NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F048510

Metagenome / Metatranscriptome Family F048510

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048510
Family Type Metagenome / Metatranscriptome
Number of Sequences 148
Average Sequence Length 37 residues
Representative Sequence MQRVRSLLRSTPSRIGRRIAQFVAIAAASLPDAGA
Number of Associated Samples 118
Number of Associated Scaffolds 148

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 69.23 %
% of genes near scaffold ends (potentially truncated) 27.70 %
% of genes from short scaffolds (< 2000 bps) 75.68 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.784 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.568 % of family members)
Environment Ontology (ENVO) Unclassified
(26.351 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.946 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.44%    β-sheet: 0.00%    Coil/Unstructured: 55.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 148 Family Scaffolds
PF02518HATPase_c 22.30
PF028262-Hacid_dh_C 20.27
PF085212CSK_N 5.41
PF00486Trans_reg_C 3.38
PF12833HTH_18 2.70
PF01145Band_7 2.03
PF13420Acetyltransf_4 2.03
PF03466LysR_substrate 2.03
PF07729FCD 1.35
PF13278Obsolete Pfam Family 1.35
PF03972MmgE_PrpD 1.35
PF00920ILVD_EDD 1.35
PF03401TctC 0.68
PF00106adh_short 0.68
PF01494FAD_binding_3 0.68
PF003892-Hacid_dh 0.68
PF12700HlyD_2 0.68
PF02776TPP_enzyme_N 0.68
PF13407Peripla_BP_4 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 148 Family Scaffolds
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 5.41
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 2.70
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.35
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 1.35
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 1.35
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 1.35
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.68
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.68
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.68
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.78 %
UnclassifiedrootN/A16.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459004|F62QY1Z02HP3CQAll Organisms → cellular organisms → Bacteria → Proteobacteria508Open in IMG/M
2170459010|GIO7OMY02HCBD0Not Available509Open in IMG/M
3300001661|JGI12053J15887_10284094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium813Open in IMG/M
3300001686|C688J18823_10502489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium778Open in IMG/M
3300001867|JGI12627J18819_10090961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1263Open in IMG/M
3300004799|Ga0058863_11534226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium546Open in IMG/M
3300005434|Ga0070709_10255624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1264Open in IMG/M
3300005437|Ga0070710_10980211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium615Open in IMG/M
3300005529|Ga0070741_10063401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR654266Open in IMG/M
3300005529|Ga0070741_10320155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1449Open in IMG/M
3300005529|Ga0070741_10362385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1342Open in IMG/M
3300005529|Ga0070741_10460606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1157Open in IMG/M
3300005533|Ga0070734_10017078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR654931Open in IMG/M
3300005533|Ga0070734_10056197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2371Open in IMG/M
3300005533|Ga0070734_10464695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium721Open in IMG/M
3300005537|Ga0070730_10000079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium124437Open in IMG/M
3300005548|Ga0070665_100064194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR653682Open in IMG/M
