
3300020580|Ga0210403_10524159 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300021086|Ga0179596_10073453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1491 | Open in IMG/M |
3300021086|Ga0179596_10721392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 504 | Open in IMG/M |
3300021088|Ga0210404_10637380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 606 | Open in IMG/M |
3300021168|Ga0210406_10404745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1093 | Open in IMG/M |
3300021374|Ga0213881_10018325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2889 | Open in IMG/M |
3300021374|Ga0213881_10086202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1351 | Open in IMG/M |
3300021384|Ga0213876_10045145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2331 | Open in IMG/M |
3300021384|Ga0213876_10189175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1095 | Open in IMG/M |
3300021384|Ga0213876_10374929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 757 | Open in IMG/M |
3300021403|Ga0210397_10434818 | Not Available | 986 | Open in IMG/M |
3300021403|Ga0210397_10967592 | Not Available | 660 | Open in IMG/M |
3300021404|Ga0210389_11233506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300021407|Ga0210383_11672910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 522 | Open in IMG/M |
3300021478|Ga0210402_10324842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 1426 | Open in IMG/M |
3300021560|Ga0126371_10104644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 2826 | Open in IMG/M |
3300021560|Ga0126371_10497253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1367 | Open in IMG/M |
3300021560|Ga0126371_12281788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 654 | Open in IMG/M |
3300022467|Ga0224712_10373746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 676 | Open in IMG/M |
3300022508|Ga0222728_1057829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 665 | Open in IMG/M |
3300022510|Ga0242652_1042239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 557 | Open in IMG/M |
3300022511|Ga0242651_1051469 | Not Available | 510 | Open in IMG/M |
3300022512|Ga0242676_1019427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 697 | Open in IMG/M |
3300022529|Ga0242668_1044630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 772 | Open in IMG/M |
3300022722|Ga0242657_1166966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 590 | Open in IMG/M |
3300024271|Ga0224564_1124984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
3300024288|Ga0179589_10003471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3967 | Open in IMG/M |
3300025898|Ga0207692_10578619 | Not Available | 720 | Open in IMG/M |
3300025906|Ga0207699_10743156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 719 | Open in IMG/M |
3300025909|Ga0207705_10365661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1113 | Open in IMG/M |
3300025910|Ga0207684_10221974 | Not Available | 1631 | Open in IMG/M |
3300025911|Ga0207654_11121999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 573 | Open in IMG/M |
3300025912|Ga0207707_10000088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 90991 | Open in IMG/M |
3300025912|Ga0207707_10026854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5031 | Open in IMG/M |
3300025912|Ga0207707_10044581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3867 | Open in IMG/M |
3300025917|Ga0207660_10603884 | Not Available | 894 | Open in IMG/M |
3300025920|Ga0207649_11050636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 642 | Open in IMG/M |
3300025944|Ga0207661_10004757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 9507 | Open in IMG/M |
3300025949|Ga0207667_10504175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1227 | Open in IMG/M |
