Basic Information | |
---|---|
Family ID | F048202 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 148 |
Average Sequence Length | 48 residues |
Representative Sequence | MPFKSPPPKKGQLRRITLKFKSDMTRKQMATFRKSVRALAKRFKATISK |
Number of Associated Samples | 117 |
Number of Associated Scaffolds | 148 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 79.73 % |
% of genes near scaffold ends (potentially truncated) | 33.11 % |
% of genes from short scaffolds (< 2000 bps) | 75.00 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.622 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand (11.486 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.054 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.946 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.77% β-sheet: 0.00% Coil/Unstructured: 66.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 148 Family Scaffolds |
---|---|---|
PF13374 | TPR_10 | 10.14 |
PF02655 | ATP-grasp_3 | 7.43 |
PF13424 | TPR_12 | 4.73 |
PF13535 | ATP-grasp_4 | 4.05 |
PF13191 | AAA_16 | 3.38 |
PF13432 | TPR_16 | 2.03 |
PF07719 | TPR_2 | 2.03 |
PF13176 | TPR_7 | 1.35 |
PF07721 | TPR_4 | 1.35 |
PF00515 | TPR_1 | 1.35 |
PF06026 | Rib_5-P_isom_A | 1.35 |
PF00496 | SBP_bac_5 | 0.68 |
PF14492 | EFG_III | 0.68 |
PF00903 | Glyoxalase | 0.68 |
PF02771 | Acyl-CoA_dh_N | 0.68 |
PF02954 | HTH_8 | 0.68 |
PF00342 | PGI | 0.68 |
PF13529 | Peptidase_C39_2 | 0.68 |
PF13181 | TPR_8 | 0.68 |
COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
---|---|---|---|
COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 1.35 |
COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.68 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.62 % |
Unclassified | root | N/A | 3.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918013|NODE_6983_length_1432_cov_8.205307 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1464 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2362084 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2049 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101870690 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2559 | Open in IMG/M |
3300002560|JGI25383J37093_10127866 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300002561|JGI25384J37096_10030413 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
3300002908|JGI25382J43887_10004229 | All Organisms → cellular organisms → Bacteria | 6677 | Open in IMG/M |
3300002908|JGI25382J43887_10167161 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1097 | Open in IMG/M |
3300003659|JGI25404J52841_10105250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
3300004267|Ga0066396_10001039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2346 | Open in IMG/M |
3300004267|Ga0066396_10026947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 814 | Open in IMG/M |
3300004281|Ga0066397_10030628 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 870 | Open in IMG/M |
3300004633|Ga0066395_10001398 | All Organisms → cellular organisms → Bacteria | 8578 | Open in IMG/M |
3300005167|Ga0066672_10007972 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 4892 | Open in IMG/M |
3300005180|Ga0066685_10027256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3503 | Open in IMG/M |
3300005180|Ga0066685_10099909 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
3300005180|Ga0066685_10916344 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300005186|Ga0066676_10070349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2050 | Open in IMG/M |
3300005289|Ga0065704_10508233 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300005332|Ga0066388_100023225 | All Organisms → cellular organisms → Bacteria | 5535 | Open in IMG/M |
3300005332|Ga0066388_100299163 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2254 | Open in IMG/M |
3300005353|Ga0070669_100748138 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 828 | Open in IMG/M |
3300005363|Ga0008090_15081227 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
3300005444|Ga0070694_101075493 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300005447|Ga0066689_10290777 | Not Available | 1012 | Open in IMG/M |
