Basic Information | |
---|---|
Family ID | F047736 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 149 |
Average Sequence Length | 47 residues |
Representative Sequence | DRETREIFQDPDTNLLYVTDGNGGGLTVLRYTGPIPKDPPLPGAR |
Number of Associated Samples | 125 |
Number of Associated Scaffolds | 149 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 91.28 % |
% of genes from short scaffolds (< 2000 bps) | 85.23 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.248 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.738 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.846 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.651 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.18% Coil/Unstructured: 80.82% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 149 Family Scaffolds |
---|---|---|
PF07732 | Cu-oxidase_3 | 13.42 |
PF08309 | LVIVD | 3.36 |
PF07987 | DUF1775 | 2.68 |
PF03030 | H_PPase | 2.01 |
PF00873 | ACR_tran | 1.34 |
PF00027 | cNMP_binding | 1.34 |
PF02566 | OsmC | 1.34 |
PF04234 | CopC | 1.34 |
PF04909 | Amidohydro_2 | 1.34 |
PF11604 | CusF_Ec | 1.34 |
PF02738 | MoCoBD_1 | 1.34 |
PF07311 | Dodecin | 1.34 |
PF03401 | TctC | 0.67 |
PF00497 | SBP_bac_3 | 0.67 |
PF05119 | Terminase_4 | 0.67 |
PF14226 | DIOX_N | 0.67 |
PF13458 | Peripla_BP_6 | 0.67 |
PF05378 | Hydant_A_N | 0.67 |
PF00080 | Sod_Cu | 0.67 |
PF00392 | GntR | 0.67 |
PF14347 | DUF4399 | 0.67 |
PF07676 | PD40 | 0.67 |
PF00529 | CusB_dom_1 | 0.67 |
PF02518 | HATPase_c | 0.67 |
PF00753 | Lactamase_B | 0.67 |
PF09339 | HTH_IclR | 0.67 |
PF13340 | DUF4096 | 0.67 |
PF12697 | Abhydrolase_6 | 0.67 |
PF13437 | HlyD_3 | 0.67 |
PF01425 | Amidase | 0.67 |
PF07885 | Ion_trans_2 | 0.67 |
COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
---|---|---|---|
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 13.42 |
COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 3.36 |
COG4549 | Uncharacterized conserved protein YcnI, contains cohesin/reeler-like domain | Function unknown [S] | 2.68 |
COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 2.01 |
COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.34 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.34 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.34 |
COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 1.34 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.34 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.67 |
COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.67 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.67 |
COG3747 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.25 % |
Unclassified | root | N/A | 12.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664021|ICCgaii200_c1080837 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
3300000787|JGI11643J11755_11697762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 547 | Open in IMG/M |
3300001686|C688J18823_10824419 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300002121|C687J26615_10086189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
3300002912|JGI25386J43895_10049872 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300004081|Ga0063454_100412772 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300004153|Ga0063455_101131169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300004463|Ga0063356_105350344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300004633|Ga0066395_10357118 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300004633|Ga0066395_10460479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
3300005177|Ga0066690_10695787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 673 | Open in IMG/M |
3300005328|Ga0070676_10147054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1505 | Open in IMG/M |
3300005332|Ga0066388_100376368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2066 | Open in IMG/M |
3300005332|Ga0066388_100953475 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
3300005332|Ga0066388_102030960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1032 | Open in IMG/M |
