NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F048204

Metagenome / Metatranscriptome Family F048204

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048204
Family Type Metagenome / Metatranscriptome
Number of Sequences 148
Average Sequence Length 45 residues
Representative Sequence RDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG
Number of Associated Samples 112
Number of Associated Scaffolds 148

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.65 %
% of genes from short scaffolds (< 2000 bps) 88.51 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.649 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(24.324 % of family members)
Environment Ontology (ENVO) Unclassified
(37.162 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.324 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.17%    β-sheet: 0.00%    Coil/Unstructured: 95.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 148 Family Scaffolds
PF02321OEP 72.30
PF06912DUF1275 2.70
PF03600CitMHS 0.68
PF14833NAD_binding_11 0.68
PF14559TPR_19 0.68
PF00034Cytochrom_C 0.68
PF03404Mo-co_dimer 0.68
PF00563EAL 0.68
PF10017Methyltransf_33 0.68
PF16576HlyD_D23 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 148 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 144.59
COG3619Uncharacterized membrane protein YoaK, UPF0700 familyFunction unknown [S] 2.70
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.68
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.68
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.68
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.68

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.65 %
UnclassifiedrootN/A1.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2065487018|GPINP_F5MS3JC02H8TQIAll Organisms → cellular organisms → Bacteria503Open in IMG/M
3300000955|JGI1027J12803_103505702All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300000955|JGI1027J12803_103849162All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300002558|JGI25385J37094_10025139All Organisms → cellular organisms → Bacteria2119Open in IMG/M
3300002908|JGI25382J43887_10518498All Organisms → cellular organisms → Bacteria → Proteobacteria504Open in IMG/M
3300005167|Ga0066672_10210875All Organisms → cellular organisms → Bacteria → Proteobacteria1240Open in IMG/M
3300005177|Ga0066690_10276016All Organisms → cellular organisms → Bacteria → Proteobacteria1131Open in IMG/M
3300005178|Ga0066688_10671437All Organisms → cellular organisms → Bacteria → Proteobacteria662Open in IMG/M
3300005178|Ga0066688_10715943All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300005180|Ga0066685_10976741All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005181|Ga0066678_10784847All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300005187|Ga0066675_10580411All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300005332|Ga0066388_107458391All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005440|Ga0070705_100341089All Organisms → cellular organisms → Bacteria → Proteobacteria1089Open in IMG/M
3300005440|Ga0070705_101434989All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300005440|Ga0070705_101682743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium536Open in IMG/M
3300005445|Ga0070708_101498074All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005454|Ga0066687_10469044All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300005467|Ga0070706_100497350All Organisms → cellular organisms → Bacteria → Proteobacteria1134Open in IMG/M
3300005467|Ga0070706_101102444All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005467|Ga0070706_101126291All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300005467|Ga0070706_101936334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales534Open in IMG/M
