NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F048322

Metagenome Family F048322

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048322
Family Type Metagenome
Number of Sequences 148
Average Sequence Length 40 residues
Representative Sequence MLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI
Number of Associated Samples 30
Number of Associated Scaffolds 148

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 22.30 %
% of genes near scaffold ends (potentially truncated) 32.43 %
% of genes from short scaffolds (< 2000 bps) 61.49 %
Associated GOLD sequencing projects 26
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.622 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment
(29.054 % of family members)
Environment Ontology (ENVO) Unclassified
(32.432 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(30.405 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.77%    β-sheet: 0.00%    Coil/Unstructured: 49.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 148 Family Scaffolds
PF14332DUF4388 1.35
PF02275CBAH 1.35
PF14492EFG_III 1.35
PF01850PIN 1.35
PF02730AFOR_N 1.35
PF02321OEP 1.35
PF07927HicA_toxin 1.35
PF11028DUF2723 1.35
PF13549ATP-grasp_5 1.35
PF01258zf-dskA_traR 1.35
PF01227GTP_cyclohydroI 1.35
PF07638Sigma70_ECF 1.35
PF03099BPL_LplA_LipB 1.35
PF00781DAGK_cat 1.35
PF02738MoCoBD_1 0.68
PF00510COX3 0.68
PF00575S1 0.68
PF13419HAD_2 0.68
PF00579tRNA-synt_1b 0.68
PF01979Amidohydro_1 0.68
PF04209HgmA_C 0.68
PF03461TRCF 0.68
PF03349Toluene_X 0.68
PF00155Aminotran_1_2 0.68
PF01209Ubie_methyltran 0.68
PF02743dCache_1 0.68
PF13415Kelch_3 0.68
PF13840ACT_7 0.68
PF01590GAF 0.68
PF13668Ferritin_2 0.68
PF05670NFACT-R_1 0.68
PF02113Peptidase_S13 0.68
PF00246Peptidase_M14 0.68
PF02518HATPase_c 0.68
PF09994DUF2235 0.68
PF00302CAT 0.68
PF00343Phosphorylase 0.68
PF13847Methyltransf_31 0.68
PF02579Nitro_FeMo-Co 0.68
PF13183Fer4_8 0.68
PF01641SelR 0.68
PF02470MlaD 0.68
PF03601Cons_hypoth698 0.68
PF00271Helicase_C 0.68
PF02782FGGY_C 0.68
PF01612DNA_pol_A_exo1 0.68
PF09861Lar_N 0.68
PF02915Rubrerythrin 0.68
PF00406ADK 0.68
PF05580Peptidase_S55 0.68
PF12840HTH_20 0.68
PF02810SEC-C 0.68
PF03720UDPG_MGDP_dh_C 0.68
PF05103DivIVA 0.68
PF00072Response_reg 0.68
PF13432TPR_16 0.68
PF00583Acetyltransf_1 0.68
PF13350Y_phosphatase3 0.68
PF07228SpoIIE 0.68
PF01138RNase_PH 0.68
PF16868NMT1_3 0.68
PF00588SpoU_methylase 0.68
PF09335SNARE_assoc 0.68
PF00563EAL 0.68
PF00528BPD_transp_1 0.68
PF01521Fe-S_biosyn 0.68
PF02225PA 0.68
PF04325DUF465 0.68
PF13424TPR_12 0.68
PF02868Peptidase_M4_C 0.68
PF00483NTP_transferase 0.68
PF00326Peptidase_S9 0.68
PF03949Malic_M 0.68
PF00923TAL_FSA 0.68
PF16257UxaE 0.68
PF00034Cytochrom_C 0.68
PF01475FUR 0.68
PF16811TAtT 0.68
PF01042Ribonuc_L-PSP 0.68
PF00383dCMP_cyt_deam_1 0.68
PF14237GYF_2 0.68
PF03060NMO 0.68
PF13701DDE_Tnp_1_4 0.68
PF13189Cytidylate_kin2 0.68
PF04264YceI 0.68
PF01212Beta_elim_lyase 0.68
PF07494Reg_prop 0.68
PF00701DHDPS 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 148 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 2.70
COG1597Phosphatidylglycerol kinase, diacylglycerol kinase familyLipid transport and metabolism [I] 2.70
COG0095Lipoate-protein ligase ACoenzyme transport and metabolism [H] 1.35
COG0321Lipoate-protein ligase BCoenzyme transport and metabolism [H] 1.35
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.35
COG0340Biotin-protein ligaseCoenzyme transport and metabolism [H] 1.35
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 1.35
COG1197Transcription-repair coupling factor (superfamily II helicase)Transcription [K] 1.35
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.35
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 1.35
COG1734RNA polymerase-binding transcription factor DksATranscription [K] 1.35
COG2414Aldehyde:ferredoxin oxidoreductaseEnergy production and conversion [C] 1.35
COG3049Penicillin V acylase or related amidase, Ntn superfamilyCell wall/membrane/envelope biogenesis [M] 1.35
COG4927Predicted choloylglycine hydrolaseGeneral function prediction only [R] 1.35
COG0058Glucan phosphorylaseCarbohydrate transport and metabolism [G] 0.68
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.68
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.68
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.68
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.68
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.68
COG0176Transaldolase/fructose-6-phosphate aldolaseCarbohydrate transport and metabolism [G] 0.68