3300005563|Ga0068855_100191514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2306Open in IMG/M
3300005563|Ga0068855_100298893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1783Open in IMG/M
3300005563|Ga0068855_100362388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR651595Open in IMG/M
3300005563|Ga0068855_100418163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1467Open in IMG/M
3300005577|Ga0068857_101741209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium609Open in IMG/M
3300005598|Ga0066706_10961876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium661Open in IMG/M
3300005610|Ga0070763_10359132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium812Open in IMG/M
3300005614|Ga0068856_102433999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium531Open in IMG/M
3300005764|Ga0066903_100161736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR653248Open in IMG/M
3300005764|Ga0066903_101330210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1344Open in IMG/M
3300005764|Ga0066903_108800553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium512Open in IMG/M
3300005921|Ga0070766_10113897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1618Open in IMG/M
3300005944|Ga0066788_10007805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2209Open in IMG/M
3300006028|Ga0070717_10833697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium839Open in IMG/M
3300006028|Ga0070717_11225275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium683Open in IMG/M
3300006028|Ga0070717_11555669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium600Open in IMG/M
3300006041|Ga0075023_100015163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2059Open in IMG/M
3300006173|Ga0070716_100520465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium881Open in IMG/M
3300006354|Ga0075021_10202393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1212Open in IMG/M
3300006755|Ga0079222_10218380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1165Open in IMG/M
3300006804|Ga0079221_10046706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR651921Open in IMG/M
3300006893|Ga0073928_10714069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales698Open in IMG/M
3300007265|Ga0099794_10243569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium926Open in IMG/M
3300009093|Ga0105240_10141693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR652873Open in IMG/M
3300009093|Ga0105240_10741509Not Available1069Open in IMG/M
3300009093|Ga0105240_11961860All Organisms → cellular organisms → Bacteria → Proteobacteria609Open in IMG/M
3300009093|Ga0105240_12193240Not Available573Open in IMG/M
3300009143|Ga0099792_10400017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium840Open in IMG/M
3300009551|Ga0105238_10003445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium15739Open in IMG/M
3300009660|Ga0105854_1070930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1068Open in IMG/M
3300010046|Ga0126384_12294444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium521Open in IMG/M
3300010154|Ga0127503_10969069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium625Open in IMG/M
3300010159|Ga0099796_10108041Not Available1056Open in IMG/M
3300010361|Ga0126378_10012457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR657042Open in IMG/M
3300010366|Ga0126379_11301423Not Available833Open in IMG/M
3300010366|Ga0126379_11951327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii690Open in IMG/M
3300010376|Ga0126381_104708151Not Available525Open in IMG/M
3300010376|Ga0126381_104957959Not Available511Open in IMG/M
3300010379|Ga0136449_102197076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium805Open in IMG/M
3300010867|Ga0126347_1424515Not Available523Open in IMG/M
3300011269|Ga0137392_10221573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1552Open in IMG/M