3300005468|Ga0070707_102071046All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005471|Ga0070698_101526601All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005518|Ga0070699_100257303All Organisms → cellular organisms → Bacteria1561Open in IMG/M
3300005518|Ga0070699_100271656All Organisms → cellular organisms → Bacteria1517Open in IMG/M
3300005538|Ga0070731_10577770All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300005540|Ga0066697_10027465All Organisms → cellular organisms → Bacteria3134Open in IMG/M
3300005540|Ga0066697_10341634All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300005555|Ga0066692_10547747All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300005556|Ga0066707_10761831All Organisms → cellular organisms → Bacteria → Proteobacteria601Open in IMG/M
3300005556|Ga0066707_10857126All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300005557|Ga0066704_10634800All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300005559|Ga0066700_10751435All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005561|Ga0066699_10396507All Organisms → cellular organisms → Bacteria → Proteobacteria987Open in IMG/M
3300005617|Ga0068859_102955954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales520Open in IMG/M
3300006034|Ga0066656_10036661All Organisms → cellular organisms → Bacteria → Proteobacteria2762Open in IMG/M
3300006049|Ga0075417_10163559All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300006794|Ga0066658_10233184All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300006796|Ga0066665_10611434All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300006797|Ga0066659_10833121All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium766Open in IMG/M
3300006806|Ga0079220_10895295All Organisms → cellular organisms → Bacteria → Proteobacteria688Open in IMG/M
3300006845|Ga0075421_101480051All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300006852|Ga0075433_10400983All Organisms → cellular organisms → Bacteria → Proteobacteria1210Open in IMG/M
3300006854|Ga0075425_100181355All Organisms → cellular organisms → Bacteria → Proteobacteria2418Open in IMG/M
3300006854|Ga0075425_101250064All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium843Open in IMG/M
3300006854|Ga0075425_101603549All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300006871|Ga0075434_101116154All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300006880|Ga0075429_100048110All Organisms → cellular organisms → Bacteria → Proteobacteria3709Open in IMG/M
3300006880|Ga0075429_100917831All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300006903|Ga0075426_10373746All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300006903|Ga0075426_11008012All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium629Open in IMG/M
3300006904|Ga0075424_100194359All Organisms → cellular organisms → Bacteria → Proteobacteria2154Open in IMG/M
3300006914|Ga0075436_100963407All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium639Open in IMG/M
3300006969|Ga0075419_11030307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium600Open in IMG/M
3300007076|Ga0075435_100847259All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300007076|Ga0075435_100849250All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300007076|Ga0075435_101693387All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300007255|Ga0099791_10542765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300007265|Ga0099794_10374107All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300009012|Ga0066710_102325970All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium779Open in IMG/M