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.68
COG0219tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domainTranslation, ribosomal structure and biogenesis [J] 0.68
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.68
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.68
COG0281Malic enzymeEnergy production and conversion [C] 0.68
COG0316Fe-S cluster assembly iron-binding protein IscAPosttranslational modification, protein turnover, chaperones [O] 0.68
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.68
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.68
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.68
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.68
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.68
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 0.68
COG0565tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.68
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 0.68
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.68
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.68
COG0686Alanine dehydrogenase (includes sporulation protein SpoVN)Amino acid transport and metabolism [E] 0.68
COG0689Ribonuclease PHTranslation, ribosomal structure and biogenesis [J] 0.68
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 0.68
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 0.68
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.68
COG1185Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)Translation, ribosomal structure and biogenesis [J] 0.68
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.68
COG1293Ribosome quality control (RQC) protein RqcH, Rqc2/NEMF/Tae2 family, contains fibronectin-(FbpA) and RNA- (NFACT) binding domainsTranslation, ribosomal structure and biogenesis [J] 0.68
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 0.68
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.68
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.68
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.68
COG2027D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.68
COG2067Long-chain fatty acid transport proteinLipid transport and metabolism [I] 0.68
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.68
COG2123Exosome complex RNA-binding protein Rrp42, RNase PH superfamilyIntracellular trafficking, secretion, and vesicular transport [U] 0.68
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.68
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.68
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.68
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.68
COG2855Uncharacterized membrane protein YadS, UPF0324 familyFunction unknown [S] 0.68
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.68
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.68
COG3033TryptophanaseAmino acid transport and metabolism [E] 0.68
COG3227Zn-dependent metalloprotease (Neutral protease B)Posttranslational modification, protein turnover, chaperones [O] 0.68
COG3292Periplasmic ligand-binding sensor domainSignal transduction mechanisms [T] 0.68
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.68
COG3508Homogentisate 1,2-dioxygenaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.68
COG4841Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF familyFunction unknown [S] 0.68
COG4845Chloramphenicol O-acetyltransferaseDefense mechanisms [V] 0.68
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.68
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 0.68
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.68

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.62 %
UnclassifiedrootN/A28.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002225|JGI24723J26617_10027391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2388Open in IMG/M
3300002225|JGI24723J26617_10043087All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1667Open in IMG/M
3300002225|JGI24723J26617_10047310Not Available1544Open in IMG/M
3300002225|JGI24723J26617_10055981All Organisms → cellular organisms → Bacteria1349Open in IMG/M
3300002225|JGI24723J26617_10074690All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300002225|JGI24723J26617_10088541Not Available947Open in IMG/M
3300002225|JGI24723J26617_10121719All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300002225|JGI24723J26617_10122342All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300002225|JGI24723J26617_10168984All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300005588|Ga0070728_10195206All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM11139Open in IMG/M