3300012200|Ga0137382_10264619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1194Open in IMG/M
3300012201|Ga0137365_11355295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei502Open in IMG/M
3300012207|Ga0137381_10993861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei724Open in IMG/M
3300012212|Ga0150985_117818804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium668Open in IMG/M
3300012923|Ga0137359_10198559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1792Open in IMG/M
3300013104|Ga0157370_10127920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2371Open in IMG/M
3300014657|Ga0181522_10469832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium756Open in IMG/M
3300017944|Ga0187786_10130989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales884Open in IMG/M
3300017947|Ga0187785_10014260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2747Open in IMG/M
3300017947|Ga0187785_10424639Not Available645Open in IMG/M
3300018035|Ga0187875_10603709Not Available579Open in IMG/M
3300020076|Ga0206355_1265808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium842Open in IMG/M
3300020170|Ga0179594_10000536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR658470Open in IMG/M
3300020170|Ga0179594_10368945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium545Open in IMG/M
3300020199|Ga0179592_10007508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4672Open in IMG/M
3300020579|Ga0210407_10039254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3521Open in IMG/M
3300020580|Ga0210403_10524159All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300021086|Ga0179596_10073453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1491Open in IMG/M
3300021086|Ga0179596_10721392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei504Open in IMG/M
3300021088|Ga0210404_10637380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium606Open in IMG/M
3300021168|Ga0210406_10404745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1093Open in IMG/M
3300021374|Ga0213881_10018325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2889Open in IMG/M
3300021374|Ga0213881_10086202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1351Open in IMG/M
3300021384|Ga0213876_10045145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2331Open in IMG/M
3300021384|Ga0213876_10189175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1095Open in IMG/M
3300021384|Ga0213876_10374929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium757Open in IMG/M
3300021403|Ga0210397_10434818Not Available986Open in IMG/M
3300021403|Ga0210397_10967592Not Available660Open in IMG/M
3300021404|Ga0210389_11233506All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300021407|Ga0210383_11672910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium522Open in IMG/M
3300021478|Ga0210402_10324842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS2311426Open in IMG/M
3300021560|Ga0126371_10104644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR652826Open in IMG/M
3300021560|Ga0126371_10497253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1367Open in IMG/M
3300021560|Ga0126371_12281788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium654Open in IMG/M
3300022467|Ga0224712_10373746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium676Open in IMG/M
3300022508|Ga0222728_1057829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium665Open in IMG/M
3300022510|Ga0242652_1042239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium557Open in IMG/M
3300022511|Ga0242651_1051469Not Available510Open in IMG/M
3300022512|Ga0242676_1019427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium697Open in IMG/M
3300022529|Ga0242668_1044630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium772Open in IMG/M
