NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F048237

Metagenome / Metatranscriptome Family F048237

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048237
Family Type Metagenome / Metatranscriptome
Number of Sequences 148
Average Sequence Length 86 residues
Representative Sequence LLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Number of Associated Samples 133
Number of Associated Scaffolds 148

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.68 %
% of genes near scaffold ends (potentially truncated) 98.65 %
% of genes from short scaffolds (< 2000 bps) 94.59 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (97.973 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(17.568 % of family members)
Environment Ontology (ENVO) Unclassified
(37.162 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 40.24%    Coil/Unstructured: 59.76%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 148 Family Scaffolds
PF04865Baseplate_J 5.41
PF06841Phage_T4_gp19 1.35


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001833|ACM24_1027890All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1651Open in IMG/M
3300003430|JGI25921J50272_10080611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1702Open in IMG/M
3300004787|Ga0007755_1568608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1708Open in IMG/M
3300004793|Ga0007760_10141145All Organisms → Viruses → Predicted Viral1356Open in IMG/M
3300005400|Ga0066867_10268634All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1615Open in IMG/M
3300005662|Ga0078894_10298471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11461Open in IMG/M
3300006751|Ga0098040_1247663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1516Open in IMG/M
3300006802|Ga0070749_10756606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1517Open in IMG/M
3300006874|Ga0075475_10268944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Aurunvirus → Synechococcus virus STIM5711Open in IMG/M
3300006919|Ga0070746_10350284All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1669Open in IMG/M
3300007344|Ga0070745_1018497All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM13131Open in IMG/M
3300007538|Ga0099851_1330386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1534Open in IMG/M
3300007541|Ga0099848_1255295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1612Open in IMG/M
3300007640|Ga0070751_1103696All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11174Open in IMG/M
3300007640|Ga0070751_1277137All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1630Open in IMG/M
3300007647|Ga0102855_1177359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1569Open in IMG/M
3300007718|Ga0102852_1060542All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1724Open in IMG/M
3300007862|Ga0105737_1109358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1702Open in IMG/M
3300007864|Ga0105749_1146269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1552Open in IMG/M
3300007956|Ga0105741_1161388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1550Open in IMG/M
3300008108|Ga0114341_10023374All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM14331Open in IMG/M
3300009002|Ga0102810_1185610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1640Open in IMG/M
3300009039|Ga0105152_10227891All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1769Open in IMG/M
3300009149|Ga0114918_10489519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1660Open in IMG/M
3300009149|Ga0114918_10614843All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1574Open in IMG/M
3300009151|Ga0114962_10554018All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1602Open in IMG/M
3300009155|Ga0114968_10736340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1515Open in IMG/M
3300009161|Ga0114966_10641485All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1588Open in IMG/M
3300009180|Ga0114979_10489510All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1712Open in IMG/M
3300009180|Ga0114979_10757581All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1547Open in IMG/M
3300009183|Ga0114974_10230567All Organisms → Viruses → Predicted Viral1116Open in IMG/M
3300009228|Ga0103854_1033788All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1576Open in IMG/M
3300009593|Ga0115011_10838990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1764Open in IMG/M
3300009608|Ga0115100_10398905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1689Open in IMG/M
3300009608|Ga0115100_10511833All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1574Open in IMG/M
3300009608|Ga0115100_10515562All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1531Open in IMG/M
3300009608|Ga0115100_10566829All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1654Open in IMG/M
3300009608|Ga0115100_10696057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1539Open in IMG/M
3300010354|Ga0129333_10898608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1749Open in IMG/M
3300010354|Ga0129333_11045429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1684Open in IMG/M
3300010354|Ga0129333_11722892All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1509Open in IMG/M
3300010430|Ga0118733_103917783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1801Open in IMG/M
3300010885|Ga0133913_12990282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11128Open in IMG/M
3300011118|Ga0114922_11294358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1588Open in IMG/M