3300009012|Ga0066710_102478208All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300009012|Ga0066710_104885594All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300009090|Ga0099827_10526862All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1016Open in IMG/M
3300009090|Ga0099827_11146631All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium675Open in IMG/M
3300009094|Ga0111539_10808032All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300009100|Ga0075418_11632715All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300009100|Ga0075418_12023759All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300009137|Ga0066709_102435423All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300009137|Ga0066709_103058249All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium613Open in IMG/M
3300009143|Ga0099792_10437448All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300009143|Ga0099792_10491050All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300009147|Ga0114129_11895627All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium723Open in IMG/M
3300009147|Ga0114129_12990627All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300009162|Ga0075423_11421625All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300010047|Ga0126382_12304141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300010336|Ga0134071_10091083All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1439Open in IMG/M
3300012096|Ga0137389_10182409All Organisms → cellular organisms → Bacteria1739Open in IMG/M
3300012096|Ga0137389_11702435All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300012203|Ga0137399_10735432All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300012205|Ga0137362_10275067All Organisms → cellular organisms → Bacteria1456Open in IMG/M
3300012205|Ga0137362_10867483All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300012349|Ga0137387_11309750All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium506Open in IMG/M
3300012685|Ga0137397_10009078All Organisms → cellular organisms → Bacteria6921Open in IMG/M
3300012918|Ga0137396_10712892All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300012918|Ga0137396_11186776All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300012923|Ga0137359_10224604All Organisms → cellular organisms → Bacteria1676Open in IMG/M
3300012924|Ga0137413_11094055All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300012924|Ga0137413_11304107All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300012930|Ga0137407_10490796All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300012976|Ga0134076_10038734All Organisms → cellular organisms → Bacteria1766Open in IMG/M
3300012986|Ga0164304_10677602All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium780Open in IMG/M
3300015053|Ga0137405_1252892All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300015053|Ga0137405_1339639All Organisms → cellular organisms → Bacteria1981Open in IMG/M
3300015245|Ga0137409_10226439All Organisms → cellular organisms → Bacteria1672Open in IMG/M
3300015357|Ga0134072_10271721All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium620Open in IMG/M
3300017654|Ga0134069_1065044All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1159Open in IMG/M
3300017656|Ga0134112_10163169All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300017656|Ga0134112_10165247All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300017656|Ga0134112_10358844All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300018076|Ga0184609_10412060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300018433|Ga0066667_10145342All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300019377|Ga0190264_11680369All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300019789|Ga0137408_1018798All Organisms → cellular organisms → Bacteria1531Open in IMG/M