3300022722|Ga0242657_1166966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium590Open in IMG/M
3300024271|Ga0224564_1124984All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300024288|Ga0179589_10003471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3967Open in IMG/M
3300025898|Ga0207692_10578619Not Available720Open in IMG/M
3300025906|Ga0207699_10743156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium719Open in IMG/M
3300025909|Ga0207705_10365661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1113Open in IMG/M
3300025910|Ga0207684_10221974Not Available1631Open in IMG/M
3300025911|Ga0207654_11121999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium573Open in IMG/M
3300025912|Ga0207707_10000088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium90991Open in IMG/M
3300025912|Ga0207707_10026854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5031Open in IMG/M
3300025912|Ga0207707_10044581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3867Open in IMG/M
3300025917|Ga0207660_10603884Not Available894Open in IMG/M
3300025920|Ga0207649_11050636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium642Open in IMG/M
3300025944|Ga0207661_10004757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium9507Open in IMG/M
3300025949|Ga0207667_10504175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1227Open in IMG/M
3300026078|Ga0207702_11812903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium602Open in IMG/M
3300026215|Ga0209849_1015176All Organisms → cellular organisms → Bacteria → Proteobacteria1277Open in IMG/M
3300027307|Ga0209327_1074169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium503Open in IMG/M
3300027517|Ga0209113_1011530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1111Open in IMG/M
3300027645|Ga0209117_1000325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium23230Open in IMG/M
3300027725|Ga0209178_1033564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR651618Open in IMG/M
3300027826|Ga0209060_10008467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR656479Open in IMG/M
3300027826|Ga0209060_10386627Not Available637Open in IMG/M
3300027857|Ga0209166_10514194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae614Open in IMG/M
3300027894|Ga0209068_10034209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2529Open in IMG/M
3300030981|Ga0102770_11191792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium653Open in IMG/M
3300031057|Ga0170834_101482598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1600Open in IMG/M
3300031231|Ga0170824_111248910Not Available880Open in IMG/M
3300031544|Ga0318534_10001163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium10148Open in IMG/M
3300031545|Ga0318541_10706590Not Available563Open in IMG/M
3300031573|Ga0310915_10005607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR656986Open in IMG/M
3300031668|Ga0318542_10156508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1135Open in IMG/M
3300031708|Ga0310686_119605813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2652Open in IMG/M
3300031716|Ga0310813_11521009All Organisms → cellular organisms → Bacteria → Proteobacteria623Open in IMG/M
3300031719|Ga0306917_10510079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium945Open in IMG/M
3300031771|Ga0318546_10304362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1104Open in IMG/M
3300031782|Ga0318552_10340869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria763Open in IMG/M
3300031893|Ga0318536_10260000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria882Open in IMG/M
3300031897|Ga0318520_10911289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium554Open in IMG/M
3300031941|Ga0310912_10207262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1500Open in IMG/M