3300012370|Ga0123369_1031122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1668Open in IMG/M
3300012394|Ga0123365_1100516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1657Open in IMG/M
3300012504|Ga0129347_1250302All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1674Open in IMG/M
3300012520|Ga0129344_1158362All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1691Open in IMG/M
3300012523|Ga0129350_1235471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1753Open in IMG/M
3300012525|Ga0129353_1135077All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1683Open in IMG/M
3300012525|Ga0129353_1189449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1693Open in IMG/M
3300012525|Ga0129353_1337797All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1527Open in IMG/M
3300012528|Ga0129352_10207054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1681Open in IMG/M
3300012702|Ga0157596_1033561All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1750Open in IMG/M
3300012711|Ga0157607_1067369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1746Open in IMG/M
3300012716|Ga0157605_1218329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1664Open in IMG/M
3300012717|Ga0157609_1086133All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1773Open in IMG/M
3300012722|Ga0157630_1117973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1743Open in IMG/M
3300012731|Ga0157616_1095849All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1708Open in IMG/M
3300012733|Ga0157606_1303517All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1689Open in IMG/M
3300012759|Ga0157626_1169363All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1838Open in IMG/M
3300012760|Ga0138273_1176450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11052Open in IMG/M
3300012761|Ga0138288_1093072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1543Open in IMG/M
3300012771|Ga0138270_1248385All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1702Open in IMG/M
3300012777|Ga0138292_1009941All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1805Open in IMG/M
3300012783|Ga0157524_122466All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1633Open in IMG/M
3300012959|Ga0157620_1010157All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1665Open in IMG/M
3300012959|Ga0157620_1051286All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1517Open in IMG/M
3300012968|Ga0129337_1236752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1728Open in IMG/M
3300013079|Ga0157536_1223644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11546Open in IMG/M
(restricted) 3300013131|Ga0172373_10146616All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11684Open in IMG/M
3300013295|Ga0170791_10403712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1573Open in IMG/M
3300013295|Ga0170791_13241809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1792Open in IMG/M
3300013310|Ga0157622_1169715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1785Open in IMG/M
3300015243|Ga0180041_108319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1836Open in IMG/M
3300016681|Ga0180043_160450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1787Open in IMG/M
3300016683|Ga0180042_151550All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1750Open in IMG/M
3300016758|Ga0182070_1219712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1645Open in IMG/M
3300017708|Ga0181369_1055138All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1882Open in IMG/M
3300017728|Ga0181419_1123384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1629Open in IMG/M
3300017749|Ga0181392_1060533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11155Open in IMG/M
3300017752|Ga0181400_1148567All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1665Open in IMG/M
3300017757|Ga0181420_1214996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1554Open in IMG/M
3300017762|Ga0181422_1245769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1530Open in IMG/M
3300017764|Ga0181385_1271995All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1506Open in IMG/M
3300017766|Ga0181343_1126900All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1716Open in IMG/M
3300017770|Ga0187217_1249269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1580Open in IMG/M
3300017776|Ga0181394_1117733All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1839Open in IMG/M
3300017781|Ga0181423_1124781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11000Open in IMG/M
3300017781|Ga0181423_1160885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1862Open in IMG/M
3300017782|Ga0181380_1245220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1595Open in IMG/M
3300017788|Ga0169931_10805969All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1602Open in IMG/M
3300017952|Ga0181583_10815258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1548Open in IMG/M
3300017962|Ga0181581_10747119All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1585Open in IMG/M
3300018423|Ga0181593_10560362All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1828Open in IMG/M
3300018424|Ga0181591_11058244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1548Open in IMG/M
3300018876|Ga0181564_10695214All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1535Open in IMG/M
3300019267|Ga0182069_1367195All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1681Open in IMG/M