3300026078|Ga0207702_11812903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 602 | Open in IMG/M |
3300026215|Ga0209849_1015176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1277 | Open in IMG/M |
3300027307|Ga0209327_1074169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 503 | Open in IMG/M |
3300027517|Ga0209113_1011530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1111 | Open in IMG/M |
3300027645|Ga0209117_1000325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 23230 | Open in IMG/M |
3300027725|Ga0209178_1033564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 1618 | Open in IMG/M |
3300027826|Ga0209060_10008467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 6479 | Open in IMG/M |
3300027826|Ga0209060_10386627 | Not Available | 637 | Open in IMG/M |
3300027857|Ga0209166_10514194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 614 | Open in IMG/M |
3300027894|Ga0209068_10034209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2529 | Open in IMG/M |
3300030981|Ga0102770_11191792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 653 | Open in IMG/M |
3300031057|Ga0170834_101482598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1600 | Open in IMG/M |
3300031231|Ga0170824_111248910 | Not Available | 880 | Open in IMG/M |
3300031544|Ga0318534_10001163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 10148 | Open in IMG/M |
3300031545|Ga0318541_10706590 | Not Available | 563 | Open in IMG/M |
3300031573|Ga0310915_10005607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 6986 | Open in IMG/M |
3300031668|Ga0318542_10156508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1135 | Open in IMG/M |
3300031708|Ga0310686_119605813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2652 | Open in IMG/M |
3300031716|Ga0310813_11521009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
3300031719|Ga0306917_10510079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 945 | Open in IMG/M |
3300031771|Ga0318546_10304362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1104 | Open in IMG/M |
3300031782|Ga0318552_10340869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
3300031893|Ga0318536_10260000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 882 | Open in IMG/M |
3300031897|Ga0318520_10911289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 554 | Open in IMG/M |
3300031941|Ga0310912_10207262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1500 | Open in IMG/M |
3300031962|Ga0307479_10735236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 965 | Open in IMG/M |
3300032160|Ga0311301_12612369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
3300032828|Ga0335080_10267297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1865 | Open in IMG/M |
3300032892|Ga0335081_12737372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 502 | Open in IMG/M |
3300033134|Ga0335073_11736299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 587 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.57% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.14% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.08% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.08% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.41% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.05% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.38% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.03% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.03% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.03% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.03% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.03% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 