3300005588|Ga0070728_10502030Not Available634Open in IMG/M
3300005590|Ga0070727_10425289Not Available741Open in IMG/M
3300005590|Ga0070727_10474371Not Available699Open in IMG/M
3300005590|Ga0070727_10691640Not Available572Open in IMG/M
3300005600|Ga0070726_10699631All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005612|Ga0070723_10454074All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium627Open in IMG/M
3300005612|Ga0070723_10584016Not Available559Open in IMG/M
3300005612|Ga0070723_10709140Not Available510Open in IMG/M
3300006467|Ga0099972_10322332Not Available793Open in IMG/M
3300006467|Ga0099972_10438288All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium677Open in IMG/M
3300006467|Ga0099972_10439882All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300006467|Ga0099972_10749254All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter2079Open in IMG/M
3300006467|Ga0099972_11132449Not Available592Open in IMG/M
3300006467|Ga0099972_11974094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2748Open in IMG/M
3300006467|Ga0099972_11975645All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium2505Open in IMG/M
3300006467|Ga0099972_12909242All Organisms → cellular organisms → Bacteria1506Open in IMG/M
3300006467|Ga0099972_12995446All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300006467|Ga0099972_13045132All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2050Open in IMG/M
3300006467|Ga0099972_13285326Not Available525Open in IMG/M
3300006467|Ga0099972_13561323Not Available556Open in IMG/M
3300006467|Ga0099972_13561895Not Available1652Open in IMG/M
3300009149|Ga0114918_10294718All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300010392|Ga0118731_102647174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi9790Open in IMG/M
3300010392|Ga0118731_103225731All Organisms → cellular organisms → Bacteria → Proteobacteria6498Open in IMG/M
3300010392|Ga0118731_104020081All Organisms → cellular organisms → Bacteria17143Open in IMG/M
3300010392|Ga0118731_105457366All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300010392|Ga0118731_106347004All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum6472Open in IMG/M
3300010392|Ga0118731_106397077All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM22299Open in IMG/M
3300010392|Ga0118731_107251971All Organisms → cellular organisms → Bacteria17315Open in IMG/M
3300010392|Ga0118731_107484544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria12852Open in IMG/M
3300010392|Ga0118731_107775452All Organisms → cellular organisms → Bacteria → Acidobacteria34314Open in IMG/M
3300010392|Ga0118731_107899361All Organisms → cellular organisms → Bacteria17769Open in IMG/M
3300010392|Ga0118731_108101081All Organisms → cellular organisms → Bacteria15163Open in IMG/M
3300010392|Ga0118731_109939685All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3836Open in IMG/M
3300010392|Ga0118731_111959517All Organisms → cellular organisms → Bacteria4546Open in IMG/M
3300010392|Ga0118731_112448885All Organisms → cellular organisms → Bacteria4032Open in IMG/M
3300010392|Ga0118731_113487655All Organisms → cellular organisms → Bacteria3373Open in IMG/M
3300010392|Ga0118731_113769819All Organisms → cellular organisms → Bacteria8823Open in IMG/M
3300010392|Ga0118731_113862114All Organisms → cellular organisms → Bacteria10565Open in IMG/M
3300010392|Ga0118731_115385331All Organisms → cellular organisms → Bacteria23104Open in IMG/M
3300010430|Ga0118733_100006357All Organisms → cellular organisms → Bacteria33354Open in IMG/M
3300010430|Ga0118733_100018817All Organisms → cellular organisms → Bacteria16299Open in IMG/M
3300010430|Ga0118733_100022562All Organisms → cellular organisms → Bacteria14507Open in IMG/M
3300010430|Ga0118733_100028182All Organisms → cellular organisms → Bacteria → Proteobacteria12563Open in IMG/M
3300010430|Ga0118733_100045855All Organisms → cellular organisms → Bacteria9264Open in IMG/M
3300010430|Ga0118733_100127854All Organisms → cellular organisms → Bacteria5089Open in IMG/M
3300010430|Ga0118733_100248247All Organisms → cellular organisms → Bacteria3519Open in IMG/M
3300010430|Ga0118733_100313626All Organisms → cellular organisms → Bacteria → Acidobacteria3103Open in IMG/M
3300010430|Ga0118733_100336998All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile → Desulfomonile tiedjei2985Open in IMG/M