3300019277|Ga0182081_1179831All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1612Open in IMG/M
3300020074|Ga0194113_11088118All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1528Open in IMG/M
3300020109|Ga0194112_10333734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11129Open in IMG/M
3300020184|Ga0181573_10503168All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1530Open in IMG/M
3300020196|Ga0194124_10096946All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11688Open in IMG/M
3300020220|Ga0194119_10785091All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1565Open in IMG/M
3300020516|Ga0207935_1016268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11026Open in IMG/M
3300020539|Ga0207941_1002007All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM14798Open in IMG/M
3300020550|Ga0208600_1023809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1972Open in IMG/M
3300020564|Ga0208719_1093629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1503Open in IMG/M
3300021356|Ga0213858_10495937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1565Open in IMG/M
3300021425|Ga0213866_10166787All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11159Open in IMG/M
3300021519|Ga0194048_10300159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1578Open in IMG/M
3300022200|Ga0196901_1003247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM17585Open in IMG/M
(restricted) 3300023089|Ga0233408_10083010All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1645Open in IMG/M
3300023566|Ga0228679_1016071All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1761Open in IMG/M
(restricted) 3300024255|Ga0233438_10273847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1657Open in IMG/M
3300024262|Ga0210003_1336885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1566Open in IMG/M
3300025108|Ga0208793_1032181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11737Open in IMG/M
3300025108|Ga0208793_1129396All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1683Open in IMG/M
3300025168|Ga0209337_1116746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11211Open in IMG/M
3300025671|Ga0208898_1018709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM13133Open in IMG/M
3300025687|Ga0208019_1206078All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1511Open in IMG/M
3300025769|Ga0208767_1225771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1607Open in IMG/M
3300025889|Ga0208644_1356766All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1555Open in IMG/M
3300026458|Ga0247578_1061340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1725Open in IMG/M
3300026465|Ga0247588_1077185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1662Open in IMG/M
3300026468|Ga0247603_1063843All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1748Open in IMG/M
3300027644|Ga0209356_1054029All Organisms → Viruses → Predicted Viral1246Open in IMG/M
3300027708|Ga0209188_1065638All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11554Open in IMG/M
(restricted) 3300027728|Ga0247836_1241545All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1684Open in IMG/M
3300027749|Ga0209084_1291505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1619Open in IMG/M
3300027762|Ga0209288_10064306All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11116Open in IMG/M
3300027782|Ga0209500_10343132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1619Open in IMG/M
(restricted) 3300027861|Ga0233415_10479081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1601Open in IMG/M
(restricted) 3300027868|Ga0255053_10243881All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1866Open in IMG/M
3300027974|Ga0209299_1007157All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM15511Open in IMG/M
3300028109|Ga0247582_1141151All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1621Open in IMG/M
(restricted) 3300028114|Ga0247835_1207619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1663Open in IMG/M
3300028330|Ga0247601_1029361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1737Open in IMG/M
(restricted) 3300028557|Ga0247832_1118199All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11084Open in IMG/M
(restricted) 3300028569|Ga0247843_1024505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM14501Open in IMG/M
(restricted) 3300028581|Ga0247840_10537579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1537Open in IMG/M
3300032046|Ga0315289_11214882All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1606Open in IMG/M
3300032053|Ga0315284_11647607All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1671Open in IMG/M
3300032516|Ga0315273_10600939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11459Open in IMG/M
3300033557|Ga0316617_102796112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1508Open in IMG/M
3300033993|Ga0334994_0339462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1748Open in IMG/M
3300034066|Ga0335019_0142079All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11586Open in IMG/M