2.03% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.35% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.35% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.35% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.35% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.35% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.35% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.35% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.35% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.68% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.68% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.68% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.68% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300030981 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E4B_03617960 | 2170459004 | Grass Soil | MQRVRSLLRSTPSRIGRRIAQFVAIAAASLPDAGA |
F62_08809320 | 2170459010 | Grass Soil | MQRVRSLLRATPGRISRRIAQFVAIAAASLPDAGA |
JGI12053J15887_102840941 | 3300001661 | Forest Soil | MQRVRSLLRATPAEIGRRFAQFVAIAAASLPDVGA* |
C688J18823_105024892 | 3300001686 | Soil | MRRLRSLLRSTPSRIGRRLAAIVTIAAASLPTAGV* |
JGI12627J18819_100909611 | 3300001867 | Forest Soil | MQRVASLLRSTPSRIGRRIAQFVAIAAASLPDVGA* |
JGI12627J18819_101001812 | 3300001867 | Forest Soil | MILRAPEDISMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA* |
Ga0058863_115342262 | 3300004799 | Host-Associated | FLPRGERILVMKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA* |
Ga0070709_102556241 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PGHGRVLIMQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA* |
Ga0070710_109802112 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EDISMERVRSFLRSTPSRVSRRIAQFVAIAAASLPDAGA* |
Ga0070741_100634013 | 3300005529 | Surface Soil | MERVRSLLRSTPSRISRGIARFVALAAASLPDAGA* |
Ga0070741_103201552 | 3300005529 | Surface Soil | MQRVRSLLRTTPSRIRDRIAPFVAIAAASLPDGGA* |
Ga0070741_103623852 | 3300005529 | Surface Soil | MQRVRSLLRTTPHLIKSRIAQFVAIAAASLPDAGV* |
Ga0070741_104606061 | 3300005529 | Surface Soil | MERVRSLLRSTPSRLGRRIAQIVAIAAASLPDAGA* |
Ga0070734_100170784 | 3300005533 | Surface Soil | MSMARINRLLRSAPSRIGRRIAQFVAIAAASLPDAGA* |
Ga0070734_100561973 | 3300005533 | Surface Soil | MERVRSLLRSTPSRLGRRIAQIVAIAAASLPEAGA* |
Ga0070734_104646952 | 3300005533 | Surface Soil | MSMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA* |
Ga0070730_1000007947 | 3300005537 | Surface Soil | MERVRSLLRSTPKLRRRIAELVAIAAASLPDAGA* |
Ga0070665_1000641942 | 3300005548 | Switchgrass Rhizosphere | MERVRSLLRSTPSRISRRIAQFVAIAAASLPDAGA* |
Ga0068855_1001915141 | 3300005563 | Corn Rhizosphere | PRRRRRVFGMQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA* |
Ga0068855_1002988931 | 3300005563 | Corn Rhizosphere | MLRVRSLLRSTPSRIGRRIAGFVAIAAASLPDAGA* |
Ga0068855_1003623882 | 3300005563 | Corn Rhizosphere | MEWVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA* |
Ga0068855_1004181632 | 3300005563 | Corn Rhizosphere | MKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA* |
Ga0068857_1017412091 | 3300005577 | Corn Rhizosphere | MERVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA* |
Ga0066706_109618762 | 3300005598 | Soil | MRRVRSLLRATPAQIGRRLAQFVAIAAASLPDVGA* |
Ga0070763_103591322 | 3300005610 | Soil | MRRVHSLLRSAPARIGRRFAQFVAIAAASLPVAGA* |
Ga0068856_1024339991 | 3300005614 | Corn Rhizosphere | MERVRSLLRSTPSLIGRRIAQFVAIAAASLPEAGA* |
Ga0066903_1001617363 | 3300005764 | Tropical Forest Soil | MQRVRSLLRTTPSRISRRIAELVAIAAASLPDAGA* |
Ga0066903_1013302102 | 3300005764 | Tropical Forest Soil | MLRITSFMRSTPSRIGRRIAQFVAIAAASLPAVGA* |
Ga0066903_1088005532 | 3300005764 | Tropical Forest Soil | MQRVRSLLRATPGRISRRIAQFVAIAAASLPAAGA* |
Ga0070766_101138972 | 3300005921 | Soil | MRRVNSLLRSAPARIGRRFAQFVAIAAASLPIAGA* |