3300010430|Ga0118733_100522767All Organisms → cellular organisms → Bacteria2357Open in IMG/M
3300010430|Ga0118733_100757947All Organisms → cellular organisms → Bacteria1934Open in IMG/M
3300010430|Ga0118733_105660768All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300010430|Ga0118733_108260713Not Available538Open in IMG/M
3300013098|Ga0164320_10567506Not Available586Open in IMG/M
3300013099|Ga0164315_10017345All Organisms → cellular organisms → Bacteria → Acidobacteria5682Open in IMG/M
3300013099|Ga0164315_10229145Not Available1515Open in IMG/M
3300013099|Ga0164315_10257636Not Available1421Open in IMG/M
3300013099|Ga0164315_10439385All Organisms → cellular organisms → Bacteria → Acidobacteria1058Open in IMG/M
3300013099|Ga0164315_10626013All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300013099|Ga0164315_10835845All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300013099|Ga0164315_11045147All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300013099|Ga0164315_11377746Not Available555Open in IMG/M
3300013099|Ga0164315_11452094All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium539Open in IMG/M
3300013101|Ga0164313_10000104All Organisms → cellular organisms → Bacteria53301Open in IMG/M
3300013101|Ga0164313_10001937All Organisms → cellular organisms → Bacteria18578Open in IMG/M
3300013101|Ga0164313_10003192All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium14634Open in IMG/M
3300013101|Ga0164313_10005473All Organisms → cellular organisms → Bacteria11229Open in IMG/M
3300013101|Ga0164313_10008793All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum8791Open in IMG/M
3300013101|Ga0164313_10008815All Organisms → cellular organisms → Bacteria → Proteobacteria8781Open in IMG/M
3300013101|Ga0164313_10009521All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria8432Open in IMG/M
3300013101|Ga0164313_10025363All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum5029Open in IMG/M
3300013101|Ga0164313_10042701All Organisms → cellular organisms → Bacteria3822Open in IMG/M
3300013101|Ga0164313_10052839All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM13420Open in IMG/M
3300013101|Ga0164313_10058806All Organisms → cellular organisms → Bacteria3239Open in IMG/M
3300013101|Ga0164313_10072713All Organisms → cellular organisms → Bacteria2893Open in IMG/M
3300013101|Ga0164313_10231446All Organisms → cellular organisms → Bacteria → Acidobacteria1557Open in IMG/M
3300013101|Ga0164313_10283743Not Available1391Open in IMG/M
3300013101|Ga0164313_10321747All Organisms → cellular organisms → Bacteria → Acidobacteria1297Open in IMG/M
3300013101|Ga0164313_10348901All Organisms → cellular organisms → Bacteria → Acidobacteria1239Open in IMG/M
3300013101|Ga0164313_10388427Not Available1166Open in IMG/M
3300013101|Ga0164313_10415030All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1123Open in IMG/M
3300013101|Ga0164313_10419814All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM11116Open in IMG/M
3300013101|Ga0164313_10515259Not Available994Open in IMG/M
3300013101|Ga0164313_10544496All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium963Open in IMG/M
3300013101|Ga0164313_10572583Not Available936Open in IMG/M
3300013101|Ga0164313_10601505Not Available910Open in IMG/M
3300013101|Ga0164313_10875292All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300013101|Ga0164313_10875385Not Available735Open in IMG/M
3300013101|Ga0164313_10900438Not Available723Open in IMG/M
3300013101|Ga0164313_10902798Not Available722Open in IMG/M
3300013101|Ga0164313_11129627Not Available635Open in IMG/M
3300013101|Ga0164313_11130357All Organisms → cellular organisms → Bacteria → Proteobacteria635Open in IMG/M
3300013101|Ga0164313_11502032Not Available543Open in IMG/M
3300013101|Ga0164313_11619070Not Available521Open in IMG/M
3300013233|Ga0172420_10405000All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300013233|Ga0172420_10858188Not Available678Open in IMG/M
3300013233|Ga0172420_11121891Not Available588Open in IMG/M
3300013233|Ga0172420_11185803Not Available571Open in IMG/M
3300014914|Ga0164311_10061316All Organisms → cellular organisms → Bacteria2238Open in IMG/M
3300014914|Ga0164311_10749093Not Available557Open in IMG/M
3300021508|Ga0190283_1028088Not Available1143Open in IMG/M
3300021508|Ga0190283_1069702All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300021508|Ga0190283_1083368Not Available591Open in IMG/M
3300021514|Ga0190293_1005593All Organisms → cellular organisms → Bacteria4216Open in IMG/M