3300034272|Ga0335049_0046198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM13238Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater17.57%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous14.19%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake10.14%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.43%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.08%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.08%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.41%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.05%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.70%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface2.70%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.70%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.03%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.03%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.03%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.03%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.35%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.68%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.68%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.68%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment0.68%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.68%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.68%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001833Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM24, ROCA_DNA012_0.2um_2lEnvironmentalOpen in IMG/M
3300003430Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SDEnvironmentalOpen in IMG/M
3300004787Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005400Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006751Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007647Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009039Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cmEnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009228Microbial communities of water from Amazon river, Brazil - RCM7EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300012370Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_209_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012394Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012702Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012711Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012716Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012722Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012733Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012759Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012760Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012761Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012771Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012777Freshwater microbial communities from Lake Simoncouche, Canada - S_140709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012783Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES002 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012959Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES150 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013079Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES022 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013310Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300015243Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES148 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016681Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES152 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016683Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES128 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016758Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071403BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019267Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071402VT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019277Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020184Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300020516Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020539Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020564Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027868 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028330Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 76R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028557 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4mEnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ACM24_102789013300001833Marine PlanktonLDDTTGHLLPVFPENAVLLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERTINMTGLGGTGLIGSAFYIDNVFSD*
JGI25921J50272_1008061123300003430Freshwater LakeNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0007755_156860813300004787Freshwater LakeLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS*
Ga0007760_1014114533300004793Freshwater LakeLADDGTLQPVFPENGLLLFYSPNGPSDSVMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITVERIINLVGLGATGAIGSGAMVTNILS*
Ga0066867_1026863413300005400MarineENAILLFYSPLSASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVANVTGLGATGKYGSGFYVADILA*
Ga0078894_1029847113300005662Freshwater LakeLATDGQLMPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0098040_124766313300006751MarineILLFYSPLSASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVANVTGLGATGKYGSGFYVADILA*
Ga0070749_1075660623300006802AqueousASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERSVEITGLGATGKYGSGFYIADVLN*
Ga0075475_1026894423300006874AqueousVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS*
Ga0070746_1035028423300006919AqueousENAVLLFYSPLSSSDSVMPAGGASAATPAFAYSYQLTGTPAVRPEYYIRERRVVRAEITVERAVNVTGLGASGAYGSGFFIADVLN*
Ga0070745_101849743300007344AqueousLPIFPENAIMLFYSPLGANDAVLPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGATGLCGSGAFINDILA*
Ga0099851_133038623300007538AqueousGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGMGSTGGFGSGFYINDVFA*
Ga0099848_125529523300007541AqueousGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS*
Ga0070751_110369613300007640AqueousAEGRYLATDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS*
Ga0070751_127713723300007640AqueousAGGASAATPAFAYSYQLTGTPAVRPEYYIRERRVVRAEITVERSAEVTGLGATGAFGSGFYIADVLN*
Ga0102855_117735923300007647EstuarineRRLADDGTLTPVFPENAVLLFYSPLSASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGASGAFGSGFYLADVFA*
Ga0102852_106054213300007718EstuarineRKLADDGTLLPVFPENGVLLFYSPLGASDSVMPAGGASAATPSYAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNMTGLGATGLFGSGFYIDNVFA*
Ga0105737_110935823300007862Estuary WaterYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGSFGSGFFVADVFA*
Ga0105749_114626923300007864Estuary WaterFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGASGAYGSGFFVNNVFA*
Ga0105741_116138813300007956Estuary WaterAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGASGAFGSGFYVADVFA*
Ga0114341_1002337413300008108Freshwater, PlanktonILLFYSPNGPSDSIMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATGLIGSGAMITNILS*
Ga0102810_118561023300009002EstuarineVLLFYSPLSSSDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGASGAFGSGFYLADVFA*
Ga0105152_1022789123300009039Lake SedimentPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVINLVGLGATGLIGSGAMITDILS*
Ga0114918_1048951923300009149Deep SubsurfaceSASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIANVTGLGATGKYGSGFFISNVLA*
Ga0114918_1061484323300009149Deep SubsurfaceSDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIANVTGLGATGRYGSGFFISNVLA*
Ga0114962_1055401823300009151Freshwater LakeLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNILS*
Ga0114968_1073634013300009155Freshwater LakeTDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0114966_1064148513300009161Freshwater LakeGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS*
Ga0114979_1048951013300009180Freshwater LakeTLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0114979_1075758113300009180Freshwater LakeENGVLLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS*
Ga0114974_1023056733300009183Freshwater LakeGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVINLVGLGATGLIGSGAMITDILS*
Ga0103854_103378813300009228River WaterDGQLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0115011_1083899013300009593MarineLLFYSPLSASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIANVTGLGATGKYGSGFFIANVLA*
Ga0115100_1039890513300009608MarineAGGASAATPSYAYTYQLTGTPAVRPEYYIRERRVVRAEITVERTINMTGLGGTGKIGSAFYMANVFED*
Ga0115100_1051183323300009608MarineVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEVTVERTINMTGLGGTGLIGSAFFVDNVFSD*
Ga0115100_1051556213300009608MarineGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNLTGLGATGGFGSGFLIQNVFS*
Ga0115100_1056682923300009608MarineSDSVMPAGGASAATPSYAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNMTGLGATGLFGSGFYIDNVFA*
Ga0115100_1069605713300009608MarineRKLAAMDEQLEHVFPEDAVLLFYSPLGASGSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNLTGLGATGKYGSGFLIENVFA*
Ga0129333_1089860813300010354Freshwater To Marine Saline GradientGRYLATDGTLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGANGAFGSGFYIDDVFA*
Ga0129333_1104542923300010354Freshwater To Marine Saline GradientLGANDSVLPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGASGLAGSGAFINDILA*
Ga0129333_1172289213300010354Freshwater To Marine Saline GradientLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0118733_10391778313300010430Marine SedimentVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIANVTGLGATGRYGSGFFISNVLA*
Ga0133913_1299028233300010885Freshwater LakeGPSDSVMPAGVANAATPAFSYTYQLTGAPAVRPEYYIRERRVVRAEITVERIINLVGLGANGAIGSGAMVTDILS*
Ga0114922_1129435813300011118Deep SubsurfaceAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERSVNITGLGASGAFGSGFYVSNVFA*
Ga0123369_103112213300012370MarineASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGAFGSGFYIADVFES*
Ga0123365_110051623300012394MarineLLFYSPLSASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEVTVERAVNITGLGATGKYGSGFFIADVFA*
Ga0129347_125030213300012504AqueousVLLFYSPLSASDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATSKYGSGFYINDVFA*
Ga0129344_115836213300012520AqueousLADDGTLTPVFPENAMLLFYSPLSASDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGAFGSGFYINDVFA*
Ga0129350_123547123300012523AqueousAVLLFYSPLSASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGMGSTGGFGSGFYINDVFA*
Ga0129353_113507723300012525AqueousPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGATGLCGSGAFINDILA*
Ga0129353_118944913300012525AqueousSASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEVTVERAVNITGLGATGKYGSGFFIEDVFA*
Ga0129353_133779723300012525AqueousASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEVTVERAVNITGLGATGKYGSGFFIADVFA*
Ga0129352_1020705413300012528AqueousASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEVTVERAVNITGLGATGKYGSGFFIADVFA*
Ga0157596_103356113300012702FreshwaterTLQPVFPANGILLFYSPNGPSDSIMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATGLIGSGAMITNILS*
Ga0157607_106736923300012711FreshwaterDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIVNPVGLGATGRIGSGAMITDILS*
Ga0157605_121832923300012716FreshwaterLLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS*
Ga0157609_108613323300012717FreshwaterYLATDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS*
Ga0157630_111797323300012722FreshwaterFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS*