Ga0066788_100078052 | 3300005944 | Soil | MQRVRSLLRAAPSHIGRGIARFVAIAAASLPDVGA* |
Ga0081540_10094532 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MARVRKLLQTAPSRIGRRFAQFVAIAAASLPSAGA* |
Ga0070717_108336971 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRVASLLRSTPRRIGRRFAQFVAIAAASLPEVGA* |
Ga0070717_112252753 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | REDISMERVRSLLRKTPSRISRGIARFVAIAAASLPDAGA* |
Ga0070717_115556691 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRVRSLLRSTPSRISRGIARFVAIAAASLPGAGA* |
Ga0075023_1000151632 | 3300006041 | Watersheds | MKKVRSLLAAAPSRIGRRIAQFVAIAAASLPSAGA* |
Ga0070716_1005204651 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA* |
Ga0075021_102023932 | 3300006354 | Watersheds | MRKVGSLLRAAPSRIGRRLAALVAIAAASLPDAGA* |
Ga0079222_102183803 | 3300006755 | Agricultural Soil | MERVRSLLRKTPSRIGRGIARFVAIAAASLPDAGA* |
Ga0079221_100467063 | 3300006804 | Agricultural Soil | MQRVRSLLRSAPFRLRRRLKLIVAIAAASLPDVGA* |
Ga0073928_107140691 | 3300006893 | Iron-Sulfur Acid Spring | MRRVNSLLRSAPARIGRRLARFVAIAAASLPVAGA* |
Ga0099794_102435692 | 3300007265 | Vadose Zone Soil | MRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA* |
Ga0105240_101416932 | 3300009093 | Corn Rhizosphere | MQRVASLLRSTPRRIGREIARFVAIAAASLPEVGA* |
Ga0105240_107415092 | 3300009093 | Corn Rhizosphere | MQRVRALLRTAPSRIKNRIAQFVAIAAASLPDAGA* |
Ga0105240_119618601 | 3300009093 | Corn Rhizosphere | MQRVRSLLRTAPSRIKNRIAQFVAIAAASLPDAGA* |
Ga0105240_121932401 | 3300009093 | Corn Rhizosphere | MQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA* |
Ga0099792_104000171 | 3300009143 | Vadose Zone Soil | MEGIGQMRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA* |
Ga0105238_1000344510 | 3300009551 | Corn Rhizosphere | MERVRSLLRSTPSRISRRIAQFVAIVAASLPDAGA* |
Ga0105854_10709303 | 3300009660 | Permafrost Soil | MQRVRSLLRGAPSHIGRGIARFVAIAAASLPDVGA* |
Ga0126384_122944442 | 3300010046 | Tropical Forest Soil | MSMARINRLLRAAPARIGQRIAQFVAIAAASLPDAGA* |
Ga0127503_109690691 | 3300010154 | Soil | KSCAGEGIGQMRRVRSLLLATPAQIGRRFAQFVAIAAASLPDVGA* |
Ga0099796_101080413 | 3300010159 | Vadose Zone Soil | MRRVASLLRATPAQIGRRLAQLVAIAAASLPEVGA* |
Ga0126378_100124576 | 3300010361 | Tropical Forest Soil | VARKDILMQRVRSLLRTTPSRISRRIAELVAIAAASLPDAGA* |
Ga0126379_113014232 | 3300010366 | Tropical Forest Soil | MQRVRSLLWAAPAQIGRRFARFVAIAAASLPDVGA* |
Ga0126379_119513271 | 3300010366 | Tropical Forest Soil | QMQQVPSLLRTAPAEIGRRLARLVAIAAASLPDVGA* |
Ga0126381_1047081512 | 3300010376 | Tropical Forest Soil | MQKVASLLRSTPRRISRRFAQFVAIAAASLPEVGA* |
Ga0126381_1049579591 | 3300010376 | Tropical Forest Soil | MFIMQRVASLLRSTPRRISRRIAQFVAIAAASLPDVGA* |
Ga0136449_1021970762 | 3300010379 | Peatlands Soil | MRRVNSLLRSAQERIRRGIAQFVAIAAASLPAVGA* |
Ga0126347_14245152 | 3300010867 | Boreal Forest Soil | QMLRVRSLLRAAPAQIGRRLAQLVAIAAASLPEVGA* |
Ga0137392_102215731 | 3300011269 | Vadose Zone Soil | MRRVRSLLRVTPAQIGRRLAQLVAIAAASLPDVGA* |
Ga0137382_102646191 | 3300012200 | Vadose Zone Soil | MRQLASLLRSTPSRIGRRLALIVAIAAASLPTAGA* |
Ga0137365_113552952 | 3300012201 | Vadose Zone Soil | MRQLASLLRSTPSRIGRRLALIVAIAAASLPTAGA |
Ga0137363_100516232 | 3300012202 | Vadose Zone Soil | VGGPYNGAEGIGQMRRVRSLLRVTPAQIGRRLAQLVAIAAASLPDVGA* |
Ga0137381_109938612 | 3300012207 | Vadose Zone Soil | MQRVHSLLRSTRARIGRQLALIVAIAAASLPDAGA* |
Ga0150985_1178188041 | 3300012212 | Avena Fatua Rhizosphere | LMGARGYFMQKVRSLLRLTPSRISRGFARFVAIAAASLPDAGA* |
Ga0137359_101985591 | 3300012923 | Vadose Zone Soil | QMRRVRSLLRSTPAQIGRRLVQLVAIAAASLPDVGA* |
Ga0157370_101279203 | 3300013104 | Corn Rhizosphere | MQRIRSLLRSARVRISRRITQLVAIAAASLPDVGA* |
Ga0181522_104698323 | 3300014657 | Bog | SMQRVNSLLRSAQERIRRGIAQFVAIAAASLPAVGA* |
Ga0187786_101309892 | 3300017944 | Tropical Peatland | MQRVTSLLRATPSRIRRRIARFVAIAAASLPDVGA |