3300031962|Ga0307479_10735236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65965Open in IMG/M
3300032160|Ga0311301_12612369All Organisms → cellular organisms → Bacteria → Proteobacteria560Open in IMG/M
3300032828|Ga0335080_10267297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1865Open in IMG/M
3300032892|Ga0335081_12737372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium502Open in IMG/M
3300033134|Ga0335073_11736299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium587Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.14%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil7.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.08%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.08%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.41%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.05%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.38%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.03%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.03%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.03%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots2.03%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.35%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.35%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.35%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.35%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.35%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.35%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock1.35%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.35%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.68%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.68%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.68%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.68%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.68%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.68%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.68%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.68%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459004Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)EnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022508Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022510Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022511Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022512Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300027058Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027307Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027517Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300030981Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4B_036179602170459004Grass SoilMQRVRSLLRSTPSRIGRRIAQFVAIAAASLPDAGA
F62_088093202170459010Grass SoilMQRVRSLLRATPGRISRRIAQFVAIAAASLPDAGA
JGI12053J15887_1028409413300001661Forest SoilMQRVRSLLRATPAEIGRRFAQFVAIAAASLPDVGA*
C688J18823_1050248923300001686SoilMRRLRSLLRSTPSRIGRRLAAIVTIAAASLPTAGV*
JGI12627J18819_1009096113300001867Forest SoilMQRVASLLRSTPSRIGRRIAQFVAIAAASLPDVGA*
JGI12627J18819_1010018123300001867Forest SoilMILRAPEDISMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA*
Ga0058863_1153422623300004799Host-AssociatedFLPRGERILVMKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA*
Ga0070709_1025562413300005434Corn, Switchgrass And Miscanthus RhizospherePGHGRVLIMQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA*
Ga0070710_1098021123300005437Corn, Switchgrass And Miscanthus RhizosphereEDISMERVRSFLRSTPSRVSRRIAQFVAIAAASLPDAGA*
Ga0070741_1006340133300005529Surface SoilMERVRSLLRSTPSRISRGIARFVALAAASLPDAGA*
Ga0070741_1032015523300005529Surface SoilMQRVRSLLRTTPSRIRDRIAPFVAIAAASLPDGGA*
Ga0070741_1036238523300005529Surface SoilMQRVRSLLRTTPHLIKSRIAQFVAIAAASLPDAGV*
Ga0070741_1046060613300005529Surface SoilMERVRSLLRSTPSRLGRRIAQIVAIAAASLPDAGA*
Ga0070734_1001707843300005533Surface SoilMSMARINRLLRSAPSRIGRRIAQFVAIAAASLPDAGA*