3300021514|Ga0190293_1011574All Organisms → cellular organisms → Bacteria2902Open in IMG/M
3300021514|Ga0190293_1019919All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium2143Open in IMG/M
3300021514|Ga0190293_1039764All Organisms → cellular organisms → Bacteria → Proteobacteria1431Open in IMG/M
3300021514|Ga0190293_1118548Not Available713Open in IMG/M
3300021514|Ga0190293_1143451All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium631Open in IMG/M
(restricted) 3300023086|Ga0233407_10100157Not Available527Open in IMG/M
3300024262|Ga0210003_1398125Not Available500Open in IMG/M
(restricted) 3300024519|Ga0255046_10339175All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM2707Open in IMG/M
3300027758|Ga0209379_10244616All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter610Open in IMG/M
3300027820|Ga0209578_10561543Not Available508Open in IMG/M
3300027834|Ga0209344_10001537All Organisms → cellular organisms → Bacteria29442Open in IMG/M
3300027834|Ga0209344_10001991All Organisms → cellular organisms → Bacteria24162Open in IMG/M
3300027834|Ga0209344_10004253All Organisms → cellular organisms → Bacteria13291Open in IMG/M
3300027834|Ga0209344_10004704All Organisms → cellular organisms → Bacteria12309Open in IMG/M
3300027834|Ga0209344_10006324All Organisms → cellular organisms → Bacteria → Acidobacteria9791Open in IMG/M
3300027834|Ga0209344_10008181All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales8155Open in IMG/M
3300027834|Ga0209344_10009450All Organisms → cellular organisms → Bacteria → Acidobacteria7336Open in IMG/M
3300027834|Ga0209344_10208286All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium987Open in IMG/M
3300027834|Ga0209344_10550461All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium509Open in IMG/M
3300027852|Ga0209345_10134983All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → unclassified Thermoanaerobaculia → Thermoanaerobaculia bacterium1606Open in IMG/M
(restricted) 3300027856|Ga0255054_10280313All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
(restricted) 3300027856|Ga0255054_10385801Not Available681Open in IMG/M
(restricted) 3300027856|Ga0255054_10500226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
(restricted) 3300027856|Ga0255054_10602657Not Available531Open in IMG/M
3300027858|Ga0209013_10324812All Organisms → cellular organisms → Bacteria874Open in IMG/M
(restricted) 3300027868|Ga0255053_10062323All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium1773Open in IMG/M
(restricted) 3300027868|Ga0255053_10400127All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
(restricted) 3300027868|Ga0255053_10445980All Organisms → cellular organisms → Bacteria626Open in IMG/M
(restricted) 3300027868|Ga0255053_10587803Not Available538Open in IMG/M
(restricted) 3300027996|Ga0233413_10042340All Organisms → cellular organisms → Bacteria1745Open in IMG/M
3300032231|Ga0316187_10048277All Organisms → cellular organisms → Bacteria3407Open in IMG/M
3300032258|Ga0316191_10632386All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300032272|Ga0316189_10410884All Organisms → cellular organisms → Bacteria → Acidobacteria1047Open in IMG/M
3300032272|Ga0316189_10431559All Organisms → cellular organisms → Bacteria → Proteobacteria1018Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment29.05%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine20.95%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment16.22%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine13.51%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater6.76%
Hydrothermal Vent Microbial MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat6.08%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow2.70%
MarineEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine2.70%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.35%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002225Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6EnvironmentalOpen in IMG/M
3300005588Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300013099Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cmEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013233Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161EnvironmentalOpen in IMG/M
3300014914Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cmEnvironmentalOpen in IMG/M
3300021508Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-0-1_MGEnvironmentalOpen in IMG/M
3300021514Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-30-0-1_MGEnvironmentalOpen in IMG/M