3300005332|Ga0066388_104325009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300005332|Ga0066388_104890519 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300005332|Ga0066388_106173589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
3300005338|Ga0068868_101554982 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300005354|Ga0070675_100415542 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300005367|Ga0070667_102272529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
3300005439|Ga0070711_101579777 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005450|Ga0066682_10805654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300005537|Ga0070730_10924955 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300005548|Ga0070665_100763942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 979 | Open in IMG/M |
3300005556|Ga0066707_10300752 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300005557|Ga0066704_10404490 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 906 | Open in IMG/M |
3300005563|Ga0068855_101755253 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300005568|Ga0066703_10773873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
3300005569|Ga0066705_10408888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
3300005713|Ga0066905_100482026 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300005713|Ga0066905_101310188 | Not Available | 652 | Open in IMG/M |
3300005764|Ga0066903_100235250 | All Organisms → cellular organisms → Bacteria | 2801 | Open in IMG/M |
3300005764|Ga0066903_101460016 | Not Available | 1289 | Open in IMG/M |
3300005764|Ga0066903_107821703 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300006028|Ga0070717_10967738 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 775 | Open in IMG/M |
3300006034|Ga0066656_11131840 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300006237|Ga0097621_101675265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
3300006796|Ga0066665_10972862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium 13_1_40CM_64_14 | 653 | Open in IMG/M |
3300006852|Ga0075433_10481857 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300006852|Ga0075433_11564538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 569 | Open in IMG/M |
3300006853|Ga0075420_100831488 | Not Available | 795 | Open in IMG/M |
3300006914|Ga0075436_101463426 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
3300007004|Ga0079218_10509140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 1068 | Open in IMG/M |
3300007004|Ga0079218_11824180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 683 | Open in IMG/M |
3300007004|Ga0079218_12973895 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300009012|Ga0066710_102654620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 717 | Open in IMG/M |
3300009012|Ga0066710_104329050 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300009038|Ga0099829_11457289 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300009038|Ga0099829_11744138 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300009090|Ga0099827_10088142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2440 | Open in IMG/M |
3300009090|Ga0099827_11455868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 596 | Open in IMG/M |
3300009100|Ga0075418_11285962 | Not Available | 793 | Open in IMG/M |
3300009162|Ga0075423_12359316 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300009162|Ga0075423_13148318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 506 | Open in IMG/M |
3300009813|Ga0105057_1052721 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300010046|Ga0126384_10159394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1746 | Open in IMG/M |
3300010047|Ga0126382_11055708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
3300010159|Ga0099796_10067520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1283 | Open in IMG/M |
3300010166|Ga0126306_10304013 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300010360|Ga0126372_11755055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 663 | Open in IMG/M |
3300010361|Ga0126378_12234559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