3300019879|Ga0193723_1026101All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300019885|Ga0193747_1027718All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300019888|Ga0193751_1074770All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300020061|Ga0193716_1043796All Organisms → cellular organisms → Bacteria2119Open in IMG/M
3300021080|Ga0210382_10537457All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300021168|Ga0210406_10965083All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium637Open in IMG/M
3300021170|Ga0210400_11676313All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300021432|Ga0210384_11409745All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300021432|Ga0210384_11885169All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium503Open in IMG/M
3300021559|Ga0210409_10291171All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300025910|Ga0207684_11591369All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300026277|Ga0209350_1085963All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300026285|Ga0209438_1150926All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300026296|Ga0209235_1043221All Organisms → cellular organisms → Bacteria2225Open in IMG/M
3300026297|Ga0209237_1023366All Organisms → cellular organisms → Bacteria → Proteobacteria3486Open in IMG/M
3300026297|Ga0209237_1056094All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1945Open in IMG/M
3300026298|Ga0209236_1224059All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300026313|Ga0209761_1194872All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300026318|Ga0209471_1071809All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1545Open in IMG/M
3300026323|Ga0209472_1038544All Organisms → cellular organisms → Bacteria2127Open in IMG/M
3300026326|Ga0209801_1090566All Organisms → cellular organisms → Bacteria1332Open in IMG/M
3300026331|Ga0209267_1012689All Organisms → cellular organisms → Bacteria → Proteobacteria4489Open in IMG/M
3300026331|Ga0209267_1094405All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300026335|Ga0209804_1234434All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300026342|Ga0209057_1083119All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1349Open in IMG/M
3300026374|Ga0257146_1073822All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300026532|Ga0209160_1028908All Organisms → cellular organisms → Bacteria3529Open in IMG/M
3300026537|Ga0209157_1034052All Organisms → cellular organisms → Bacteria2905Open in IMG/M
3300026537|Ga0209157_1253738All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium688Open in IMG/M
3300026542|Ga0209805_1172515All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300026548|Ga0209161_10299664All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium781Open in IMG/M
3300027535|Ga0209734_1028861All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300027616|Ga0209106_1100210All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300027882|Ga0209590_10387247All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium902Open in IMG/M
3300027903|Ga0209488_11090449All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300027909|Ga0209382_10009814All Organisms → cellular organisms → Bacteria11964Open in IMG/M