Ga0187785_100142602 | 3300017947 | Tropical Peatland | MARINKLLRSAPSRIGQRIAQFVAIAAASLPDAGA |
Ga0187785_104246392 | 3300017947 | Tropical Peatland | MQRVTSLLRATPSRIRRRIAQFVAIAAASLPDVGA |
Ga0187875_106037091 | 3300018035 | Peatland | MRQFSSLLRSARSRIGRGLAQFVAIAAASLPVAGV |
Ga0206355_12658083 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRVASLLRSTPRRIGREIARFVAIAAASLPEVGA |
Ga0179594_100005361 | 3300020170 | Vadose Zone Soil | MEGIGQMRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA |
Ga0179594_103689452 | 3300020170 | Vadose Zone Soil | SCNGAEGIGQMRRVASLLRATPAQIGRRLAQLVAIAAASLPEVGA |
Ga0179592_100075084 | 3300020199 | Vadose Zone Soil | MRRVASLLRATPAQIGRRLAQLVAIAAASLPEVGA |
Ga0210407_100392544 | 3300020579 | Soil | MQQLRLLLRDAPAQIGRRFARFVAIAAASLPDAGA |
Ga0210403_105241592 | 3300020580 | Soil | MQQLRALLRKTPSRLRRRIAEFVAIAAASLPAAGA |
Ga0179596_100734533 | 3300021086 | Vadose Zone Soil | MRRVRSLLRVTPAQIGRRLAQLVAIAAASLPDVGA |
Ga0179596_107213921 | 3300021086 | Vadose Zone Soil | MRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA |
Ga0210404_106373803 | 3300021088 | Soil | QFLPRRGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA |
Ga0210406_104047452 | 3300021168 | Soil | MERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA |
Ga0213881_100183254 | 3300021374 | Exposed Rock | MQRVASLLRATPGRISRRLAQFVAIAAASLPEVGA |
Ga0213881_100862022 | 3300021374 | Exposed Rock | MERVRSLLRATPSRISRRIAQFVAIAAASLPDAGA |
Ga0213876_100451452 | 3300021384 | Plant Roots | MQKVRSLLRSTPSRISRGIARFVAIAAASLPDVGA |
Ga0213876_101891752 | 3300021384 | Plant Roots | MQRVASLLRATPRRISQRFAQFVAIAAASLPEVGA |
Ga0213876_103749292 | 3300021384 | Plant Roots | MSMERVRSLLRSTPRRISRHIARFVAIAAASLPDAGA |
Ga0210397_104348182 | 3300021403 | Soil | PEDISMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA |
Ga0210397_109675922 | 3300021403 | Soil | MSMERVRSLLRSTPTRISRHIARFVAIAAASLPDAGA |
Ga0210389_112335062 | 3300021404 | Soil | MHRVNSLLRLAQERIRRGVAQFVAIAAASLPAVGA |
Ga0210383_116729101 | 3300021407 | Soil | MRRVNSLLRSAPARIGRRLARFVAIAAASLPVAGA |
Ga0210402_103248423 | 3300021478 | Soil | MQRVRSLLRTTPGRISRRIAQFVAIAAASLPDAGA |
Ga0126371_101046444 | 3300021560 | Tropical Forest Soil | MQRVRSLLRTTPSRISRRIAELVAIAAASLPDAGA |
Ga0126371_104972532 | 3300021560 | Tropical Forest Soil | MLRITSFMRSTPSRIGRRIAQFVAIAAASLPAVGA |
Ga0126371_122817881 | 3300021560 | Tropical Forest Soil | SARWSFVMQGVRSLLRATPGRISRRIAQFVAIAAASLPAAGA |
Ga0224712_103737461 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | QFLPRGERILVMKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA |
Ga0242642_10845092 | 3300022504 | Soil | EQVPRGAEGIGQMQRVRSLVLAAPAQIRRRLARLVAIAAASLPDVGA |
Ga0222728_10578293 | 3300022508 | Soil | LVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA |
Ga0242652_10422391 | 3300022510 | Soil | HGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA |
Ga0242651_10514691 | 3300022511 | Soil | LPRHGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA |
Ga0242676_10194273 | 3300022512 | Soil | HFLSWHGRITVMQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA |
Ga0242668_10446301 | 3300022529 | Soil | RHGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA |
Ga0242657_11669661 | 3300022722 | Soil | MEIPMRRVNSLLRSAPARIGRRLARFVAIAAASLPVAGA |
Ga0224564_11249842 | 3300024271 | Soil | MQRVNSLLRSAPAQIMRGIAYFVAIAAASLPAAGA |
Ga0179589_100034713 | 3300024288 | Vadose Zone Soil | MRRVASLLRATPAQIGRRLAQLVAIAAASLPEAGA |
Ga0207692_105786191 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MERVRSLLRSTPSRIGRGIARFVAIAAASLPDVGA |
Ga0207699_107431563 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ISCPGHGRVLIMQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA |
Ga0207705_103656613 | 3300025909 | Corn Rhizosphere | MQRVRALLRTAPSRIKNRIAQFVAIAAASLPDAGA |