3300010361|Ga0126378_12893717 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300010362|Ga0126377_12028358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300010362|Ga0126377_13003853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300010366|Ga0126379_10384643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1446 | Open in IMG/M |
3300010371|Ga0134125_12465567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 565 | Open in IMG/M |
3300010376|Ga0126381_103434360 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300010376|Ga0126381_104455243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
3300010400|Ga0134122_10699412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 952 | Open in IMG/M |
3300010868|Ga0124844_1140414 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 917 | Open in IMG/M |
3300011271|Ga0137393_11618786 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300012189|Ga0137388_11262449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 677 | Open in IMG/M |
3300012189|Ga0137388_11375472 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300012189|Ga0137388_11861840 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300012210|Ga0137378_10523209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
3300012351|Ga0137386_10818484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300012357|Ga0137384_10300699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1334 | Open in IMG/M |
3300012360|Ga0137375_11260279 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300012362|Ga0137361_11678755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300012924|Ga0137413_10026758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3113 | Open in IMG/M |
3300012929|Ga0137404_11945845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300012948|Ga0126375_11141427 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
3300012958|Ga0164299_11209969 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300012960|Ga0164301_10213508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1240 | Open in IMG/M |
3300012971|Ga0126369_11455066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
3300013104|Ga0157370_10677910 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300013296|Ga0157374_10636259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1078 | Open in IMG/M |
3300013307|Ga0157372_11254695 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300014154|Ga0134075_10510995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300014495|Ga0182015_10659515 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300014497|Ga0182008_10471998 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 685 | Open in IMG/M |
3300014838|Ga0182030_11379898 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300015372|Ga0132256_101343569 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300016270|Ga0182036_11599335 | Not Available | 549 | Open in IMG/M |
3300016357|Ga0182032_10555760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 950 | Open in IMG/M |
3300016445|Ga0182038_11291532 | Not Available | 652 | Open in IMG/M |
3300017930|Ga0187825_10289584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 608 | Open in IMG/M |
3300018052|Ga0184638_1332683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300018079|Ga0184627_10269956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
3300018468|Ga0066662_11857571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
3300018469|Ga0190270_12310938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 599 | Open in IMG/M |
3300018476|Ga0190274_10317493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1461 | Open in IMG/M |
3300021405|Ga0210387_11787219 | Not Available | 518 | Open in IMG/M |
3300022563|Ga0212128_10820789 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
3300024860|Ga0256344_1009867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2089 | Open in IMG/M |
3300025903|Ga0207680_10718878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 716 | Open in IMG/M |