3300023086 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_7_MGEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300027758Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027834Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027852Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes)EnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027858Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes)EnvironmentalOpen in IMG/M
3300027868 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300032231Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1EnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI24723J26617_1002739143300002225MarineMLWWLQKMQEYWWYVEAFRKRPERKDLVQIAGENRSI*
JGI24723J26617_1004308723300002225MarineMRCAKSLMLWCLQKMQEYWWYAEAFCKRPERKELVQIAGENRSI*
JGI24723J26617_1004731013300002225MarineLWCLQEMQEYWWYVEAFCKRPERKELVQIAGENRSI*
JGI24723J26617_1005598123300002225MarineMKCAKSLMLWCLQKTQEYWWSVEAFCKRTERKELVQIA*
JGI24723J26617_1007469023300002225MarineMRYTKSLMLWCLQKMQEYWWYVEAFCKRPERKESVQIAGENRSI*
JGI24723J26617_1008854113300002225MarineMRCTNSLMLWFLQKTQKYWWDVEAFCKYPERKELVQIA*
JGI24723J26617_1012171913300002225MarineWCLQKMQETWWYVEAFCKRPERKELVQIAVENRSIQVQD*
JGI24723J26617_1012234223300002225MarineMGCGNSLMLWCLQKTQEYWWYVEAFCKRPERKELVQIAGENRSI*
JGI24723J26617_1016898423300002225MarineSLMLWCLQKMQEYWWYVEAFCKRPERKDFVQVAGGNRSV*
Ga0070728_1019520613300005588Marine SedimentFCRMRCAKSLMLWCLQKTQGYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0070728_1050203023300005588Marine SedimentMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0070727_1042528923300005590Marine SedimentMRCAKTLMLWCLQEMQEYWWYVEAFCKRPERKELVQIA*
Ga0070727_1047437123300005590Marine SedimentMRCAKSLLLWYLQKMQEYWWYVEAFCKYPERKELLQIAGENRSI*
Ga0070727_1069164013300005590Marine SedimentMLWCLQKTQEYWWYVEAFCKHPERKELVQIAGENRSI*
Ga0070726_1069963113300005600Marine SedimentMRCANSLMLWCLQKTQEYWWYVEAFCKRPERKELVQIAG
Ga0070723_1045407413300005612Marine SedimentMLWRLQKMQEYWWYVEAFCKCPQRKKFVQITGENHSI*
Ga0070723_1058401613300005612Marine SedimentMLWYLQKMQEYWWYVEAFCKYPERKELVQIAGENRSI*
Ga0070723_1070914013300005612Marine SedimentFCRMRCAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQITGENRSI*
Ga0099972_1032233213300006467MarineMLPDEMCPFLMLWCLQKIQEYWWYVEAFCKRPERKELVQLAGENRSI*
Ga0099972_1043828823300006467MarineMLWRLQKMQEYWWYVEAFCKCPQRKELVQITGENRSI*
Ga0099972_1043988213300006467MarineMLWWLQKMQEYWWYVEAFCKRPERKELVQITGENRSI*
Ga0099972_1074925433300006467MarineMRCVKCLMLWHLQKTQEYWWYVEAFCKCHQRKNLVQIAGENRSI*
Ga0099972_1113244923300006467MarineRCANSLMLWRLQKMQEYWWYVEAFCKCPQRKELVQTTGENRSI*
Ga0099972_1197409423300006467MarineMRWCLQKTQEYWWYVEYFCKRPERKELVQIAGENRSI*
Ga0099972_1197564513300006467MarineFCRMRCANSLMLWYLQKMQEYWWYVEAFCKYPERKELVQIAGEYRSS*
Ga0099972_1290924223300006467MarineMLWYLQKMQEYWWYVEAFCRYPERKELVQIAGENRSI*
Ga0099972_1299544623300006467MarineMRCAKCLMLWCLQKTQEYWWYVEAFCKCHQRKNLVQI
Ga0099972_1304513213300006467MarineMRCANSLMLWYLQKIQEYWWYVEAFCKYPERKELVQIAGENR
Ga0099972_1328532623300006467MarineFCRMRCANSLMLWCLQKTQEYWWYVEAFCKYSERKELVQIAGENRSI*
Ga0099972_1356132323300006467MarineMRCAKSLMLWCMQKMQEYWWYVEAFCKRPERKELVQ
Ga0099972_1356189523300006467MarineMRCANSLMLWCLQKMQEYWWYVEAFCKRPERKELVQ
Ga0114918_1029471823300009149Deep SubsurfaceMLWCLHKTQEYWWYVEAFCERPERKDLVQIAGENRSI*
Ga0118731_10264717473300010392MarineMRWCLQKMQEYWWYIEAFCKRPERKDLVQIAGENRSI*
Ga0118731_10322573123300010392MarineMLWCLQKTQEYWWYVEAFCKYSERKELVQIAGENRSI*
Ga0118731_104020081183300010392MarineERFCRMRCAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQITGENRSI*
Ga0118731_10545736623300010392MarineLWRLQKMQEYWWYVEAFCKCPQREDLVQITGENRSI*
Ga0118731_10634700433300010392MarineMLWYLQKTQEYWWYVEAFCKCHQRKNLVQIAGENRSI*
Ga0118731_10639707743300010392MarineLMLWCLQKMQEYWWYVEAFCKRPERKELVQITGENRSI*
Ga0118731_10725197173300010392MarineMLWCLQKTQEYWWYVEAFCKCPERKELVQIAGENRSI*
Ga0118731_10748454483300010392MarineMLWHPQKTQEYWWYVEAFCGCHQRKNLVQIAGENRSI*
Ga0118731_10777545283300010392MarineMLWYLQKIQEYWWYVEAFCKYPERKELVQIAGENRSI*
Ga0118731_107899361133300010392MarineMLWCLQKMQEYWWYVEAFCKRPERKNLVQIAGENRSI*
Ga0118731_10810108193300010392MarineMLWCLQKMQEYWWYVEAFCKYPERKELVQIAGENRSI*
Ga0118731_10993968513300010392MarineMRCAKTLMLWCLQEMQEYWWYVEAFCKRPERRELVQIA
Ga0118731_11195951723300010392MarineMLWHLQKMQEYWWYVEAFCKRPERKELVQITGENRSI*
Ga0118731_11244888533300010392MarineMLWCLQKTQEYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0118731_11348765513300010392MarineNSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0118731_113769819113300010392MarineKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0118731_11386211473300010392MarineMLWCLQKMQEYWWYVETFCKRSERKELVQIAGENRSI*