Ga0070734_1005619733300005533Surface SoilMERVRSLLRSTPSRLGRRIAQIVAIAAASLPEAGA*
Ga0070734_1046469523300005533Surface SoilMSMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA*
Ga0070730_10000079473300005537Surface SoilMERVRSLLRSTPKLRRRIAELVAIAAASLPDAGA*
Ga0070665_10006419423300005548Switchgrass RhizosphereMERVRSLLRSTPSRISRRIAQFVAIAAASLPDAGA*
Ga0068855_10019151413300005563Corn RhizospherePRRRRRVFGMQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA*
Ga0068855_10029889313300005563Corn RhizosphereMLRVRSLLRSTPSRIGRRIAGFVAIAAASLPDAGA*
Ga0068855_10036238823300005563Corn RhizosphereMEWVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA*
Ga0068855_10041816323300005563Corn RhizosphereMKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA*
Ga0068857_10174120913300005577Corn RhizosphereMERVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA*
Ga0066706_1096187623300005598SoilMRRVRSLLRATPAQIGRRLAQFVAIAAASLPDVGA*
Ga0070763_1035913223300005610SoilMRRVHSLLRSAPARIGRRFAQFVAIAAASLPVAGA*
Ga0068856_10243399913300005614Corn RhizosphereMERVRSLLRSTPSLIGRRIAQFVAIAAASLPEAGA*
Ga0066903_10016173633300005764Tropical Forest SoilMQRVRSLLRTTPSRISRRIAELVAIAAASLPDAGA*
Ga0066903_10133021023300005764Tropical Forest SoilMLRITSFMRSTPSRIGRRIAQFVAIAAASLPAVGA*
Ga0066903_10880055323300005764Tropical Forest SoilMQRVRSLLRATPGRISRRIAQFVAIAAASLPAAGA*
Ga0070766_1011389723300005921SoilMRRVNSLLRSAPARIGRRFAQFVAIAAASLPIAGA*
Ga0066788_1000780523300005944SoilMQRVRSLLRAAPSHIGRGIARFVAIAAASLPDVGA*
Ga0081540_100945323300005983Tabebuia Heterophylla RhizosphereMARVRKLLQTAPSRIGRRFAQFVAIAAASLPSAGA*
Ga0070717_1083369713300006028Corn, Switchgrass And Miscanthus RhizosphereMQRVASLLRSTPRRIGRRFAQFVAIAAASLPEVGA*
Ga0070717_1122527533300006028Corn, Switchgrass And Miscanthus RhizosphereREDISMERVRSLLRKTPSRISRGIARFVAIAAASLPDAGA*
Ga0070717_1155566913300006028Corn, Switchgrass And Miscanthus RhizosphereMQRVRSLLRSTPSRISRGIARFVAIAAASLPGAGA*
Ga0075023_10001516323300006041WatershedsMKKVRSLLAAAPSRIGRRIAQFVAIAAASLPSAGA*
Ga0070716_10052046513300006173Corn, Switchgrass And Miscanthus RhizosphereMQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA*
Ga0075021_1020239323300006354WatershedsMRKVGSLLRAAPSRIGRRLAALVAIAAASLPDAGA*
Ga0079222_1021838033300006755Agricultural SoilMERVRSLLRKTPSRIGRGIARFVAIAAASLPDAGA*
Ga0079221_1004670633300006804Agricultural SoilMQRVRSLLRSAPFRLRRRLKLIVAIAAASLPDVGA*
Ga0073928_1071406913300006893Iron-Sulfur Acid SpringMRRVNSLLRSAPARIGRRLARFVAIAAASLPVAGA*
Ga0099794_1024356923300007265Vadose Zone SoilMRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA*
Ga0105240_1014169323300009093Corn RhizosphereMQRVASLLRSTPRRIGREIARFVAIAAASLPEVGA*
Ga0105240_1074150923300009093Corn RhizosphereMQRVRALLRTAPSRIKNRIAQFVAIAAASLPDAGA*
Ga0105240_1196186013300009093Corn RhizosphereMQRVRSLLRTAPSRIKNRIAQFVAIAAASLPDAGA*
Ga0105240_1219324013300009093Corn RhizosphereMQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA*
Ga0099792_1040001713300009143Vadose Zone SoilMEGIGQMRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA*
Ga0105238_10003445103300009551Corn RhizosphereMERVRSLLRSTPSRISRRIAQFVAIVAASLPDAGA*
Ga0105854_107093033300009660Permafrost SoilMQRVRSLLRGAPSHIGRGIARFVAIAAASLPDVGA*
Ga0126384_1229444423300010046Tropical Forest SoilMSMARINRLLRAAPARIGQRIAQFVAIAAASLPDAGA*
Ga0127503_1096906913300010154SoilKSCAGEGIGQMRRVRSLLLATPAQIGRRFAQFVAIAAASLPDVGA*
Ga0099796_1010804133300010159Vadose Zone SoilMRRVASLLRATPAQIGRRLAQLVAIAAASLPEVGA*
Ga0126378_1001245763300010361Tropical Forest SoilVARKDILMQRVRSLLRTTPSRISRRIAELVAIAAASLPDAGA*
Ga0126379_1130142323300010366Tropical Forest SoilMQRVRSLLWAAPAQIGRRFARFVAIAAASLPDVGA*
Ga0126379_1195132713300010366Tropical Forest SoilQMQQVPSLLRTAPAEIGRRLARLVAIAAASLPDVGA*
Ga0126381_10470815123300010376Tropical Forest SoilMQKVASLLRSTPRRISRRFAQFVAIAAASLPEVGA*