3300025903|Ga0207680_10831854 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300025913|Ga0207695_10634054 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300025918|Ga0207662_11146109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300026089|Ga0207648_11870883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 562 | Open in IMG/M |
3300026306|Ga0209468_1083305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium 13_1_40CM_64_14 | 1063 | Open in IMG/M |
3300026313|Ga0209761_1163231 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300026328|Ga0209802_1093511 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
3300027874|Ga0209465_10284195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 829 | Open in IMG/M |
3300028379|Ga0268266_11405346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 673 | Open in IMG/M |
3300028791|Ga0307290_10001810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6873 | Open in IMG/M |
3300028810|Ga0307294_10266089 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300028869|Ga0302263_10446011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
3300029883|Ga0311327_10705012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300029911|Ga0311361_10258207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2027 | Open in IMG/M |
3300029992|Ga0302276_10283597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
3300031198|Ga0307500_10162140 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300031232|Ga0302323_100128211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2488 | Open in IMG/M |
3300031247|Ga0265340_10172886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
3300031470|Ga0272432_1016551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5915 | Open in IMG/M |
3300031573|Ga0310915_10699602 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300031912|Ga0306921_12316894 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300031995|Ga0307409_101646733 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300032013|Ga0310906_10342379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
3300032035|Ga0310911_10810021 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300032060|Ga0318505_10138479 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300032075|Ga0310890_11542016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300032205|Ga0307472_101464810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300032205|Ga0307472_102774371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300033289|Ga0310914_10535680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
3300034025|Ga0334940_023028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1735 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.07% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.37% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.03% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.36% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.01% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.01% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.01% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.34% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.34% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.34% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.34% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.34% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.34% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.34% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.67% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.67% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.67% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.67% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.67% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.67% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.67% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.67% |
Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.67% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.67% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.67% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300024860 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031470 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nord | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034025 | Biocrust microbial communities from Mojave Desert, California, United States - 36SMC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICCgaii200_10808373 | 2228664021 | Soil | PNGGALRHTREPYQDPDTGLIYVTDGNGGGVTVLKWTGRIPPPPIPGAR |
JGI11643J11755_116977622 | 3300000787 | Soil | TCGGSDPNGGALRHTREPYQDPDTNLIYVTDGNGGGITVLRWTGDIPPRPPIPGAR* |
F14TB_1101845482 | 3300001431 | Soil | EVGYYLSPRYASFGYVDRQSREVFQDPDTNLIYVTDGNGGGLTVLEWTGLIPKHPPMPGAR* |
C688J18823_108244192 | 3300001686 | Soil | GRHTREPYPDWDSDLIYVTDGNGGGLTALRYTGALPTKPPTPGVR* |
C687J26615_100861892 | 3300002121 | Soil | RRDRHTREVFQDPDTGLLYLTDGNGSGLMVLRYTGPIPKALPIPGAR* |
JGI25386J43895_100498721 | 3300002912 | Grasslands Soil | VFVDPDTNLVYVTDGNGGGLTVLKYTGPIPERAPIPGVR* |
Ga0063454_1004127722 | 3300004081 | Soil | IDVPGQKGRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGALPSRPPIPGVR* |
Ga0062593_1005991511 | 3300004114 | Soil | PREVGYYLPPKYASWGYVDRQTREVFQDPDTDLIYVTDGNGGGLTVLEWTGPIPKHPPIPAAR* |
Ga0063455_1011311691 | 3300004153 | Soil | GRNDRHTREIFQDPDTGLLYVTDGNGGGLTVLRYTGPIPDKLPIPGGR* |
Ga0063356_1053503441 | 3300004463 | Arabidopsis Thaliana Rhizosphere | EPHKVRHTREIWQDPDSNLLYLTDGNGGGLMVLRYTGQIPTRLPIPGAR* |
Ga0066395_103571181 | 3300004633 | Tropical Forest Soil | TREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPTKPPIPGIR* |
Ga0066395_104604791 | 3300004633 | Tropical Forest Soil | TREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPTKPPIPGVR* |
Ga0066690_106957871 | 3300005177 | Soil | ALDRHTREVFVDPDTNLVYVTDGNGGGLTVLKYTGPIPERAPIPGLR* |
Ga0070676_101470542 | 3300005328 | Miscanthus Rhizosphere | REVFQDPDNDLIYVTDGNGGGLTVLEWTGPIPKTPPIPGAR* |
Ga0066388_1003763682 | 3300005332 | Tropical Forest Soil | ARKDRHTREIFQDPDTGLLYLTDGNGAGLMVLRYTGPIPDQAPIPGGR* |
Ga0066388_1009534751 | 3300005332 | Tropical Forest Soil | REIFQDPDTGLLYLTDGNGAGLMVLRYTGPIPDKAPIPGGR* |
Ga0066388_1020309601 | 3300005332 | Tropical Forest Soil | APQRQDRHTREIFQDPDTGLLYVTDGNGGGLTVLRYTGPIPERAPFPGAR* |
Ga0066388_1043250092 | 3300005332 | Tropical Forest Soil | HTREIFQDPDTGLLYLTDGNGGGLMVLRYTGPIPDKAPFPGAR* |
Ga0066388_1048905192 | 3300005332 | Tropical Forest Soil | RESYQDRDSGLLFMTDANGGGVTVLRWTGPIPPRPPIPASVPGSR* |
Ga0066388_1061735891 | 3300005332 | Tropical Forest Soil | GRHTREPYPDWDSDIIYVTDGNGGGLTALRFTGPLPTKPPIPGVR* |
Ga0068868_1015549822 | 3300005338 | Miscanthus Rhizosphere | PQVRMGYDPRHTRETYQDPDSGLIYMTDGSGGGLTVLRWTGYVPKNRQIPGAR* |
Ga0070691_103359472 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | PFAPKFVGYYLSPKYASWENDDRRTREVGQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGAR* |
Ga0070675_1004155423 | 3300005354 | Miscanthus Rhizosphere | SIPQQIGRHTREAYFDPATNLIYVTDGNGGGVTVVRYTGPMPSNPPIPGATR* |
Ga0070671_1014560721 | 3300005355 | Switchgrass Rhizosphere | WDISNPFLPREVGYYLPPKYASWGYVDRQTREVFQDPDTNLIYVTDGNGGGLTVLEWTGPIPKHPPIPGSR* |
Ga0070667_1022725291 | 3300005367 | Switchgrass Rhizosphere | YVDRQTREVFQDPDTNLIYVTDGNGGGLTVLEWTGPIPKHPPIPGAR* |
Ga0070711_1015797771 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GGPAPVNRHTREEWQDRSTGLLYVTDGSGGGLTVLRWTGPIPANPPIPGAR* |
Ga0066682_108056542 | 3300005450 | Soil | EIFQDPDTGLLYLTDGNGGGLMVLRYTGLIPDRLPIPGGR* |
Ga0070730_109249552 | 3300005537 | Surface Soil | TREVFQDPATGLLYVTDGNGGGLTVLRWTGPIPRPPLPVR* |
Ga0070665_1007639421 | 3300005548 | Switchgrass Rhizosphere | GQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGAR* |
Ga0070704_1014330412 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | YLSPKYASWENDDRRTREVGQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGAR* |
Ga0066707_103007522 | 3300005556 | Soil | YSDSALDRHTREVFVDPDTNLVYVTDGNGGGLTVLKYTGPIPERAPIPGVR* |
Ga0066704_104044903 | 3300005557 | Soil | RTHLIYVTDGNGGGVTVLRYTGPMPQRPPIPGAR* |
Ga0068855_1017552531 | 3300005563 | Corn Rhizosphere | YTPVFRHSREEFEDPTTGLIYMTDGNGGGLTVLRWTGPVPRNPPLPGAR* |
Ga0066703_107738731 | 3300005568 | Soil | APRYAVPGRPADRQIREVYQDPATGLIYMTDGNGGGLTVLRWTGPVPSKPPIPGAR* |
Ga0066705_104088882 | 3300005569 | Soil | PRFAAPGRNDRQTREIFQDPDTGLLYLTDGNGGGLMVLRYTGLIPDRLPIPGGR* |