3300028536|Ga0137415_10433997All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300029636|Ga0222749_10577011All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300029911|Ga0311361_10614028All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300031720|Ga0307469_11563549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium633Open in IMG/M
3300031720|Ga0307469_12544398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300032205|Ga0307472_101787953All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil24.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.57%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere16.22%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil10.14%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.41%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.05%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.03%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.35%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.68%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2065487018Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPINP_001258402065487018SoilQAGLNGTEMIVKQPSVSLQEGQVVEPMETKDSSRR
JGI1027J12803_10350570223300000955SoilQAGLHGNETIVSQPTVSLQEGQVVKPIQSKKTPQG*
JGI1027J12803_10384916223300000955SoilIQSGLQGNETIVKQPTVSLQEGQVVTPLESPHPSGG*
JGI25385J37094_1002513913300002558Grasslands SoilRFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIESKSSSGG*
JGI25382J43887_1051849823300002908Grasslands SoilGNTLRFQEVVLGRDFGTSIDIQAGLQGDETIVKQPTVSFQEGQRVTPIESKNSSGG*
Ga0066672_1021087513300005167SoilFGTSIDVQAGLQGHETIVKQPTVSFQEGQRVTPIESKTSSGG*
Ga0066690_1027601613300005177SoilFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG*
Ga0066688_1067143713300005178SoilLHFQQVVVGRDLGTAIDVQSGLEGHETVVKQPTVSLQEGQAVNPIAAPAAAGG*
Ga0066688_1071594323300005178SoilLRFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG*
Ga0066685_1097674113300005180SoilTSIDVQAGLQGHETIVTQPTVSLQEGQRVTPIESKSSSGG*
Ga0066678_1078484713300005181SoilSIDVQAGLDGNETIVKQPTVSLQEGRVVTPIASPHASGS*
Ga0066675_1058041113300005187SoilLGTAIDVQSGLEGHETVVKQPTVSLQEGQTVNPVASPATAGG*
Ga0066388_10745839123300005332Tropical Forest SoilPVVPGRDFGMSIDIQAGLNGTEQVVKQPTVSLQEGQVVEPMESQDSSWR*
Ga0070705_10034108913300005440Corn, Switchgrass And Miscanthus RhizosphereLHFQDVVVGRDLGTSIDIQAGLRGDEAVVQQPRVSLQEGQAVTPIESRIGSGG*
Ga0070705_10143498923300005440Corn, Switchgrass And Miscanthus RhizosphereSIDVQSELQGHEAVMKQPTVALQEDQIVTPIESPNPSGGD*
Ga0070705_10168274323300005440Corn, Switchgrass And Miscanthus RhizosphereSIDIQAGLHGDEMVVSQPTVSLQEGQVVKPIEPPSPAGG*
Ga0070708_10149807423300005445Corn, Switchgrass And Miscanthus RhizosphereDLGTAIDVQAGLQGNETIVKLPTVALQEGQIVNPVAAPATNGG*
Ga0066687_1046904413300005454SoilLGTAIDVQSGLEGHETVVKQPTVSLQEGQTVNPVASPAAAGG*
Ga0070706_10049735023300005467Corn, Switchgrass And Miscanthus RhizosphereRDLGASIDIQSGLRGDETIVKQPTVSLQEGQVVKPIEAQKPSGG*
Ga0070706_10110244423300005467Corn, Switchgrass And Miscanthus RhizosphereLGRDFGTSIDIQAGLQGNETIVKQPTVSLQEGQIVTPIESPNPSGG*
Ga0070706_10112629123300005467Corn, Switchgrass And Miscanthus RhizosphereHFQDVAVGRDLGTTIDIQAGLNGNETIVSQPTVSLQEGQVVKPIQSQKTPQG*
Ga0070706_10193633423300005467Corn, Switchgrass And Miscanthus RhizosphereVLGRDFGTSIDVQAGLQGHETIVTQPTVSLQEGQRVTPIESKSSSGG*
Ga0070707_10207104623300005468Corn, Switchgrass And Miscanthus RhizosphereHFQPVVFGRDLGASIDIQSGLRGDETIVKQPTVSLQEGQVVKPIEAQKPSGG*
Ga0070698_10152660123300005471Corn, Switchgrass And Miscanthus RhizosphereLGRDFGTSIDIQGGLQGNEAVVKQPTVSLQEDQVVTPIESPNPSGG*
Ga0070699_10025730313300005518Corn, Switchgrass And Miscanthus RhizosphereVGRDLGTAIDVQAGLQGNETIVKLPTVALQEGQIVNPVAAPATNGS*
Ga0070699_10027165613300005518Corn, Switchgrass And Miscanthus RhizosphereASIDIQSGLRGDETIVKQPTVALQEGQVVKPIEAQKPSGG*