Ga0118731_115385331123300010392MarineMLWYLQRMQEYWWYVEAFCKYPERKELVQIAGEYRSS*
Ga0118733_100006357283300010430Marine SedimentMLWHLQKTQEYWWYVEAFCGCHQRKNLVQIAGENRSI*
Ga0118733_10001881753300010430Marine SedimentMLWHLQKTQEYWWYVEAFCKCHQRKNLVQIAGENRSI*
Ga0118733_10002256273300010430Marine SedimentMRWCLQKTQEYWWNVEYFCKRPERKELVQIAGENRSI*
Ga0118733_10002818263300010430Marine SedimentMLWRLQKMQEYWWYVEAFCKCPQRKELVQTTGENRSI*
Ga0118733_10004585543300010430Marine SedimentMLWCLQKMQEYWWYVEAFRKCPQRKELVQITGENRSI*
Ga0118733_10012785413300010430Marine SedimentRFCRMRCANSLMLWYLQKMQEYWWYVEAFCKYPERKELVQIAGEYRSS*
Ga0118733_10024824743300010430Marine SedimentSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0118733_10031362613300010430Marine SedimentCAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQLAGENRSI*
Ga0118733_10033699813300010430Marine SedimentTERFCRMRCANSLMLWYLQKMQEYWWYVEAFCKYPERKELVQVAGENCSI*
Ga0118733_10052276713300010430Marine SedimentMLWCLQKTQEYWRYVEAFCKRPERKELVQIAGENRSI*
Ga0118733_10075794733300010430Marine SedimentMLWCLQKTQEYWWYVEAFCKHPERKELVQIAGKNRSI*
Ga0118733_10566076813300010430Marine SedimentMLWCLQKTQEYWWYVEAFCKCHQRKNLVQIAGENRSI*
Ga0118733_10826071323300010430Marine SedimentFCRMRCAKSLMLWCLQKMQEYWWYVEAFCKRPERKNLVQIAGENRSI*
Ga0164320_1056750623300013098Marine SedimentCRVRCAKSLMLWRLQKMQEYWWYAEAFCKCPQRKELVQITGENRSI*
Ga0164315_1001734573300013099Marine SedimentMLWWLQKTQEYWWYVEAFCKRPERKELVQIAGEIRSI*
Ga0164315_1022914513300013099Marine SedimentMLWCLQEMQEYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0164315_1025763623300013099Marine SedimentMLWCLQKMQEYWWYVEAFCKRPERKDLVQIAGENRSI*
Ga0164315_1043938523300013099Marine SedimentAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0164315_1062601323300013099Marine SedimentMLWCVQKTQEYWLYAEAFCAWPQRKELVQIAGENYSS*
Ga0164315_1083584513300013099Marine SedimentMLWCLQKTQEYWWYAEAFCKYPERKELVQIAGKNRSI*
Ga0164315_1104514713300013099Marine SedimentMLWFLKKMQEYWWYVEAFCKRPERKELVQITGENRSI*
Ga0164315_1137774623300013099Marine SedimentMLWCLQKMQEYWWYVEAFCKCPERKELVQIAGENRSI*
Ga0164315_1145209413300013099Marine SedimentMLWCLQKTQEYWWYAEAFCKRLERKELVQIAGENRSI*
Ga0164313_10000104133300013101Marine SedimentMLWCLQKVQEYWWYVEAFCKRPERKELVQIAGKNRSI*
Ga0164313_1000193773300013101Marine SedimentMLWCLQKMQEYWWYAEAFCKRPERKELVQIAGENRSI*
Ga0164313_1000319293300013101Marine SedimentMLWRLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0164313_10005473103300013101Marine SedimentFCRMRCAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIA*
Ga0164313_1000879313300013101Marine SedimentFCRMRCAKSLMLWCLQEMQEYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0164313_1000881563300013101Marine SedimentMFWCLQKSQEYWWYVEAFCKYPERGELVQIAGNNRSIQV*
Ga0164313_1000952193300013101Marine SedimentCRMRYAKSLMLWCLQKTQEYWWYIEAFCKHPERKELVQIAGKNRSI*
Ga0164313_1002536313300013101Marine SedimentMLWFLKKMQKYWWYVEAFCKYPERKELVQIAGKNRSI
Ga0164313_1004270113300013101Marine SedimentLMLWCLQKTQEYWWYAEAFCKYPERKELVQIAGKNRSI*
Ga0164313_1005283933300013101Marine SedimentMLWCLKKTQEYWWYVEAFCRRPERKELVQIAGENRSI*
Ga0164313_1005880613300013101Marine SedimentMLWYLQKTQKYWWYVESFCKRPERKELVQITGENRSI*
Ga0164313_1007271323300013101Marine SedimentMFWCLQKMQEYWWYVEAFCKRPGRKELVQIAGENRSS*
Ga0164313_1023144613300013101Marine SedimentMLWRLQKMQEYWWYVEAFCKCPQRIELVQITGENRSI*
Ga0164313_1028374343300013101Marine SedimentMLWCLQKMQEYWWYVEAFCKRPERKGLVQIAGKNRSI*
Ga0164313_1032174723300013101Marine SedimentMLWCLQKMQEYWWYVEAFCKYPERKELVQIAGKNRSI*
Ga0164313_1034890123300013101Marine SedimentMRCAKGLMLWCLQKSQEYWWYVEAFFKCHQRKNLVQITGENRSV*
Ga0164313_1038842723300013101Marine SedimentMLWWLQKKSQEYWWYVEAFYKRPERKELVQVAGENRSI*
Ga0164313_1041503023300013101Marine SedimentMLWCLKKMQEYWWYVEAFCKYPERKELVQIAGKNRLI*
Ga0164313_1041981423300013101Marine SedimentMLWYLQKMQEYWWYVEAFCKYPERKELVQIAGENHSF*
Ga0164313_1051525913300013101Marine SedimentMLWCLQKMQEYWWYVEAFFKRPERKELVQIAGENRSI*
Ga0164313_1054449613300013101Marine SedimentMLWCLQKTQEYWWYVEAFCKRLERKELVQIAGENRSI*
Ga0164313_1057258313300013101Marine SedimentMLWCLQKMQEYWWYVEAFCKYSERKELVQIVGKNRSF*
Ga0164313_1060150513300013101Marine SedimentMCPFLMLWSLKKSQEYWWYVEDFRKRPERKELVQIA*
Ga0164313_1087529223300013101Marine SedimentMSCAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQITGENRSI*
Ga0164313_1087538523300013101Marine SedimentMFWRLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0164313_1090043823300013101Marine SedimentMRCTNSLMLWCLQKKQEYWWYAEAFYKCPERKELVQIAGENRSI*