Ga0066905_1004820263 | 3300005713 | Tropical Forest Soil | PRQVGRHTREAYIDPKTNLIYVSDGNGGGVTVLRYTGPLPPRAPMPGAR* |
Ga0066905_1013101881 | 3300005713 | Tropical Forest Soil | KTNLIYVTDGNGGGVTVLRYTGPIPQHAPIPGAR* |
Ga0066903_1002352501 | 3300005764 | Tropical Forest Soil | INVPGQKGRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGVLPTRPPIPGVR* |
Ga0066903_1014600162 | 3300005764 | Tropical Forest Soil | PGQKGRHTREPYPDWDSDLIYVTDGNGGGLTALRYTGPLPTKPPIPGVR* |
Ga0066903_1078217031 | 3300005764 | Tropical Forest Soil | TREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPAKPPIPGVR* |
Ga0070717_109677381 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DTSTSFQVGRHTREAFVDPDTMQVYVSDGNSGGITVLRYTGPMPAHPPLPGIR* |
Ga0066656_111318402 | 3300006034 | Soil | QIREVYQDPATGLIYMTDGNGGGLTVLRWTGPVPSKPPIPGAR* |
Ga0097621_1016752651 | 3300006237 | Miscanthus Rhizosphere | DRHTREIFQDPDTDLIYVSDGNGGGLTVLQWTGPIPKNPPIAGAR* |
Ga0068871_1024270112 | 3300006358 | Miscanthus Rhizosphere | RVWDISNPFLPREIGFYLSPKYASFGLVDRHTREVFQDPDTDLIYVTDGNGGGLTVLEWTGPIPKNPPIPGAR* |
Ga0066665_109728622 | 3300006796 | Soil | EVYQDPATGLIYMTDGNGGGLTVLRWTGPVPSKPPIPGAR* |
Ga0075433_104818572 | 3300006852 | Populus Rhizosphere | PATNLIYVTDGNGGGLTVLRYTGPIPSRPPIPGAR* |
Ga0075433_115645382 | 3300006852 | Populus Rhizosphere | VGQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGAR* |
Ga0075420_1008314881 | 3300006853 | Populus Rhizosphere | PNRNDRHTREIFQDPDTNLLYVTDGNGGGVMVLRYTGPLPERRPIPGGR* |
Ga0075436_1014634261 | 3300006914 | Populus Rhizosphere | FSIPQQVGRHTREAYLDPATNLIYVTDGNGGGITVLRYIGPIPNQPPIPGAR* |
Ga0079218_105091401 | 3300007004 | Agricultural Soil | WENDDRRTREVAQDPITNLIYITDGNGGGLTVLRYTGPIPASPPIPGAR* |
Ga0079218_115645141 | 3300007004 | Agricultural Soil | EVGFYLPPKYASYGYVDRQTREVFQDPDTDLIYVTDGNGGGLTVLEWTGPIPKDPPIPGAR* |
Ga0079218_118241802 | 3300007004 | Agricultural Soil | WENDDRRTREVAQDPITNLIYITDGNGGGLTVLRYTGPIPAGPPIPGAR* |
Ga0079218_129738951 | 3300007004 | Agricultural Soil | PPKYASYGYVDRQTREVFQDPDTDLIYVTDGNGGGLTVLEWTGPIPKHPPIPGAR* |
Ga0066710_1026546201 | 3300009012 | Grasslands Soil | PNTSPYADSALDRHTREVFVDPDTNLVYVTDGNGGGLTVLKYTGPIPERAPIPGVR |
Ga0066710_1043290501 | 3300009012 | Grasslands Soil | KGRHTREPYPDWDSDLIYVTDGNGGGLTALRYIGPLPTKPPIPGVR |
Ga0099829_114572891 | 3300009038 | Vadose Zone Soil | KGRHTREPYPDWDSDLIYVTDGNGGGLTALRYTGPLPTKPPIPGIR* |
Ga0099829_117441382 | 3300009038 | Vadose Zone Soil | YPDWDSDLIYVTDGNGGGLTALRYTGPLPTKPPIPGIR* |
Ga0099827_100881421 | 3300009090 | Vadose Zone Soil | TREIFQDPATGLLYLTDGNGGGLMVLRYTGPVPDRPPIPGAR* |
Ga0099827_114558681 | 3300009090 | Vadose Zone Soil | VFVDPDTNLVYVTDGNGGGVTVLRYTGPIPERAPIPRVR* |
Ga0075418_112859621 | 3300009100 | Populus Rhizosphere | REIFQDPDTNLLYVTDGNGGGVMVLRYTGPLPERRPIPGGR* |
Ga0075423_123593161 | 3300009162 | Populus Rhizosphere | TSPYADSALARHTREVFVDPDTNLVYLTDGNGGGLTVLRYTGPIPEQAPILGVR* |
Ga0075423_131483181 | 3300009162 | Populus Rhizosphere | PKYASWENDDRRTREVGQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGAR* |
Ga0105057_10527212 | 3300009813 | Groundwater Sand | ETYQDRDTGLIYMTDGNGGGLTVLRWTGPIPPKPPIPGAR* |
Ga0126384_101593941 | 3300010046 | Tropical Forest Soil | NDRQTREIFQDPDTGLLYLTDGNGAGLMVLRYTGPIPDQAPIPGGR* |
Ga0126382_110557081 | 3300010047 | Tropical Forest Soil | DTGLLYLTDGNGAGLMVLRYTGPIPDKAPIPGGR* |
Ga0099796_100675201 | 3300010159 | Vadose Zone Soil | PDTGLLYLTDGNGAGLMVLRYTGSIPDKAPIPGGR* |
Ga0126306_103040133 | 3300010166 | Serpentine Soil | PRFAAPGREDRHTREVWQDPDTDLIYVTDGNGGGITVVRYTGPIPPGRPIPGAR* |
Ga0126372_117550552 | 3300010360 | Tropical Forest Soil | SVPKQVGRHTREAYVDPKTQLIYVTDGNGGGVTVLRYTGPMPQRPPLPGAR* |
Ga0126378_122345591 | 3300010361 | Tropical Forest Soil | TREIFQDPDTGLLYLTDGNGAGLMVLRYTGPIPDQAPIPGGR* |
Ga0126378_128937171 | 3300010361 | Tropical Forest Soil | SINVRGQKGRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPAKPPIPGVR* |
Ga0126377_120283582 | 3300010362 | Tropical Forest Soil | HTREIFQDPDTGLLYLTDGNGAGLMVLRYTGPIPDKAPIPGGR* |
Ga0126377_130038531 | 3300010362 | Tropical Forest Soil | IFQDPDTGLLYLTDGNGAGLMVLRYTGPIPDKLPIPGGR* |