Ga0070731_1057777023300005538Surface SoilELGRDFGMSIDIQEGLYGTETIVKQPTVSLEEGQVVRPIESQGSSWH*
Ga0066697_1002746513300005540SoilLRFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIESKSSSGG*
Ga0066697_1034163423300005540SoilIGENNTLHFQDVELGRDFGMSIDVQAGLHGTETIVKQPTVSLQEGQVVKPIESQDVSWR*
Ga0066692_1054774723300005555SoilVVLGRDFGTSIDVQSGLRGDETIVRQPTVSLQEGQVVTPVEPPKPSGG*
Ga0066707_1076183123300005556SoilFGMSIDIQEGLNGTEIIVKQPSVSLQEGQVVEPMESQDSSWR*
Ga0066707_1085712613300005556SoilGTSIDIQTGLQGNETIVKQPTVSLQEGELVTPLASQDPSGS*
Ga0066704_1063480023300005557SoilRFQEVVLGRDFGTSIDIQAGLQGDETIVKQPTVSFQEGQRVTPIESKNSSGG*
Ga0066700_1075143523300005559SoilRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG*
Ga0066699_1039650723300005561SoilDFGTSIDVQAGLQGDETIVKQPTVSLQEGQVVAPIESPDPSGG*
Ga0068859_10295595413300005617Switchgrass RhizosphereFGTSIDIQAGLLGNETIVKQPTVSLQEGQVVTPLESPTPSGG*
Ga0066656_1003666143300006034SoilFQQVVVGRDLGAAVDVQSGLEGNETIVAQPTVSLQEGQTVNPVAAPATNGG*
Ga0075417_1016355923300006049Populus RhizosphereIQSGLRGDESVVQQPRVSLEEGQTVTPIQARPGSGG*
Ga0066658_1023318423300006794SoilGRDLGTSIDIQAGLRGNELIVSQPTVSLQEGQLVNPIESKNPSGG*
Ga0066665_1061143423300006796SoilGRDFGMSIDVQAGLHGTETIVKQPTVSLQEGQVVKPIESQDVSWR*
Ga0066659_1083312123300006797SoilDVQSGLEGHETVVKQPTVSLQEGQTVNPVASPAAAGG*
Ga0066659_1116240923300006797SoilRDFGDTIDVQAGLSGGETVVKQPDVSMQDAQVVTPVESQNAP*
Ga0079220_1089529513300006806Agricultural SoilEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSD*
Ga0075421_10148005123300006845Populus RhizosphereDFGMSIDIQAGLNGTELVLKQPTVSLQEGQVVEPMESQDSSWR*
Ga0075433_1040098323300006852Populus RhizosphereGVSIDIQAGLNGNETIVKQPTVSLQEGQVVQPVESR*
Ga0075425_10018135543300006854Populus RhizosphereFQKVTVGRDLGTSMDIQAGLQGNETIVSQPTVSLQEGQVVKPIQSQKTPQG*
Ga0075425_10125006413300006854Populus RhizosphereQSGLEGTETIVKQPTVSLQEGQIVNPVASSAAAGG*
Ga0075425_10160354913300006854Populus RhizospherePGNTLRFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIESKNSAGD*
Ga0075434_10111615423300006871Populus RhizosphereFQPVVLGRDFGMSIDVQAGLNGAEMIVKQPSVSLQEGQVVEPMESQDSSWR*
Ga0075429_10004811073300006880Populus RhizosphereSMDIQAGLQGNETIVSQPTVSLQEGQVVKPIQSQKTPQG*
Ga0075429_10091783123300006880Populus RhizosphereIDIQAGLQGHEMIVKQPTVSFQEGQRVTPIESKNSSGS*
Ga0075426_1037374623300006903Populus RhizosphereSMDIQAGLQGNETIVSQPTVSLQEGQVVNPIQSQKTPQG*
Ga0075426_1100801213300006903Populus RhizosphereIDVQAGLEGHETIVKQPTVSLQEGQTVNPVAAPVATGG*
Ga0075424_10019435933300006904Populus RhizosphereEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIESKNSAGD*
Ga0075436_10096340723300006914Populus RhizosphereGTVIDVQAGLEGHETIVKQPTVSLQEGQTVNPVAAPVATGG*
Ga0075419_1103030723300006969Populus RhizosphereVGRDLGTSMDIQAGLQGNETIVSQPTVSLQEGQVVNPIQSQKTPQG*
Ga0075435_10084725913300007076Populus RhizosphereDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSAGD*
Ga0075435_10084925013300007076Populus RhizosphereDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSD*
Ga0075435_10169338723300007076Populus RhizosphereVVLGRDFGTSIDIQAGLQGNEILVKQPTVSLQEGQVVAPIESPNPSGG*
Ga0099791_1054276513300007255Vadose Zone SoilAGLQGNELVVSQPTVSLQEGQVVKPIESHSPSGG*
Ga0099794_1037410713300007265Vadose Zone SoilAGNTLRFQEVVLGRDFGTSIDIQAGLQGDETIVKQPTVSLQEGQRVTPIESKNSSGG*
Ga0066710_10232597013300009012Grasslands SoilLHFQQVVVGRDLGTAIDVQSGLEGHETIVKQPTVSLQEGQIVNPVASPVAAGG
Ga0066710_10247820823300009012Grasslands SoilENNTLHFQDVELGRDFGMSIDVQAGLHGTETIVKQPTVSLQEGQVVKPIESQDVSWR
Ga0066710_10488559423300009012Grasslands SoilGRDFGTSIDIQTGLQGNETIVKQPTVSLQEGQLVTPLASQDTSGG
Ga0099827_1052686213300009090Vadose Zone SoilTIDVQSGLEGNETIVKQPTVSLQEGQTVNPIASQAAAGG*
Ga0099827_1114663123300009090Vadose Zone SoilRDFGTSIDIQGGLQGNEAVVKQPTVSLQEGQVVTPIESPNPSGG*