3300005450|Ga0066682_10844603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 550 | Open in IMG/M |
3300005467|Ga0070706_100341414 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1396 | Open in IMG/M |
3300005560|Ga0066670_10611725 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300005564|Ga0070664_100406657 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
3300005713|Ga0066905_100183429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1546 | Open in IMG/M |
3300005764|Ga0066903_100585631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1927 | Open in IMG/M |
3300005764|Ga0066903_105357257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 677 | Open in IMG/M |
3300006049|Ga0075417_10004715 | All Organisms → cellular organisms → Bacteria | 4546 | Open in IMG/M |
3300006049|Ga0075417_10008234 | All Organisms → cellular organisms → Bacteria | 3738 | Open in IMG/M |
3300006794|Ga0066658_10248489 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 950 | Open in IMG/M |
3300006844|Ga0075428_101417000 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 729 | Open in IMG/M |
3300006854|Ga0075425_100110818 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3129 | Open in IMG/M |
3300006854|Ga0075425_100291206 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
3300006871|Ga0075434_100170985 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
3300006903|Ga0075426_11129250 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300006904|Ga0075424_100276986 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
3300007255|Ga0099791_10112011 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1261 | Open in IMG/M |
3300009137|Ga0066709_100000709 | All Organisms → cellular organisms → Bacteria | 19282 | Open in IMG/M |
3300009137|Ga0066709_100034291 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 5455 | Open in IMG/M |
3300009147|Ga0114129_10131260 | All Organisms → cellular organisms → Bacteria | 3440 | Open in IMG/M |
3300009147|Ga0114129_13062256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
3300009162|Ga0075423_10213862 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2021 | Open in IMG/M |
3300009168|Ga0105104_10485699 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300009792|Ga0126374_11749881 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
3300009795|Ga0105059_1041472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 585 | Open in IMG/M |
3300009808|Ga0105071_1051478 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300009812|Ga0105067_1022028 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300009813|Ga0105057_1012311 | Not Available | 1180 | Open in IMG/M |
3300009813|Ga0105057_1071088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 604 | Open in IMG/M |
3300009818|Ga0105072_1041718 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 864 | Open in IMG/M |
3300009820|Ga0105085_1115855 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
3300009821|Ga0105064_1075511 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300009836|Ga0105068_1098732 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300010043|Ga0126380_10741376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 795 | Open in IMG/M |
3300010043|Ga0126380_11503627 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
3300010046|Ga0126384_10468332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1080 | Open in IMG/M |
3300010046|Ga0126384_11745969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 589 | Open in IMG/M |
3300010047|Ga0126382_11218827 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 675 | Open in IMG/M |
3300010336|Ga0134071_10088784 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1456 | Open in IMG/M |
3300010358|Ga0126370_12109896 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
3300010359|Ga0126376_10144462 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1896 | Open in IMG/M |
3300010359|Ga0126376_12259050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