Ga0164313_1090279823300013101Marine SedimentFCRMRCANSLMLWCLQKMQEYWWYVEAFCKYPEREELVQIAGENRSI*
Ga0164313_1112962713300013101Marine SedimentMRWCLQKTQEYWWYVEAFCKRPGRKEMVQTAGENRLI
Ga0164313_1113035723300013101Marine SedimentMLWCLQKMQEYWWYAEDFCKCPERKELVQVVGENRSI*
Ga0164313_1150203213300013101Marine SedimentIERFCRMRCANSLMLWCLQKMQEYWWYVEAFCKRPERRELAQISGENRSI*
Ga0164313_1161907013300013101Marine SedimentMLWCLQKSQEYWWYVEAFCKRPERKELVQIAGKNRSI*
Ga0172420_1040500023300013233MarineMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRPI*
Ga0172420_1085818813300013233MarineMLWSLQKTQEYWWYVEAFCKRPERKELVQIAGENRST*
Ga0172420_1112189123300013233MarineMGCAKSLMLWYLRKMQEYWLYVEAFRKYPERKELVQTAGENRSI*
Ga0172420_1118580313300013233MarineMLWRLQKMQEYWWYVEAFCKRPQRKELVQTAGENRSI*
Ga0164311_1006131613300014914Marine SedimentMLWCLQKTQEYWWYVEAFCKYPERKELVQIAGENRSS*
Ga0164311_1074909323300014914Marine SedimentMFETWTERFCRMRCAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI*
Ga0190283_102808823300021508Hydrothermal Vent Microbial MatMLWRLQKMQEYWWYVEVFCKCPQRKELVQITGENRSV
Ga0190283_106970213300021508Hydrothermal Vent Microbial MatMLWCLQKKQKYWWYVEAFCKCPERKELVQIAGKNRSI
Ga0190283_108336833300021508Hydrothermal Vent Microbial MatMLWCLQKMQEYWWYVEAFCKRPERKGLVQIAGKNRSI
Ga0190293_100559323300021514Hydrothermal Vent Microbial MatMSNSLMLWYLKKTQEYWWYVEAFCKYPERKGLVQIAGENRSI
Ga0190293_101157433300021514Hydrothermal Vent Microbial MatMFWCLQKMQEYWWYVEAFCKRPGRKELVQIASENRSS
Ga0190293_101991933300021514Hydrothermal Vent Microbial MatMRCANPLMLWCLQKTQEYWWYVEAFCKRLERKELVQIAGENRSI
Ga0190293_103976423300021514Hydrothermal Vent Microbial MatMFWCLQKTQEYWWCVEDFCKYPERKELVQIAGENCSI
Ga0190293_111854823300021514Hydrothermal Vent Microbial MatMFWCLQKMQEYWWYVEAFCKYSERRELVQIVGKNRSI
Ga0190293_114345113300021514Hydrothermal Vent Microbial MatMCKPLMLWCLQKTQEYWWYAEAFCKRLERKELVQIAGENRSI
(restricted) Ga0233407_1010015723300023086SeawaterMRCANSLMLWYLQKMQEYWWYVEAFSKYPERKELVQIAGENRSI
Ga0210003_139812523300024262Deep SubsurfaceMLWCLHKTQEYWWYVEAFCERPERKDLVQIAGENRSI
(restricted) Ga0255046_1033917513300024519SeawaterMLWRLQKMQEYWWYVEAFCKCPQRKELVQITGENRSI
Ga0209379_1024461613300027758Marine SedimentMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI
Ga0209578_1056154313300027820Marine SedimentMRCANSLMRWCLQKTQEYWWYVEYFCKRPERKELV
Ga0209344_10001537213300027834MarineMRYTKSLMLWCLQKMQEYWWYVEAFCKRPERKESVQIAGENRSI
Ga0209344_1000199193300027834MarineMFWRLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI
Ga0209344_1000425363300027834MarineMLWCLQKMQEYWWYAEAFCKRPERKELVQIAGENRSI
Ga0209344_10004704113300027834MarineMGCGNSLMLWCLQKTQEYWWYVEAFCKRPERKELVQIAGENRSI
Ga0209344_1000632463300027834MarineMRCTNSLMLWFLQKTQKYWWDVEAFCKYPERKELVQIA
Ga0209344_1000818163300027834MarineMLWCLQKMQETWWYVEAFCKRPERKELVQIAVENRSIQVQD
Ga0209344_1000945023300027834MarineMLWWLQKMQEYWWYVEAFRKRPERKDLVQIAGENRSI
Ga0209344_1020828623300027834MarineMLWCLQKMQEYWWYIEAFCKRPERKELVQIAGENRSI
Ga0209344_1055046123300027834MarineMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENCSI
Ga0209345_1013498313300027852MarineKSLMLWCLQKMQECWWYVEAFCKRLERKELVQIAGENRSILVSDKVAQ
(restricted) Ga0255054_1028031313300027856SeawaterNSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI
(restricted) Ga0255054_1038580123300027856SeawaterMLWRLQKMQEYWWYVEAFCKRPERKDLVQIAGENRSI
(restricted) Ga0255054_1050022623300027856SeawaterMLWCLQKTQEYWWYVEAFCKRPERKEFVQIAGENRSI
(restricted) Ga0255054_1060265723300027856SeawaterMRCDKSLMLWHLQKKQEYWWYVEAFCKCPELKELVQIA
Ga0209013_1032481223300027858MarineMLWCLQKMQEYWWYVEAFCQRPERKELVQITGENRSI
(restricted) Ga0255053_1006232333300027868SeawaterRCANSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI
(restricted) Ga0255053_1040012713300027868SeawaterERFCRMRCDKSLMLWHLQKKQEYWWYVEAFCKCPELKELVQIAGENRSV
(restricted) Ga0255053_1044598013300027868SeawaterMLWYLQKMQEYWWYVEAFCKYPERKGLVQIAGENRSI
(restricted) Ga0255053_1058780323300027868SeawaterMLWFLQKMQEYWWYVEAFCKYPERKELVQIAGKNRSI
(restricted) Ga0233413_1004234033300027996SeawaterMLWCLKKMQEYWWYVEAFCKRPERKELVQIAGENRSI
Ga0316187_1004827723300032231Worm BurrowMLWCLRKMQEYWWYVEAFCKRPERKELVQIAGENRSI
Ga0316191_1063238613300032258Worm BurrowRFCRMRCANSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI
Ga0316189_1041088413300032272Worm BurrowRFCRMRCANSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIA
Ga0316189_1043155923300032272Worm BurrowMRCAKCLMLWCMQKMQEYWWYIEVFCKRPERKELVQT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.