Ga0111539_1080803213300009094Populus RhizosphereTSIDVQAGLQGHELIVKQPTVSLQEGQRVTPVEPPSSSGR*
Ga0075418_1163271513300009100Populus RhizosphereRDLGTSMDIQAGLQGNETIVSQPTVSLQEGQVVKPLQSQKTPQG*
Ga0075418_1202375923300009100Populus RhizosphereGRDLGTSMDIQAGLQGNETIVSQPTVSLQEGQVVNPIQSQKTPQG*
Ga0066709_10243542323300009137Grasslands SoilFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIEPKSSSGG*
Ga0066709_10305824913300009137Grasslands SoilQAGLEGNERIVKQPTVSLQEGQTVNPIDSRAAAGG*
Ga0099792_1043744823300009143Vadose Zone SoilFQPVVLGRDFGTSIDIQGGLQGNETIVEQPTVSLLEGQLVKPITSRTRSGG*
Ga0099792_1049105023300009143Vadose Zone SoilFQPVVLGRDLGGSIDIQNGLRGDEAIVKQPTVSLKEGQVVTPIAAQKPSGG*
Ga0114129_1189562723300009147Populus RhizosphereYQPVVVGRDLGTVIDVQAGLEGHETIVKQPTVSLQEGQTVNPVTAPVATGG*
Ga0114129_1299062723300009147Populus RhizosphereLPVVLGRDFGNSIDIQAGLTGGEAIVQQPRVSLKEGQAVKAIEAQHSP*
Ga0075423_1142162523300009162Populus RhizosphereIDIQSGLQGNETIVKQPTVSLQEGQVVTPLESPTPSGG*
Ga0126382_1230414113300010047Tropical Forest SoilKVTIGRDLGTSIDIQAGLHGNETIVKQPTVSLQEEQVVNPIESKTQ*
Ga0134071_1009108323300010336Grasslands SoilVVGRDLGAAIDVQSGLEGNETIVKQPTVSLQEGQIVNPIASPAAAGG*
Ga0137389_1018240913300012096Vadose Zone SoilIDIQAGLHGGETIVKQPTVSYQEGQVVRPIPPSPAGG*
Ga0137389_1170243523300012096Vadose Zone SoilQNGLRGDETIVKQPTVSLQEGQVVRPIEPQKPSGG*
Ga0137399_1073543213300012203Vadose Zone SoilIQNGLRGDEAIVKQPTVSMHEGQVVRPIASAPSGR*
Ga0137362_1027506723300012205Vadose Zone SoilVGRDLGTAIDVQSGLEGHETVVKQPTVSLQEGQVVTPVAAPATNGG*
Ga0137362_1086748323300012205Vadose Zone SoilQGGLQGNETIVEQPTVSLVEGQLVKPIKSRTPSGG*
Ga0137387_1130975013300012349Vadose Zone SoilQAGLQGNETIVKQPTVSLQEGQIVTPISSADPPGD*
Ga0137397_10009078113300012685Vadose Zone SoilRFQQVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIEPKSSSGR*
Ga0137396_1071289223300012918Vadose Zone SoilEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG*
Ga0137396_1118677613300012918Vadose Zone SoilREVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG*
Ga0137359_1022460413300012923Vadose Zone SoilFQQVVVGRDLGTTIDVQSGLEGNETIVKLPTVSLQEGQVVTPVAAPATNGG*
Ga0137413_1109405513300012924Vadose Zone SoilTIDIQNGLRGDETIVKQPTESLREGQGVRPLTSAPSGT*
Ga0137413_1130410713300012924Vadose Zone SoilRDFGDTIDVQTGLSGNELIVKQPTVSLQQGQVVSPVESQNAPQH*
Ga0137407_1049079613300012930Vadose Zone SoilRFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG*
Ga0134076_1003873413300012976Grasslands SoilDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSPGS*
Ga0164304_1067760223300012986SoilLGTSIDIQAGLHGNEMVVSQPTVSLQEGQVVKPIEPPGPAGG*
Ga0137405_125289223300015053Vadose Zone SoilAGLRGDETIVKQPTVSLQEGQRVTPIEPKNSSGR*
Ga0137405_133963933300015053Vadose Zone SoilSDGKLRLQNVTVGRDFGDTIDVQAGLSGNELIVKQPTVSLQQGQVVSPVESQNAPQH*
Ga0137409_1022643913300015245Vadose Zone SoilDIQAGLTGDESIVKQPTVSLQEGQVVRPIAPQKPSGG*
Ga0134072_1027172113300015357Grasslands SoilAIDVQSGLEGTETIVKQPKVSLQEGQTVNPIASPAAAGG*
Ga0134069_106504423300017654Grasslands SoilLGRDLGSAIDVQSGLEGDETIVKQPTVSLQEGQIVNPIASPAAAGG
Ga0134112_1016316913300017656Grasslands SoilNKLHFQHVVLGRDLGSAIDVQSGLEGTETIVKQPTVSLQEGQTVNPIASPAAAGG
Ga0134112_1016524713300017656Grasslands SoilTSIDIQAGLNGNEMIVKQPTVSLQEGQLVNPIESKNPSGA
Ga0134112_1035884413300017656Grasslands SoilTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIEPKNSSGR
Ga0184609_1041206013300018076Groundwater SedimentIDIQAGLNGNEMIVKQPTVSLQEGQLVNPIESKNPSGG
Ga0066667_1014534213300018433Grasslands SoilTLRFQEVVLGRDFGTSIDVQAGLEGHETIMKQPTVSFQEGQRVTPIESKTSSGG
Ga0190264_1168036923300019377SoilLHSQKVTVGRDLGTSIDIQAGLQGNETIVSQPTVSLQEGQVVKPIESKDPPTG
Ga0137408_101879813300019789Vadose Zone SoilRFQQVVLGRDFGTSIDIQAGLQGHETIVKQPTVSFQEGQRVTPIESKNSSGG
Ga0193723_102610133300019879SoilHFQDVVIGRDLGTSIDIQAGLHGDEMVVSQPTVSLQEGQVVKPIEPPSPAGG