3300010360|Ga0126372_10025223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3609 | Open in IMG/M |
3300010362|Ga0126377_10467495 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1287 | Open in IMG/M |
3300010376|Ga0126381_104502921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
3300010400|Ga0134122_13043635 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
3300010401|Ga0134121_10108533 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2334 | Open in IMG/M |
3300010863|Ga0124850_1013284 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2620 | Open in IMG/M |
3300010863|Ga0124850_1069648 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1072 | Open in IMG/M |
3300010868|Ga0124844_1006941 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2444 | Open in IMG/M |
3300012202|Ga0137363_11505421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 564 | Open in IMG/M |
3300012203|Ga0137399_10849735 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300012205|Ga0137362_10124351 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2189 | Open in IMG/M |
3300012207|Ga0137381_10351239 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300012361|Ga0137360_10398070 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1160 | Open in IMG/M |
3300012685|Ga0137397_10011942 | All Organisms → cellular organisms → Bacteria | 6071 | Open in IMG/M |
3300012685|Ga0137397_11042447 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 599 | Open in IMG/M |
3300012922|Ga0137394_10000627 | All Organisms → cellular organisms → Bacteria | 24557 | Open in IMG/M |
3300012923|Ga0137359_11577748 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 544 | Open in IMG/M |
3300012975|Ga0134110_10417191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 598 | Open in IMG/M |
3300012976|Ga0134076_10602223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
3300014150|Ga0134081_10097017 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 925 | Open in IMG/M |
3300015374|Ga0132255_100012138 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 10168 | Open in IMG/M |
3300016270|Ga0182036_11809311 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300016422|Ga0182039_11053374 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 731 | Open in IMG/M |
3300018431|Ga0066655_10099308 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1628 | Open in IMG/M |
3300018431|Ga0066655_10574470 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 756 | Open in IMG/M |
3300018468|Ga0066662_10056178 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2543 | Open in IMG/M |
3300018468|Ga0066662_11409397 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 721 | Open in IMG/M |
3300025917|Ga0207660_11548991 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300025923|Ga0207681_10723725 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 828 | Open in IMG/M |
3300025937|Ga0207669_10807475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 778 | Open in IMG/M |
3300025945|Ga0207679_10296305 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
3300026089|Ga0207648_10458000 | Not Available | 1162 | Open in IMG/M |
3300026277|Ga0209350_1059837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1091 | Open in IMG/M |
3300026296|Ga0209235_1018539 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3753 | Open in IMG/M |
3300026297|Ga0209237_1001687 | All Organisms → cellular organisms → Bacteria | 13093 | Open in IMG/M |
3300026297|Ga0209237_1125528 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1067 | Open in IMG/M |
3300026313|Ga0209761_1080869 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1685 | Open in IMG/M |
3300026331|Ga0209267_1103424 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1210 | Open in IMG/M |
3300026524|Ga0209690_1204825 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 627 | Open in IMG/M |
3300026536|Ga0209058_1071263 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1862 | Open in IMG/M |
3300026540|Ga0209376_1266797 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300027032|Ga0209877_1028686 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