Ga0126381_10495795913300010376Tropical Forest SoilMFIMQRVASLLRSTPRRISRRIAQFVAIAAASLPDVGA*
Ga0136449_10219707623300010379Peatlands SoilMRRVNSLLRSAQERIRRGIAQFVAIAAASLPAVGA*
Ga0126347_142451523300010867Boreal Forest SoilQMLRVRSLLRAAPAQIGRRLAQLVAIAAASLPEVGA*
Ga0137392_1022157313300011269Vadose Zone SoilMRRVRSLLRVTPAQIGRRLAQLVAIAAASLPDVGA*
Ga0137382_1026461913300012200Vadose Zone SoilMRQLASLLRSTPSRIGRRLALIVAIAAASLPTAGA*
Ga0137365_1135529523300012201Vadose Zone SoilMRQLASLLRSTPSRIGRRLALIVAIAAASLPTAGA
Ga0137363_1005162323300012202Vadose Zone SoilVGGPYNGAEGIGQMRRVRSLLRVTPAQIGRRLAQLVAIAAASLPDVGA*
Ga0137381_1099386123300012207Vadose Zone SoilMQRVHSLLRSTRARIGRQLALIVAIAAASLPDAGA*
Ga0150985_11781880413300012212Avena Fatua RhizosphereLMGARGYFMQKVRSLLRLTPSRISRGFARFVAIAAASLPDAGA*
Ga0137359_1019855913300012923Vadose Zone SoilQMRRVRSLLRSTPAQIGRRLVQLVAIAAASLPDVGA*
Ga0157370_1012792033300013104Corn RhizosphereMQRIRSLLRSARVRISRRITQLVAIAAASLPDVGA*
Ga0181522_1046983233300014657BogSMQRVNSLLRSAQERIRRGIAQFVAIAAASLPAVGA*
Ga0187786_1013098923300017944Tropical PeatlandMQRVTSLLRATPSRIRRRIARFVAIAAASLPDVGA
Ga0187785_1001426023300017947Tropical PeatlandMARINKLLRSAPSRIGQRIAQFVAIAAASLPDAGA
Ga0187785_1042463923300017947Tropical PeatlandMQRVTSLLRATPSRIRRRIAQFVAIAAASLPDVGA
Ga0187875_1060370913300018035PeatlandMRQFSSLLRSARSRIGRGLAQFVAIAAASLPVAGV
Ga0206355_126580833300020076Corn, Switchgrass And Miscanthus RhizosphereMQRVASLLRSTPRRIGREIARFVAIAAASLPEVGA
Ga0179594_1000053613300020170Vadose Zone SoilMEGIGQMRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA
Ga0179594_1036894523300020170Vadose Zone SoilSCNGAEGIGQMRRVASLLRATPAQIGRRLAQLVAIAAASLPEVGA
Ga0179592_1000750843300020199Vadose Zone SoilMRRVASLLRATPAQIGRRLAQLVAIAAASLPEVGA
Ga0210407_1003925443300020579SoilMQQLRLLLRDAPAQIGRRFARFVAIAAASLPDAGA
Ga0210403_1052415923300020580SoilMQQLRALLRKTPSRLRRRIAEFVAIAAASLPAAGA
Ga0179596_1007345333300021086Vadose Zone SoilMRRVRSLLRVTPAQIGRRLAQLVAIAAASLPDVGA
Ga0179596_1072139213300021086Vadose Zone SoilMRRVRSLLRAAPAQIGRRLAQFVAIAAASLPDVGA
Ga0210404_1063738033300021088SoilQFLPRRGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA
Ga0210406_1040474523300021168SoilMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA
Ga0213881_1001832543300021374Exposed RockMQRVASLLRATPGRISRRLAQFVAIAAASLPEVGA
Ga0213881_1008620223300021374Exposed RockMERVRSLLRATPSRISRRIAQFVAIAAASLPDAGA
Ga0213876_1004514523300021384Plant RootsMQKVRSLLRSTPSRISRGIARFVAIAAASLPDVGA
Ga0213876_1018917523300021384Plant RootsMQRVASLLRATPRRISQRFAQFVAIAAASLPEVGA
Ga0213876_1037492923300021384Plant RootsMSMERVRSLLRSTPRRISRHIARFVAIAAASLPDAGA
Ga0210397_1043481823300021403SoilPEDISMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA
Ga0210397_1096759223300021403SoilMSMERVRSLLRSTPTRISRHIARFVAIAAASLPDAGA
Ga0210389_1123350623300021404SoilMHRVNSLLRLAQERIRRGVAQFVAIAAASLPAVGA
Ga0210383_1167291013300021407SoilMRRVNSLLRSAPARIGRRLARFVAIAAASLPVAGA
Ga0210402_1032484233300021478SoilMQRVRSLLRTTPGRISRRIAQFVAIAAASLPDAGA
Ga0126371_1010464443300021560Tropical Forest SoilMQRVRSLLRTTPSRISRRIAELVAIAAASLPDAGA
Ga0126371_1049725323300021560Tropical Forest SoilMLRITSFMRSTPSRIGRRIAQFVAIAAASLPAVGA
Ga0126371_1228178813300021560Tropical Forest SoilSARWSFVMQGVRSLLRATPGRISRRIAQFVAIAAASLPAAGA
Ga0224712_1037374613300022467Corn, Switchgrass And Miscanthus RhizosphereQFLPRGERILVMKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA
Ga0242642_108450923300022504SoilEQVPRGAEGIGQMQRVRSLVLAAPAQIRRRLARLVAIAAASLPDVGA
Ga0222728_105782933300022508SoilLVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA
Ga0242652_104223913300022510SoilHGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA
Ga0242651_105146913300022511SoilLPRHGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA
Ga0242676_101942733300022512SoilHFLSWHGRITVMQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA
Ga0242668_104463013300022529SoilRHGRILVMQRVASLLRSTPRRISREIARFVAIAAASLPDVGA