Ga0193747_102771813300019885SoilQLHFQDVVIGRDLGTSIDIQAGLHGDEMVVSQPTVSLQEGQVVKPIEPPSPAGG
Ga0193751_107477033300019888SoilVVIGRDLGTSIDIQAGLHGDEVVVSQPTVSLQEGQVVKPIEPPS
Ga0193716_104379633300020061SoilLGTLIDIQAGLHGSETIVSQPTVSLQEGQVVKPIQSQKTPQG
Ga0210401_1039099813300020583SoilQAGLSGNETVVKQPDVSLQDGQVVTPIESQNALQG
Ga0210382_1053745713300021080Groundwater SedimentRDLGTAIDTQAGLHGSEMVVSQPTVSLQEGQVVKPIESRGPSGG
Ga0210406_1096508313300021168SoilDVQAGLEGHETIVRQPTVSLQEGQTVNPVAAPLATGG
Ga0210400_1167631323300021170SoilGLRRDFGVSIDIQSGLNGNEIIVKQPTVSLQEGQLVKPVESQTTASR
Ga0210384_1140974513300021432SoilDIQAGLRGDESIVKQPTVSLQEGQVVTPIEPQKPSGD
Ga0210384_1188516913300021432SoilQAGLEGHETIVRQPTVSLQEGQTVNPVAAPLATGG
Ga0210409_1029117123300021559SoilGESIDIQNGLRGDETIVKQPTVSLQEGQVVRPIEPQKPSGQ
Ga0207684_1159136923300025910Corn, Switchgrass And Miscanthus RhizosphereLGTAIDIQAGLHGNETIVKQPTVSLQEGQLVNPIESKNPLNS
Ga0209350_108596313300026277Grasslands SoilGNTLRFQEVVLGRDFGTSIDVQAGLEGHETIMKQPTVSFQEGQRVTPIESKTSSGG
Ga0209438_115092623300026285Grasslands SoilGAGNTIRFRDVTPGRDLGTSVDIQAGLKGNESIVTQPTVSLQEGQIVEPLESPSTH
Ga0209235_104322133300026296Grasslands SoilQSGLEGDETIVKQPTVSLQEGQIVNPIASPAAAGG
Ga0209237_102336663300026297Grasslands SoilTLRFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSPGG
Ga0209237_105609413300026297Grasslands SoilDLGTVIDVQSGLEGDETIVKQPTVSLQEGQTVNPIASPAAAGG
Ga0209236_122405913300026298Grasslands SoilFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIESKSSSGG
Ga0209761_119487213300026313Grasslands SoilFQEVVVGRDFGTAIDIQAGLQGNETIVKQPTVSLQEGQVVTPVEPKNSSGG
Ga0209471_107180913300026318SoilQVVVGRDLGTAIDVQSGLEGHETVVKQPTVSLQEGQTVNPVASPAAAGG
Ga0209472_103854433300026323SoilGTAIDVQSGLEGHETVVKQPTVSLQEGQTVNPVASPATAGG
Ga0209801_109056623300026326SoilLRFQEVVLGRDFGTSIDIQAGLQGDETIVKQPTVSFQEGQRVTPIESKNSSGG
Ga0209267_101268913300026331SoilGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIEPKSSSGG
Ga0209267_109440523300026331SoilIQAGLNGNELIVKQPTVSLQEGQLVNPIQSKNPSGA
Ga0209804_123443413300026335SoilGASIDIQAGLNGGEAIIAQPTVSLQEGQVVKAINAPRQAGS
Ga0209057_108311923300026342SoilIDVQSGLEGDETIVKQPTVSLQEGQTVNPIASPAAAGG
Ga0257146_107382213300026374SoilHFQDVVIGRDLGTSIDIQAGLHGDEVVVSQPTVSLQEGQVVKPIEPPSPAGG
Ga0209160_102890813300026532SoilLHFQQVVVGRDLGAAIDVQSGLEGDETIVKQPTVSLQEGQIVNPIASPAAAGG
Ga0209157_103405213300026537SoilFQQVVVGRDLGTAIDVQSGLEGNDTIVKQPTVSLQEGQIVNPIASPAAAGG
Ga0209157_125373823300026537SoilRDFGTAIDVQAGLQGDELVVKQPTVSLQEGQAVTPVTPPNPAGG
Ga0209805_117251523300026542SoilDFGTSIDVQAGLQGDETIVKQPTVSLQEGQVVAPIESPDPSGG
Ga0209161_1029966423300026548SoilRDFGNSIDIQVGLQGNEAVVKQPTVSLREGQVVTPIESPNPSSGQPRSGG
Ga0209734_102886133300027535Forest SoilDFGDSIDVQAGLHGHESIVKQPTVSLQEGQVVRPIASAQSGG
Ga0209106_110021023300027616Forest SoilQEVVLGRDFGTSIDIQAGLQGHEMIVKQPTVSLQEGQRVTPIEPKNSSGG
Ga0209590_1038724713300027882Vadose Zone SoilQVVLGRDLGTTIDVQSGLEGNETIVKQPTVSLQEGQTVNPIASQAAAGG
Ga0209488_1109044913300027903Vadose Zone SoilPVVLGRDFGDSIDVQAGLHGRETIVRQPTVSLQEGQAVRPMSSAPSGT
Ga0209382_10009814133300027909Populus RhizosphereVTVGRDLGTSMDIQAGLQGNETIVSQPTVSLQEGQVVKPIQSQKTPQG
Ga0137415_1043399713300028536Vadose Zone SoilKLHFQDVVIGRDLGTSIDIQAGLHGNEMVVSQPTVSLQEGQVVKPIESHGPSGG
Ga0222749_1057701113300029636SoilDFGTSIDVQGGLEGHEAVVKQPTVALQEGQIVTPIESPSPSGGD
Ga0311361_1061402813300029911BogRDFGDTIDVQAGLNGTETIVKQPDVSLQEGQVVTPVQPENAPQG
Ga0307469_1156354923300031720Hardwood Forest SoilTSIDIQAGLNGNDMIVKQPTVSLQEGQLVNPIESKNPSGS
Ga0307469_1254439813300031720Hardwood Forest SoilLGRDLGTSIDIQAGLNGNELIVSQPTVSLQEGQLVNPIESKNPSGS
Ga0307472_10178795323300032205Hardwood Forest SoilRDFGTSIEIQAGLNGNELIVSQPTVSLQEGQLVQPIESKNS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.