3300027068|Ga0209898_1007561 | Not Available | 1292 | Open in IMG/M |
3300027324|Ga0209845_1075207 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
3300027384|Ga0209854_1010293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1444 | Open in IMG/M |
3300027511|Ga0209843_1037235 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300027527|Ga0209684_1005281 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2143 | Open in IMG/M |
3300027561|Ga0209887_1021340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1553 | Open in IMG/M |
3300027646|Ga0209466_1000357 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 9994 | Open in IMG/M |
3300027655|Ga0209388_1115519 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 767 | Open in IMG/M |
3300027743|Ga0209593_10303552 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300027821|Ga0209811_10094288 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1070 | Open in IMG/M |
3300027873|Ga0209814_10000112 | All Organisms → cellular organisms → Bacteria | 21617 | Open in IMG/M |
3300027873|Ga0209814_10000794 | All Organisms → cellular organisms → Bacteria | 10774 | Open in IMG/M |
3300027874|Ga0209465_10120042 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1296 | Open in IMG/M |
3300027947|Ga0209868_1016890 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300027957|Ga0209857_1073601 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300028536|Ga0137415_10107838 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2634 | Open in IMG/M |
3300031170|Ga0307498_10178520 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 726 | Open in IMG/M |
3300031543|Ga0318516_10088921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1732 | Open in IMG/M |
3300031680|Ga0318574_10529448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 691 | Open in IMG/M |
3300031720|Ga0307469_10090515 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2110 | Open in IMG/M |
3300031720|Ga0307469_11009026 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 777 | Open in IMG/M |
3300031720|Ga0307469_11103912 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300031720|Ga0307469_11205599 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 715 | Open in IMG/M |
3300031720|Ga0307469_11796213 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
3300031740|Ga0307468_100155059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1478 | Open in IMG/M |
3300031740|Ga0307468_100511177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 955 | Open in IMG/M |
3300031740|Ga0307468_101869703 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
3300031751|Ga0318494_10207958 | Not Available | 1116 | Open in IMG/M |
3300031779|Ga0318566_10183003 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1040 | Open in IMG/M |
3300031940|Ga0310901_10439217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
3300031944|Ga0310884_10581985 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 666 | Open in IMG/M |
3300032066|Ga0318514_10736734 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
3300032180|Ga0307471_100024909 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4482 | Open in IMG/M |
3300032180|Ga0307471_100351032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1585 | Open in IMG/M |
3300032180|Ga0307471_100361219 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1566 | Open in IMG/M |
3300032180|Ga0307471_100470463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1400 | Open in IMG/M |
3300032180|Ga0307471_101635446 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 799 | Open in IMG/M |
3300032180|Ga0307471_103886647 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
3300032205|Ga0307472_101236521 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 715 | Open in IMG/M |