Ga0207684_102219743 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRVRLLLRATPTQIGRHLAQFVAIAAASLPDVGA |
Ga0207654_111219992 | 3300025911 | Corn Rhizosphere | MLRVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA |
Ga0207707_1000008872 | 3300025912 | Corn Rhizosphere | MLRVRSLLRSTPSRIGRRIAGFVAIAAASLPDAGA |
Ga0207707_100268543 | 3300025912 | Corn Rhizosphere | MERVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA |
Ga0207707_100445815 | 3300025912 | Corn Rhizosphere | MQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA |
Ga0207660_106038843 | 3300025917 | Corn Rhizosphere | MKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA |
Ga0207649_110506361 | 3300025920 | Corn Rhizosphere | MEWVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA |
Ga0207661_100047576 | 3300025944 | Corn Rhizosphere | MQRVRSLLRTTPSRIKNRIAQFVAIAAASLPDAGA |
Ga0207667_105041751 | 3300025949 | Corn Rhizosphere | PRRRRRVFGMQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA |
Ga0207702_118129031 | 3300026078 | Corn Rhizosphere | GFCEMERVRSLLRSTPSLIGRRIAQFVAIAAASLPEAGA |
Ga0209849_10151763 | 3300026215 | Soil | MQRVRSLLRAAPSHIGRGIARFVAIAAASLPDVGA |
Ga0209111_10231482 | 3300027058 | Forest Soil | MILRAPEDISMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA |
Ga0209327_10741691 | 3300027307 | Forest Soil | GARKDIGMERVRSLLRSTPSRISRRIAQFVAIAAASLPDAGA |
Ga0209113_10115302 | 3300027517 | Forest Soil | MQQVAVLLRKAPSRIGQRIAQLVAIAAASLPDVGA |
Ga0209117_10003259 | 3300027645 | Forest Soil | MQQLRSLLRATPSRIGRRLAVIVAIAAASLPAAGA |
Ga0209178_10335643 | 3300027725 | Agricultural Soil | MQRVRSLLRSAPFRLRRRLKLIVAIAAASLPDVGA |
Ga0209060_100084674 | 3300027826 | Surface Soil | MSMARINRLLRSAPSRIGRRIAQFVAIAAASLPDAGA |
Ga0209060_103866272 | 3300027826 | Surface Soil | MSMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA |
Ga0209166_105141941 | 3300027857 | Surface Soil | MRRVKSLLRSTPRRISRRIAEFVAIAAASLPDAGA |
Ga0209068_100342094 | 3300027894 | Watersheds | MKKVRSLLAAAPSRIGRRIAQFVAIAAASLPSAGA |
Ga0102770_111917923 | 3300030981 | Soil | AEGIGQMRRVASLLRATPAQIGRRLAQLVAIAAASLPDVGA |
Ga0170834_1014825982 | 3300031057 | Forest Soil | MRRVNSLLRSAPARIGRRFAQFVAIAAASLPIAGA |
Ga0170824_1112489102 | 3300031231 | Forest Soil | KDISMERVRSLLRSTPSRISRGIARFVAIAAASLPDAGA |
Ga0318534_1000116311 | 3300031544 | Soil | MQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA |
Ga0318541_107065901 | 3300031545 | Soil | VFTMQRVRSLLRTTPRRIKSRIAQFVTIAAASLPDAGA |
Ga0310915_100056079 | 3300031573 | Soil | WRARNRLMQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA |
Ga0318542_101565081 | 3300031668 | Soil | NRLMQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA |
Ga0310686_1196058134 | 3300031708 | Soil | MRRVNSLLRSAPARIGRRLARLVAIAAASLPVAGA |
Ga0310813_115210092 | 3300031716 | Soil | MQKVRLLLRSTPSLLSRRIAQFVAIAAASLPDAGA |
Ga0306917_105100792 | 3300031719 | Soil | MQQLHLLLRDAPVRIRRRFARFVVIAAASLPDVGA |
Ga0318546_103043622 | 3300031771 | Soil | MQRVRSLLRTTPRRIKSRIAQFVTIAAASLPDAGA |
Ga0318552_103408692 | 3300031782 | Soil | MTMARINRLLRSAPSRIGKRIAQFVAIAAASLPDAGA |
Ga0318536_102600002 | 3300031893 | Soil | AREDMTMARINRLLRSAPSRIGKRIAQFVAIAAASLPDAGA |
Ga0318520_109112892 | 3300031897 | Soil | AREDFSMARINKLLRSAPSRIGQRIAQFVAIAAASLPDAGA |
Ga0310912_102072621 | 3300031941 | Soil | RARNRLMQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA |
Ga0307479_107352362 | 3300031962 | Hardwood Forest Soil | MQRVRSLLRSTPSRISRGIARFVAIAAASLPDVGA |
Ga0311301_126123692 | 3300032160 | Peatlands Soil | MRRVNSLLRSAQERIRRGIAQFVAIAAASLPAVGA |
Ga0335080_102672972 | 3300032828 | Soil | MRRVRSLLRAAPSQISRRIAQFVAIAAASLPDAGA |
Ga0335081_127373722 | 3300032892 | Soil | REDMSMARINRLLRAAPARIGQRIAQFVAIAAASLPDAGA |
Ga0335073_117362992 | 3300033134 | Soil | MAKVRKFLRKAPARIGRRFAQFVAIAAASLPAAGA |
⦗Top⦘ |