Ga0242657_116696613300022722SoilMEIPMRRVNSLLRSAPARIGRRLARFVAIAAASLPVAGA
Ga0224564_112498423300024271SoilMQRVNSLLRSAPAQIMRGIAYFVAIAAASLPAAGA
Ga0179589_1000347133300024288Vadose Zone SoilMRRVASLLRATPAQIGRRLAQLVAIAAASLPEAGA
Ga0207692_1057861913300025898Corn, Switchgrass And Miscanthus RhizosphereMERVRSLLRSTPSRIGRGIARFVAIAAASLPDVGA
Ga0207699_1074315633300025906Corn, Switchgrass And Miscanthus RhizosphereISCPGHGRVLIMQRVASLLRSTPRRIGREIARFVAIAAASLPDVGA
Ga0207705_1036566133300025909Corn RhizosphereMQRVRALLRTAPSRIKNRIAQFVAIAAASLPDAGA
Ga0207684_1022197433300025910Corn, Switchgrass And Miscanthus RhizosphereMRRVRLLLRATPTQIGRHLAQFVAIAAASLPDVGA
Ga0207654_1112199923300025911Corn RhizosphereMLRVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA
Ga0207707_10000088723300025912Corn RhizosphereMLRVRSLLRSTPSRIGRRIAGFVAIAAASLPDAGA
Ga0207707_1002685433300025912Corn RhizosphereMERVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA
Ga0207707_1004458153300025912Corn RhizosphereMQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA
Ga0207660_1060388433300025917Corn RhizosphereMKRVASLLRSTPRRISRRIAQFVTIAAASLPEVGA
Ga0207649_1105063613300025920Corn RhizosphereMEWVRSLLRTTPSRIGRRIAQFVAIAAASLPDAGA
Ga0207661_1000475763300025944Corn RhizosphereMQRVRSLLRTTPSRIKNRIAQFVAIAAASLPDAGA
Ga0207667_1050417513300025949Corn RhizospherePRRRRRVFGMQRIRSLLRSAPVRISRRITQLVAIAAASLPDVGA
Ga0207702_1181290313300026078Corn RhizosphereGFCEMERVRSLLRSTPSLIGRRIAQFVAIAAASLPEAGA
Ga0209849_101517633300026215SoilMQRVRSLLRAAPSHIGRGIARFVAIAAASLPDVGA
Ga0209111_102314823300027058Forest SoilMILRAPEDISMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA
Ga0209327_107416913300027307Forest SoilGARKDIGMERVRSLLRSTPSRISRRIAQFVAIAAASLPDAGA
Ga0209113_101153023300027517Forest SoilMQQVAVLLRKAPSRIGQRIAQLVAIAAASLPDVGA
Ga0209117_100032593300027645Forest SoilMQQLRSLLRATPSRIGRRLAVIVAIAAASLPAAGA
Ga0209178_103356433300027725Agricultural SoilMQRVRSLLRSAPFRLRRRLKLIVAIAAASLPDVGA
Ga0209060_1000846743300027826Surface SoilMSMARINRLLRSAPSRIGRRIAQFVAIAAASLPDAGA
Ga0209060_1038662723300027826Surface SoilMSMERVRSLLRSTPSRISRHIARFVAIAAASLPDAGA
Ga0209166_1051419413300027857Surface SoilMRRVKSLLRSTPRRISRRIAEFVAIAAASLPDAGA
Ga0209068_1003420943300027894WatershedsMKKVRSLLAAAPSRIGRRIAQFVAIAAASLPSAGA
Ga0102770_1119179233300030981SoilAEGIGQMRRVASLLRATPAQIGRRLAQLVAIAAASLPDVGA
Ga0170834_10148259823300031057Forest SoilMRRVNSLLRSAPARIGRRFAQFVAIAAASLPIAGA
Ga0170824_11124891023300031231Forest SoilKDISMERVRSLLRSTPSRISRGIARFVAIAAASLPDAGA
Ga0318534_10001163113300031544SoilMQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA
Ga0318541_1070659013300031545SoilVFTMQRVRSLLRTTPRRIKSRIAQFVTIAAASLPDAGA
Ga0310915_1000560793300031573SoilWRARNRLMQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA
Ga0318542_1015650813300031668SoilNRLMQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA
Ga0310686_11960581343300031708SoilMRRVNSLLRSAPARIGRRLARLVAIAAASLPVAGA
Ga0310813_1152100923300031716SoilMQKVRLLLRSTPSLLSRRIAQFVAIAAASLPDAGA
Ga0306917_1051007923300031719SoilMQQLHLLLRDAPVRIRRRFARFVVIAAASLPDVGA
Ga0318546_1030436223300031771SoilMQRVRSLLRTTPRRIKSRIAQFVTIAAASLPDAGA
Ga0318552_1034086923300031782SoilMTMARINRLLRSAPSRIGKRIAQFVAIAAASLPDAGA
Ga0318536_1026000023300031893SoilAREDMTMARINRLLRSAPSRIGKRIAQFVAIAAASLPDAGA
Ga0318520_1091128923300031897SoilAREDFSMARINKLLRSAPSRIGQRIAQFVAIAAASLPDAGA
Ga0310912_1020726213300031941SoilRARNRLMQRIASFMRSTPSRIGRRIAQFVAIAAASLPAVGA
Ga0307479_1073523623300031962Hardwood Forest SoilMQRVRSLLRSTPSRISRGIARFVAIAAASLPDVGA
Ga0311301_1261236923300032160Peatlands SoilMRRVNSLLRSAQERIRRGIAQFVAIAAASLPAVGA
Ga0335080_1026729723300032828SoilMRRVRSLLRAAPSQISRRIAQFVAIAAASLPDAGA
Ga0335081_1273737223300032892SoilREDMSMARINRLLRAAPARIGQRIAQFVAIAAASLPDAGA
Ga0335073_1173629923300033134SoilMAKVRKFLRKAPARIGRRFAQFVAIAAASLPAAGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.