3300033433|Ga0326726_11982495 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 11.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.14% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.14% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.78% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.11% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.38% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.70% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.35% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.35% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.35% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.35% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.68% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
3300027068 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027947 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Iowa-Corn-GraphCirc_03738940 | 2140918013 | Soil | MPFKSPPPKKGQVRRIALKFKNDMTRKQMAAFRKSVRALAKRFKATLAR |
ICChiseqgaiiDRAFT_23620843 | 3300000033 | Soil | MPFKSPPPKKGQXXXIXLKFKNDMTRKQMASFRKSVRSLAKRFKATISX* |
INPhiseqgaiiFebDRAFT_1018706902 | 3300000364 | Soil | MPFKSPPKKGQSRKITLKFRTDLTKKQMASFKKSVRALAKRFKATLGR* |
JGI25383J37093_101278662 | 3300002560 | Grasslands Soil | MPFKSPPPKKGHTRRIALKFRSDMTPKQFARFKKGVRVLAKRFKATISK* |
JGI25384J37096_100304131 | 3300002561 | Grasslands Soil | MPFKSPPPKKGHTRRIALKFRSDMTPKQFARFKRGVRVLAKRFKATISK* |
JGI25382J43887_100042293 | 3300002908 | Grasslands Soil | MPFKSPPPKKGHTRRIALKFRSDMTPKQFARFKXGVRVLAKRFKATISK* |
JGI25382J43887_101671614 | 3300002908 | Grasslands Soil | MPFKSPPPKKGQLRRVTLKFKSDMTRKQMASFRKSVRALAKRFKATISK* |
JGI25404J52841_101052501 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MPFKSPPPKKGQLRRITLKFRTDMTRKQMATFRKTVRALAKRFKATISK* |
Ga0066396_100010393 | 3300004267 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRTDLTKKQLASFKKSVRALAKRFKATLGR* |
Ga0066396_100269471 | 3300004267 | Tropical Forest Soil | MPFKSPPKRGQSRKITLKFRTDLTRKQMSSFKKSVRALAKRFKATLGR* |
Ga0066397_100306283 | 3300004281 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRTDLTKKQMSSFKKSVRALAKRFKATIGR* |
Ga0066395_100013983 | 3300004633 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRTDLTRKQMSSFKKSVRALAKRFKATLGR* |
Ga0066672_100079721 | 3300005167 | Soil | MPFKSPPPKKGQLRRITLKFKSDMTRKQMATFRKSVRALAKRFKATISK* |
Ga0066685_100272563 | 3300005180 | Soil | MPFKSPPKKGQSRKITVKFRTDLTRKQLASFKKSVRALAKRFKATIGR* |
Ga0066685_100999091 | 3300005180 | Soil | MPFKSPPPKKGHTRRIALKFRSNMTPKQFARFKKGVRVLAKRFKATISK* |
Ga0066685_109163442 | 3300005180 | Soil | MPFKSPPPKKGQLRRITLKFKSDMTRKQMATFRRSVRALAKRFKATISK* |
Ga0066676_100703491 | 3300005186 | Soil | KKGQLRRVTLKFKSDMTRKQMASFRKSVRALAKRFKATISK* |
Ga0065704_105082332 | 3300005289 | Switchgrass Rhizosphere | MPFKSPPPKKGQVRRIALKFKNDMTRKQMAAFRKSVRALAKRFKATLAR* |
Ga0066388_1000232253 | 3300005332 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRSDLTKKQLASFKKSVRSLAKRFKATVGK* |
Ga0066388_1002991631 | 3300005332 | Tropical Forest Soil | MPFKSPPPKKGQLRRITLKFKNDMTRKQMASFKKSVRSLAKRFKATISK* |
Ga0070669_1007481383 | 3300005353 | Switchgrass Rhizosphere | MPFKSPPPKKGQLRRITLKFKTDLTRKQMANFRKSVRSLAKRFKASISR* |
Ga0008090_150812271 | 3300005363 | Tropical Rainforest Soil | MPFKSPPKKGQSRKITLKFRSDLTKKQLASFKKSVRSLAKRFKATVSK* |
Ga0070694_1010754932 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPFKSPPPKKGQLRRITLKFKNDMTRKQMASFRKSVRSLAKRFKATISK* |
Ga0066689_102907771 | 3300005447 | Soil | MRFPKPDDTNHGGTLMPFKSPPPKKGHTRRIALKFRSDMTPKQFARFKKGVR |
Ga0066682_108446032 | 3300005450 | Soil | MPFKSPPKKGQSRKITLKFRSELTRKQMASFKKSVRALAKRFKATLSK* |
Ga0070706_1003414141 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SPKPDKRKRRTLMPFKSPPPKKGQLRRVTLKFKSDMTRKQMASFRKSVRALAKRFKATISK* |
Ga0066670_106117251 | 3300005560 | Soil | MPFKSPPPKKGQLRRVTLKFKSDMTRKQMASFRKS |
Ga0070664_1004066573 | 3300005564 | Corn Rhizosphere | MPFKSPPPKKGQLRKITLKFKSDMTPKKMAQFRKSVRALAKRFKASISR* |
Ga0066905_1001834293 | 3300005713 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFKSDLTKKQLASFKKSVRSLAKRFKATLSK* |
Ga0066903_1005856313 | 3300005764 | Tropical Forest Soil | MPFKSPPPKKGQLRKITLKFKNDMTPKQMAQFKKSVRALAKRFKASISR* |
Ga0066903_1053572572 | 3300005764 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRSDLTKKQLASFKKSVRSLAKRFKATISK* |
Ga0075417_100047153 | 3300006049 | Populus Rhizosphere | MPFKSPPPKKGQLRRITLKFRTDMTRKQMATFRKSVRALAKRFKATISK* |