Ga0157616_109584913300012731FreshwaterAVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITDILA*
Ga0157606_130351713300012733FreshwaterPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS*
Ga0157626_116936323300012759FreshwaterRYLATDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS*
Ga0138273_117645033300012760Freshwater LakeLQPVFPENGVLLFYSPNGPSDAVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLLGSGAMITNILS*
Ga0138288_109307223300012761Freshwater LakeQPVFPSNGIPLFYSPNGPSDSIMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATGLIGSGAMITDILS*
Ga0138270_124838523300012771Freshwater LakeENGVLLFYSPNGPSDAVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLLGSGAMITNILS*
Ga0138292_100994113300012777Freshwater LakeGRYLAESGELLPVFPENGLLLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYVRERRVVRAEITVERVVNLVGLGATNLIGSGAMVTNILGV*
Ga0157524_12246623300012783FreshwaterENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNILS*
Ga0157620_101015713300012959FreshwaterSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIVNPVGLGATGRIGSGAMITDILS*
Ga0157620_105128613300012959FreshwaterLLPVFPENGVLLFYSPNGPSDAVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITDILA*
Ga0129337_123675213300012968AqueousSVLPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGASGLAGSGAFINDILA*
Ga0157536_122364423300013079FreshwaterVAEGRYLATDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNILS*
(restricted) Ga0172373_1014661613300013131FreshwaterNGLLLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIVNLVGLGATGAIGSGAMVTDILS*
Ga0170791_1040371213300013295FreshwaterENGILLFYSPNGPSDSVMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITVERIINLVGLGANGAIGSGAMVTDILS*
Ga0170791_1324180923300013295FreshwaterADDGTLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITVERIINLVGLGANGAIGSGAMVTDILS*
Ga0157622_116971513300013310FreshwaterDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS*
Ga0180041_10831923300015243FreshwaterYLATDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGIPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS*
Ga0180043_16045013300016681FreshwaterGRYLAENGQLLPVFPENGVLLFYSPNGPSDAVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITDILA
Ga0180042_15155023300016683FreshwaterATDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Ga0182070_121971223300016758Salt MarshRQLAANGELLPIFPENAILLFYSPLGANDSVLPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGATGLCGSGAFINDILA
Ga0181369_105513823300017708MarineSLQPVFPENAIVLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGANGLYGSGFFCADVFA
Ga0181419_112338413300017728SeawaterDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNLTGLGATGKYGSGFLIENVFS
Ga0181392_106053333300017749SeawaterRKLNDADGQLLPVFPEDAVLLFYSPLGASDSVMPAGGASSATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERTINMTGLGGTGKIGSAFYMANVFED
Ga0181400_114856723300017752SeawaterDGSLTPVFPENAVCLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGAFGSGFYVADVFA
Ga0181420_121499623300017757SeawaterADGSLTPVFPENAVCLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGSFGSGFFVADVFA
Ga0181422_124576913300017762SeawaterAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERTINMTGLGGTGKIGSAFYMANVFED
Ga0181385_127199523300017764SeawaterATQHLEHVFPENAVLLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATNKIGSGFYIGDVFAGNP
Ga0181343_112690023300017766Freshwater LakePVFPANGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0187217_124926923300017770SeawaterASDSVLPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGKYGSGFLIENVFA
Ga0181394_111773323300017776SeawaterPEDGIMLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGSFGSGFFVADVFA
Ga0181423_112478113300017781SeawaterLLPVFPEDAVLLFYSPLGASDSVMPAGGASSATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERTINMTGLGGTGKIGSAFYMANVFED
Ga0181423_116088523300017781SeawaterLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAINMTGLGGTGLIGSAFYIDNVFSD
Ga0181380_124522013300017782SeawaterAICLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGAYGSGFFVGDVFA
Ga0169931_1080596923300017788FreshwaterAEGRYLATDGSLEPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0181583_1081525813300017952Salt MarshILLFYSPLGANDAVLPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGASGLAGSGAFINDILA
Ga0181581_1074711923300017962Salt MarshENAILLFYSPLGANDAVLPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGASGLAGSGAFINDILA
Ga0181593_1056036223300018423Salt MarshMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAINMTGLGGTGKIGSGFYIDNVFSD
Ga0181591_1105824423300018424Salt MarshGTLLPVFPENAILLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERSVEITGLGATGKYGSGFYIADVLN
Ga0181564_1069521423300018876Salt MarshYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAINLTGLGGTGLIGSGFYIDNVFSD
Ga0182069_136719523300019267Salt MarshFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAINMTGLGGTGKIGSGFYIDNVFSD
Ga0182081_117983113300019277Salt MarshVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGASGLAGSGAFINDILA
Ga0194113_1108811813300020074Freshwater LakeRYLATDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0194112_1033373413300020109Freshwater LakeYLATDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0181573_1050316813300020184Salt MarshNDSVLPAGGASSATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNVVGLGATGLAGSGAFINDILA
Ga0194124_1009694613300020196Freshwater LakeENAVLLFYSPLSASDSVMPAGGANAATPAYAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVINITGLGATGAFGSGFYIDDVFA