Ga0075417_100082343 | 3300006049 | Populus Rhizosphere | MPFKSPPPKKGQLRRITLKFKNDLTRKQMASFRKSVRSLAKRFKATISK* |
Ga0066658_102484892 | 3300006794 | Soil | PKKGQSRKITLKFRSDLTRKQLASFRKSVRSLAKRFKATVGK* |
Ga0075428_1014170001 | 3300006844 | Populus Rhizosphere | PTTPREERSMPFKSPPPKKGQVRRIALKFKNDMTRKQMAAFRKSVRALAKRFKATLAR* |
Ga0075425_1001108183 | 3300006854 | Populus Rhizosphere | MPFKSPPKKGQSRKITLKFRSDLTKKQMASFKKSVRALAKRFKATLGR* |
Ga0075425_1002912063 | 3300006854 | Populus Rhizosphere | MPFKSPPPKKGQSRKITLKFKTDMTPKKMALFRKSVRALAKRFKASISR* |
Ga0075434_1001709853 | 3300006871 | Populus Rhizosphere | MPFKSPPPKKGQSRKITLKFKTDMTPKKMALFRKSVRALAKRFRASISR* |
Ga0075426_111292502 | 3300006903 | Populus Rhizosphere | MPFKSPPPKKGQLRRVTLKFKSDMTRKQMASFRKSVRALARRFKAAISK* |
Ga0075424_1002769861 | 3300006904 | Populus Rhizosphere | MPFKSPPPKKGQSRKITLKFKTDMTPKKMALFRKGVRALAKRFKASISR* |
Ga0099791_101120112 | 3300007255 | Vadose Zone Soil | MPFKSPPKKGQSRKITLKFRTELTRKQMANFKKSVRALAKRFKATIAK* |
Ga0066709_10000070910 | 3300009137 | Grasslands Soil | MRFPKPDDTNHGGTLMPFKSPPPKKGHTRRIALKFRSDMTPKQFARFKKGVRVLAKRFKATISK* |
Ga0066709_1000342914 | 3300009137 | Grasslands Soil | MPFKSLPPKKGQLRRITLKFKSDMTRKQMATFRKSVRALAKRFKATISK* |
Ga0114129_101312604 | 3300009147 | Populus Rhizosphere | MPFKSPPPKKGQVRRIALKFKNDMTRKQMAAFRKSVRTLAKRFKATLAR* |
Ga0114129_130622561 | 3300009147 | Populus Rhizosphere | MPFKSPPKKGQSRKITLKFRSELTRKQMASFKKSVRALAKRFK |
Ga0075423_102138623 | 3300009162 | Populus Rhizosphere | RRVTLKFKSDMTRKQMASFRKSVRSLAKRFKATISK* |
Ga0105104_104856992 | 3300009168 | Freshwater Sediment | MPFKSPPPKKGQSRKITLKFRSDLTKKQMANFKKSVRSLAKRFKATISK* |
Ga0126374_117498811 | 3300009792 | Tropical Forest Soil | VKPVNPGGAHMPFKSPPKKGQSRKITLKFRTDLTKKQLASFKKSVRALAKRFKATLGR* |
Ga0105059_10414722 | 3300009795 | Groundwater Sand | MPFKMPPPKKNQKRRMLLTFRSDMTPKQFARFKKSVRALAKRFKLKVTK* |
Ga0105071_10514782 | 3300009808 | Groundwater Sand | MPFKSPPPKKNQKRRMVLKFRTDMTPKQFARFKKSVRALAK |
Ga0105067_10220281 | 3300009812 | Groundwater Sand | MPFKSPPPKKNQKRRLVLKFRSDLTSKQFARFKKSVRALAKRFKLTVSK* |
Ga0105057_10123112 | 3300009813 | Groundwater Sand | MPFKSPPPKKNQKRRLVLKFRSDLTSKQFARFKKSVRALAKRFKLT |
Ga0105057_10710881 | 3300009813 | Groundwater Sand | PRPEPTRRNAMPFKSPPPKRNQKRRMVFKFRSDLTPKQFARFKKSVRALAKRFKLAVTK* |
Ga0105072_10417182 | 3300009818 | Groundwater Sand | MPFKSPPPKKNQKRRMVLKFRSDMTPKQFARFKKSVRALAKRFKLTVTK* |
Ga0105085_11158552 | 3300009820 | Groundwater Sand | MPFKSPPPKKNQKRRMVLKFRTDMTPKQFARFKKSVRALAKRFKLTVTK* |
Ga0105064_10755112 | 3300009821 | Groundwater Sand | MPFKSPPPKKNQKRRMVLKFRTDMTPKQFARFKKSVRALAKRFKLAVTK* |
Ga0105068_10987322 | 3300009836 | Groundwater Sand | MPFKMPPPKKNQKRRMVLTFRSDMTPKQFARFKKSVRALAKRFKLKVTK* |
Ga0126380_107413763 | 3300010043 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRTDLTKKQMSSFKKSVRALAKRFKATLGR* |
Ga0126380_115036273 | 3300010043 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRSDLTKKQLATFKKSVRSLAKRFKATVSK* |
Ga0126384_104683322 | 3300010046 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRTDLTKKQLASFKKSVRALAKRFKATLGK* |
Ga0126384_117459693 | 3300010046 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRTDLTKKQLATFKKSVRALAKRFKATLGK* |
Ga0126382_112188271 | 3300010047 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRTDLTKKQLASFKKSVRSLAKRFK |
Ga0134071_100887842 | 3300010336 | Grasslands Soil | MTFKSPPPKKGHTRRIALKFRSDMTPKQFARFKKGVRVLAKRFKATISK* |
Ga0126370_121098962 | 3300010358 | Tropical Forest Soil | MPFKSPPPKKGQLRKITLKFKNDMTPKQMAQFRKSVRALAKRFKASISR* |
Ga0126376_101444621 | 3300010359 | Tropical Forest Soil | SRKITLKFRSDLSKKQLASFKKSVRSFAKRFKATVSK* |
Ga0126376_122590502 | 3300010359 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRSDLTKKQLASFKKSVRSLAKRFKATVGSKD* |
Ga0126372_100252231 | 3300010360 | Tropical Forest Soil | KGQSRKITLKFRSDLTKKQLASFKKSVRSLAKRFKATVGK* |
Ga0126377_104674952 | 3300010362 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRSDLTKKQLASFKKSVRSLAKRFKATLSK* |
Ga0126381_1045029211 | 3300010376 | Tropical Forest Soil | GQLRKITLKFKNDMTPKQMAQFKKSVRALAKRFKASISR* |
Ga0134122_130436351 | 3300010400 | Terrestrial Soil | NFLNPNTHRGAHMPFKSPPPKKGQLRRITLKFKTDLTRKQMANFRKSVRSLAKRFKASISR* |
Ga0134121_101085332 | 3300010401 | Terrestrial Soil | MPFKSPPPKRGQLRKITLKFKSDMTPKKMAQFRKSVRALAKRFKASISR* |
Ga0124850_10132843 | 3300010863 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRSDLTKKQLASFKKSVRSL |
Ga0124850_10696481 | 3300010863 | Tropical Forest Soil | KKGQSRKITLKFRCDLTKKQLASFKKSVRSLAKRFKATVGK* |
Ga0124844_10069413 | 3300010868 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRSDLTKKQLASFKKSVRSLAK |
Ga0137363_115054211 | 3300012202 | Vadose Zone Soil | VTLKFKSDMTRKQMASFRKSVRALAKRFKATISK* |
Ga0137399_108497351 | 3300012203 | Vadose Zone Soil | MPFKSPPPKKGQLRRITLKFKNDMTRKQMATFRKSVRALAKRFKATISR* |
Ga0137362_101243513 | 3300012205 | Vadose Zone Soil | MPFKSPPPKKGQLRRITLKFKSDLTRKQMATFRKSVRALAKRFKATISK* |
Ga0137381_103512393 | 3300012207 | Vadose Zone Soil | MPFKSPPPKKGQLRRITLKFKTDMTRKQMANFRKGVRSLAKRFKASISR* |
Ga0137360_103980702 | 3300012361 | Vadose Zone Soil | MPFKSPPPKKGQLRRITLKFKSDLTRKQMATFRKSVRALAKRFKATISR* |
Ga0137397_100119429 | 3300012685 | Vadose Zone Soil | MPFKSPPPRKGQLRRIVLKFKSDMTRKQHASFKKSVRALAKRFKAFVSK* |
Ga0137397_110424472 | 3300012685 | Vadose Zone Soil | MPFKSPPKKGQSRKITLKFRSELTRKQMASFKKSVRSLAKRFKATLGK* |
Ga0137394_1000062718 | 3300012922 | Vadose Zone Soil | MPFKSPPPKKGQLRRIVLKFKSDMTRKQHASFKKSVRALAKRFKAFVSK* |
Ga0137359_115777483 | 3300012923 | Vadose Zone Soil | KGQLRRITLKFKSDMTRKQMATFRKSVRALAKRFKARSSR* |
Ga0134110_104171913 | 3300012975 | Grasslands Soil | PKKGQLRRVTLKFKSDMTRKQMASFRKSVRALAKRFKATISK* |
Ga0134076_106022232 | 3300012976 | Grasslands Soil | MRFPKPDDTNHGGTLMPFKSPPPKKGHTRRIALKFRSDMTPKQFARFKRGVRVLAKRFKATISK* |
Ga0134081_100970172 | 3300014150 | Grasslands Soil | MPFKSPPPKKGQLRRVTLKFKSDMTHKQMASFRKSVRALAKRFKATISK* |
Ga0132255_1000121386 | 3300015374 | Arabidopsis Rhizosphere | MPFKSPPPKKGQLRKITLKFKSDMTPKKMAQFRKSVRALAKRYKASISR* |
Ga0182036_118093112 | 3300016270 | Soil | MPCKSPPPKKGQLRKITLKFKNDMTPKQMAQFRKSVRALAKRFKASISR |
Ga0182039_110533742 | 3300016422 | Soil | MPFKSPPPKKGQLRKITLKFKNDMTPKQMAQFRKSVRALAK |
Ga0066655_100993083 | 3300018431 | Grasslands Soil | MPFKSPPKKGQSRKITVKFRTDLTRKQLASFKKSVRALAKRFKATIGR |
Ga0066655_105744701 | 3300018431 | Grasslands Soil | MPFKSPPPKKGQLRRITLKFKSDMTRKQMATFRKSVRALAKRFKATISK |
Ga0066662_100561782 | 3300018468 | Grasslands Soil | MPFKSPPPKKGQLRRVTLKFKSDMTRKQMASFRKSVRALAKRFKATISK |
Ga0066662_114093971 | 3300018468 | Grasslands Soil | KPHDTHHGGTLMPFKSPPPKKGHTRRIALKFRSDMTPKQFARFKRGVRVLAKRFKATISK |
Ga0207660_115489912 | 3300025917 | Corn Rhizosphere | MPFKSPPPKKGQLRRITLKFKNDMTRKQMASFRKSVRSLAKRFKATISK |
Ga0207681_107237253 | 3300025923 | Switchgrass Rhizosphere | MPFKSPPPKKGQLRRITLKFKTDLTRKQMANFRKSVRSLAKRFKASISR |
Ga0207669_108074752 | 3300025937 | Miscanthus Rhizosphere | MPFKSPPPKKGQLRRITLKFKTDLTRKQMANFRKSVRSLAKRFKA |
Ga0207679_102963052 | 3300025945 | Corn Rhizosphere | MPFKSPPPKKGQLRKITLKFKSDMTPKKMAQFRKSVRALAKRFKASISR |
Ga0207648_104580002 | 3300026089 | Miscanthus Rhizosphere | MPFKSPPPKKGQLRRITLKFKTDLTRKQMANFRKS |
Ga0209350_10598371 | 3300026277 | Grasslands Soil | KRKRRTLMPFKSPPPKKGQLRRVTLKFKSDMTRKQMASFRKSVRALAKRFKATISK |
Ga0209235_10185393 | 3300026296 | Grasslands Soil | MPFKSPPPKKGHTRRIALKFRSDMTPKQFARFKKGVRVLAKRFKATISK |
Ga0209237_100168714 | 3300026297 | Grasslands Soil | MPFKSPPPKKGHTRRIALKFRSDMTPKQFARFKRGVRVLAKRFKATISK |
Ga0209237_11255283 | 3300026297 | Grasslands Soil | GQLRRVTLKFKSDMTRKQMASFRKSVRALAKRFKATISK |
Ga0209761_10808693 | 3300026313 | Grasslands Soil | FPKPHDTHHGGTLMPFKSPPPKKGHTRRIALKFRSDMTPKQFARFKRGVRVLAKRFKATISK |
Ga0209267_11034242 | 3300026331 | Soil | MPFKSPPKKGQSRKITLKFRSDLTRKQLASFRKSVRSLAKRFKATVGK |
Ga0209690_12048251 | 3300026524 | Soil | RIDSPKPDKRKRRTLMPFKSPPPKKGQLRRVTLKFKSDMTRKQMASFRKSVRALAKRFKATISK |
Ga0209058_10712632 | 3300026536 | Soil | MPFKSPPKKGQSRKITLKFRSDLTRKQLASFRKSVRSLAKRFKATISK |
Ga0209376_12667972 | 3300026540 | Soil | MPFKSPPPKKGQLRRITLKFKSDMTRKQMATFRKSVRALA |
Ga0209877_10286862 | 3300027032 | Groundwater Sand | MPFKMPPPKKNQKRRMLLTFRSDMTPKQFARFKKSVRALAKRFKLKVTK |
Ga0209898_10075611 | 3300027068 | Groundwater Sand | MPFKSPPPKKNQKRRLVLKFRSDLTSKQFARFKKSVRALAKRFKLTVSK |