Ga0194119_1078509123300020220Freshwater LakeFYSPLSASDSVMPAGGANAATPAYAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVINITGLGATGAFGSGFYIDDVFA
Ga0207935_101626813300020516FreshwaterSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMISNILG
Ga0207941_100200753300020539FreshwaterANGILLFYSPNGPSDSIMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATGLIGSGAMITNILS
Ga0208600_102380933300020550FreshwaterYLAQDGTLQPVFPANGILLFYSPNGPSDSIMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATGLIGSGAMITNILS
Ga0208719_109362923300020564FreshwaterPVFPENGILLFYSPNCPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0213858_1049593723300021356SeawaterASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNLTGLGATGKIGSGFYINNVFA
Ga0213866_1016678713300021425SeawaterLFYSPLSASDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNITGLGSTGLFGSGFYINDVFA
Ga0194048_1030015923300021519Anoxic Zone FreshwaterLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Ga0196901_100324713300022200AqueousGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS
(restricted) Ga0233408_1008301013300023089SeawaterPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGANGLYGSGFFCADLFA
Ga0228679_101607123300023566SeawaterKLAQNDASLEHVFPENAVMLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGASGAYGSGFFVNNVFA
(restricted) Ga0233438_1027384713300024255SeawaterMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNLTGLGATGKYGSGFLIENVFA
Ga0210003_133688513300024262Deep SubsurfaceAVLLFYSPLSASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIANVTGLGATGRYGSGFFISNVLA
Ga0208793_103218143300025108MarineENAIVLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGANGLYGSGFFCADVFA
Ga0208793_112939623300025108MarineLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGAYGSGFYVGDVFA
Ga0209337_111674613300025168MarineEGRKLEDDGTLSPVFPEDGILLFYSPLSASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNVTGLGATGAYGSGFFIADVLN
Ga0208898_101870913300025671AqueousLPIFPENAIMLFYSPLGANDAVLPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGATGLCGSGAFINDILA
Ga0208019_120607823300025687AqueousENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS
Ga0208767_122577113300025769AqueousGHLEPVFPENAVLLFYSPLGASDSVMPAGGASAATPAYAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS
Ga0208644_135676613300025889AqueousEGRYLATDGTLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTNILGS
Ga0247578_106134013300026458SeawaterPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGSIGSGFFIGDVFAGNP
Ga0247588_107718513300026465SeawaterGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGSFGSGFFVADVFA
Ga0247603_106384323300026468SeawaterMLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGSFGSGFFVADVFA
Ga0209356_105402933300027644Freshwater LakeRYLADDGTLQPVFPENGLLLFYSPNGPSDSVMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITVERIINLVGLGATGAIGSGAMVTNILS
Ga0209188_106563843300027708Freshwater LakeLLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
(restricted) Ga0247836_124154523300027728FreshwaterPNGPSDSVMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITVERIINLVGLGATGAIGSGAMVTNILS
Ga0209084_129150513300027749Freshwater LakeRYLATDGSLQPVFPENGVLLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Ga0209288_1006430613300027762Freshwater SedimentLAQDGQLMPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0209500_1034313223300027782Freshwater LakeSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
(restricted) Ga0233415_1047908113300027861SeawaterMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGASGAFGSGFYVADVFA
(restricted) Ga0255053_1024388113300027868SeawaterAEGRQLAADGSLQPVFPENAIVLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGANGLYGSGFFCADVFA
Ga0209299_100715713300027974Freshwater LakePVFPENGLLLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYVRERRVVRAEITVERVVNLVGLGATNLIGSGAMVTNILGV
Ga0247582_114115113300028109SeawaterDGSLTPVFPENAICLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGAYGSGFFVNNVFA
(restricted) Ga0247835_120761923300028114FreshwaterPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Ga0247601_102936113300028330SeawaterQLMADGTLSPVFPENAICLFYSPLGASDSVMPAGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGAFGSGFYVADVFA
(restricted) Ga0247832_111819913300028557FreshwaterRFLAENGQLLPVFPENGILLFYSPNGPSDAVMPSGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITNILA
(restricted) Ga0247843_102450513300028569FreshwaterLSASDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNITGLGANSAFGSGFYIDDVFA
(restricted) Ga0247840_1053757913300028581FreshwaterENGQLLPVFPENGILLFYSPNGPSDAVMPSGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITNILA
Ga0315289_1121488223300032046SedimentPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITVERVINLVGLGATGLIGSGAMVTNILS
Ga0315284_1164760713300032053SedimentNNKMPFSGNTGCRLPSVAEGRYLATDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITVERVINLVGLGATGLIGSGAMVTNILS
Ga0315273_1060093913300032516SedimentLNDLGELQPVFPENAMVLFYSPLSASDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNITGLGSTGLFGSGFYIDDVFA
Ga0316617_10279611223300033557SoilMPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMITDVLS
Ga0334994_0339462_459_7463300033993FreshwaterDGSLQPVFPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0335019_0142079_1323_15863300034066FreshwaterPENGILLFYSPNGPSDSVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Ga0335049_0046198_2941_32373300034272FreshwaterLAQNGQLLPVFPENGILLFYSPNGPSDAVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITNILA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.