Ga0209845_10752072 | 3300027324 | Groundwater Sand | MPFKSPPPKKNQKRRMVLKFRTDMTPKQFARFKKSVRALAKRFKLAVTK |
Ga0209854_10102933 | 3300027384 | Groundwater Sand | MPFKMPPPKKNQKRRMLLTFRSDMTPKQFARFKKSV |
Ga0209843_10372352 | 3300027511 | Groundwater Sand | MPFKSPPPKKNQKRRMVLKFRTDMTPKQFARFKKSVRALAKRFKLKVTK |
Ga0209684_10052812 | 3300027527 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRTDLTKKQLASFKKSVRALAKRFKATLGR |
Ga0209887_10213402 | 3300027561 | Groundwater Sand | MPFKSPPPKKNQKRRMVLKFRSDMTPKQFARFKKSVRALAKRFKLTVTK |
Ga0209466_10003574 | 3300027646 | Tropical Forest Soil | MPFKSPPKKGQSRKITLKFRTDLTKKQMSSFKKSVRALAKRFKATIGR |
Ga0209388_11155193 | 3300027655 | Vadose Zone Soil | MPFKSPPKKGQSRKITLKFRTELTRKQMASFKKSVRALAKRFKATLSK |
Ga0209593_103035522 | 3300027743 | Freshwater Sediment | MPFKSPPPKKGQSRKITLKFRSDLTKKQMANFKKSVRSLAKRFKATISK |
Ga0209811_100942882 | 3300027821 | Surface Soil | MPFKSPPPKKGQLRRITLKFKTDMTRKQMANFRKSVRSLAKRFKASISR |
Ga0209814_100001123 | 3300027873 | Populus Rhizosphere | MPFKSPPPKKGQLRRITLKFRTDMTRKQMATFRKSVRALAKRFKATISK |
Ga0209814_100007943 | 3300027873 | Populus Rhizosphere | MPFKSPPPKKGQLRRITLKFKNDLTRKQMASFRKSVRSLAKRFKATISK |
Ga0209465_101200422 | 3300027874 | Tropical Forest Soil | MPFKSPPPKKGQLRKITLKFKNDMTPKQMAQFKKSVRALAKRFKASISR |
Ga0209868_10168902 | 3300027947 | Groundwater Sand | MPFKSPPPKKNQKRRMLLTFRSDMTPKQFARFKKSVRALAKRFKLKVTK |
Ga0209857_10736011 | 3300027957 | Groundwater Sand | MPFKMPPPKKNQKRRMLLTFRSDMTPKQFARFKKSVRALAKRFKL |
Ga0137415_101078382 | 3300028536 | Vadose Zone Soil | MPFKSPPPKKGQLRRITLKFKNDMTRKQMATFRKSVRALAKRFKATISR |
Ga0307498_101785203 | 3300031170 | Soil | RGAHMPFKSPPPKKGQLRRITLKFKTDMTRKQMANFRKSVRSLAKRFKASISR |
Ga0318516_100889213 | 3300031543 | Soil | MPFKSPPPKKGQLRKITLKFKNDMTPKQMAQFRKSVRALAKRFKASISR |
Ga0318574_105294482 | 3300031680 | Soil | MPFKSPPPKKGQLRKISLKFKNDMTPKQMAQFRKSVRALAKRFKASISR |
Ga0307469_100905153 | 3300031720 | Hardwood Forest Soil | MPFKSPPPKKGQLRRITLKFKTDMTRKQMASFRKSVRSLAKRFKASISR |
Ga0307469_110090263 | 3300031720 | Hardwood Forest Soil | MPFKTPPKKGQSRKITLKFRSELTRKQMASFKKSVRALAKRFKATISK |
Ga0307469_111039121 | 3300031720 | Hardwood Forest Soil | MPFKSPPKKGQSRKITLKFRSELTRKQHASFKKSVRALAKRFKA |
Ga0307469_112055993 | 3300031720 | Hardwood Forest Soil | QGGTHMPFKSPPKKGQSRKITLKFRSELTRKQHASFKKSVRALAKRFKATISK |
Ga0307469_117962132 | 3300031720 | Hardwood Forest Soil | MPFKSPPKKGQSRKITLKFRTDLTKKQMASFKKSVRALAKRFKATLGR |
Ga0307468_1001550592 | 3300031740 | Hardwood Forest Soil | MPFKSPPKKGQSRKITLKFRTELTRKQMASFKKSVRSLAKRFKATIAR |
Ga0307468_1005111772 | 3300031740 | Hardwood Forest Soil | MPFKSPPKKGQSRKITLKFRSELTRKQHASFKKSVRALAKRFKATISK |
Ga0307468_1018697033 | 3300031740 | Hardwood Forest Soil | PKLDTLERRTLMPFKSLPPKKGQLRRITLKFKSDMTRKQMATFRKSVRALAKRFKATISK |
Ga0318494_102079581 | 3300031751 | Soil | MPFKSPPPKKGQLRKITLKFKNDMTPKQMAQFRKSVRALAKRFKAS |
Ga0318566_101830031 | 3300031779 | Soil | RMPFKSPPPKKGQLRKITLKFKNDMTPKQMAQFRKSVRALAKRFKASISR |
Ga0310901_104392171 | 3300031940 | Soil | HETHTDQGGECMPFKSPPPKKGQLRRITLKFKNDMTRKQMASFRKSVRSLAKRFKATISK |
Ga0310884_105819851 | 3300031944 | Soil | TDQGGECMPFKSPPPKKGQLRRITLKFKNDMTRKQMASFRKSVRSLAKRFKATISK |
Ga0318514_107367341 | 3300032066 | Soil | MPFKSPPPKKGQLRKITLKFKNDMTPKQMAQFRKSVRA |
Ga0307471_1000249093 | 3300032180 | Hardwood Forest Soil | MPFKSPPKKGQSRKITLKFRTELTRKQMASFKKSVRALAKRFKATISK |
Ga0307471_1003510321 | 3300032180 | Hardwood Forest Soil | MPFKSPPPKKGQLRRITLKFKTDMTRKQMASFRKSVRSLAKRFK |
Ga0307471_1003612193 | 3300032180 | Hardwood Forest Soil | LRRITLKFKTDMTRKQMASFRKSVRSLAKRFKASISR |
Ga0307471_1004704633 | 3300032180 | Hardwood Forest Soil | MPFKSPPPKKGQLRRITLKFKNDLTRKQMAQFRKSVRSLAKRFKASISR |
Ga0307471_1016354462 | 3300032180 | Hardwood Forest Soil | MPFKTPPKKGQSRKITLKFRSELTRKQMASFKKSVRALAKRFKATLSK |
Ga0307471_1038866473 | 3300032180 | Hardwood Forest Soil | KKGQLRRVTLKFKSDMTRKQMASFRKSVRALAKRFKATISK |
Ga0307472_1012365212 | 3300032205 | Hardwood Forest Soil | MPFKTPPKKGQSRKITLKFRSELTRKQHASFKKSVRALAKRFKATISK |
Ga0326726_119824952 | 3300033433 | Peat Soil | MPFKSPPPKKGQLRRITLKFKNDMTRKHMALFRKSVRSLAKRFKASISR |
⦗Top⦘ |