Ga0126379_103846431 | 3300010366 | Tropical Forest Soil | HTREIFQDPDTGLLYLTDGNGVGLMVLRYTGPIPDKPPIPGGR* |
Ga0134125_124655671 | 3300010371 | Terrestrial Soil | ASWENDDRRTREVGQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGAR* |
Ga0126381_1034343601 | 3300010376 | Tropical Forest Soil | HTREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPTKPPIPGIR* |
Ga0126381_1044552432 | 3300010376 | Tropical Forest Soil | HTREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPTKPPIPGVR* |
Ga0134122_106994122 | 3300010400 | Terrestrial Soil | DRRTREVGQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGAR* |
Ga0124844_11404141 | 3300010868 | Tropical Forest Soil | VGRHTREAYVDPKTNLIYVTDGNGGGVTVLRYTGPMPQ |
Ga0137393_116187862 | 3300011271 | Vadose Zone Soil | QRGRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPTKPPIPGVR* |
Ga0137388_112624492 | 3300012189 | Vadose Zone Soil | HTREPYPDWDSDLIYVTDGNGGGLTALRYIGPLPTKPPIPGVR* |
Ga0137388_113754722 | 3300012189 | Vadose Zone Soil | YPDWDSDLIYVTDGNGGGLTVLRYTGPLPTKPPIPGVR* |
Ga0137388_118618401 | 3300012189 | Vadose Zone Soil | PGQKGRHTREPYPDWDSDLIYVTDGNGGGLTALRYTGPLPTKPPIPGIR* |
Ga0137378_105232091 | 3300012210 | Vadose Zone Soil | NDRQTREIFQDPATGLLYLTDGNGGGLMVLRYTGPVPDRPPIPGAR* |
Ga0137386_108184841 | 3300012351 | Vadose Zone Soil | PRFGSPGRNDRQTREIFQDPATGLLYLTDGNGGGLMVLRYTGPVPDRPPIPGAR* |
Ga0137384_103006992 | 3300012357 | Vadose Zone Soil | DRQTREIFQDPATGLLYLTDGNGGGLMVLRYTGPVPDRPPIPGAR* |
Ga0137375_112602791 | 3300012360 | Vadose Zone Soil | MGRHTREPYPDWNSDLIYVTDGNGGGLTALRYTGPLPTKPPIPGVR* |
Ga0137361_116787551 | 3300012362 | Vadose Zone Soil | KDRHTREIFQDPDTGLLYLTDGNGAGLMVLRYTGPIPDKAPIPGGR* |
Ga0137413_100267583 | 3300012924 | Vadose Zone Soil | DRHTREIFQDPDTGLLYLTDGNGAGLMVLRYTGPIPDKAPIPGGR* |
Ga0137404_119458451 | 3300012929 | Vadose Zone Soil | TARKDRHTREIFQDPDTGLLYLTDGNGAGLMVLRYTGPIPDKAPIPGGR* |
Ga0126375_111414271 | 3300012948 | Tropical Forest Soil | PKTNLIYVSDGNGGGVTVLRYTGPLPPRAPMPGAR* |
Ga0164299_112099692 | 3300012958 | Soil | GIEVPGQKGRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGALPTRPPIPGVR* |
Ga0164301_102135081 | 3300012960 | Soil | TGAPGRNDRHTREIFQDPDTGLLYLTDGNGAGLMVLRYTGPIPQNPPIPGGR* |
Ga0126369_114550661 | 3300012971 | Tropical Forest Soil | RKDRHTREIFQDPDTGLLYLTDGNGAGLMVLRYTGPIPDKAPIPGGR* |
Ga0157370_106779102 | 3300013104 | Corn Rhizosphere | VFRHAREEFEDPTTGLIYMTDGNGGGLTVLRYTGPVPRNPPLPGAR* |
Ga0157374_106362593 | 3300013296 | Miscanthus Rhizosphere | PKYASWGYVDRQTREVFQDPDTNLIYVTDGTGGGLTVLEWTGPIPKHPPIPGSR* |
Ga0157372_112546951 | 3300013307 | Corn Rhizosphere | DPTTGLIYMTDGNGGGLTVLRWTGPVPRNPPLPGAR* |
Ga0134075_105109952 | 3300014154 | Grasslands Soil | RHTREIFQDPDTGLLYLTDGNGGGLMVLRYTGPIPQRLPVPGAR* |
Ga0182015_106595151 | 3300014495 | Palsa | VFQDPSSNLLYITDGNGGGLTVLRYTGPTPEHPPLPGAR* |
Ga0182008_104719981 | 3300014497 | Rhizosphere | AYVDPASGLVYVTDGNNGGVTILRYTGPMPQHPPLPGVR* |
Ga0182030_113798981 | 3300014838 | Bog | LSPRYAAPGRGDRQTREIFQDPATDLLYVTDGNGGGLAVLRYTGPIPEHPPIPGAR* |
Ga0132256_1013435691 | 3300015372 | Arabidopsis Rhizosphere | GLVDRHTREVFQDPDTNLIYVTDGNGGGLTVLEWTGPIPKHPPIPGAR* |
Ga0132257_1008269201 | 3300015373 | Arabidopsis Rhizosphere | VDISNPFAPKFVGYYLSPKYASWENDDRRTREVGQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGAR* |
Ga0182036_115993352 | 3300016270 | Soil | REPYPDWDSDLIYVTDGNGGGLTALRYTGPLPTKPPIPGVR |
Ga0182032_105557601 | 3300016357 | Soil | QTRETFQDLRTGLIYMTDGNGGGLTVLRWTGRIPARPPIPGAR |
Ga0182038_112915321 | 3300016445 | Soil | GQKGRHTREPYPDWDSDLIYVTDGNGGGLTALRYTGPLPTKPPIPGVR |
Ga0187825_102895841 | 3300017930 | Freshwater Sediment | PQQAGRHTREAYTDPTTNLIYVTDGNGGGVTVLRYTGPMPSRPPIPGGAR |
Ga0184638_13326831 | 3300018052 | Groundwater Sediment | TSARRDRHTREIFQDPDTGLLYLTDGNGAGLMVLRYTGPIPDKAPIPGGR |
Ga0184627_102699562 | 3300018079 | Groundwater Sediment | EIFQDPDTGLLYLTDGNGGGLMVLRYTGPIPTRLPIPGAR |
Ga0066662_118575712 | 3300018468 | Grasslands Soil | PTSTARKDRHTREIFQDPETGLLYLTDGNGAGLMVLRYTGPIPDKAPIPGGR |
Ga0190270_123109382 | 3300018469 | Soil | DVPGQKGRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPSRPPIPGVR |
Ga0190274_103174931 | 3300018476 | Soil | REIFQDPYTGLLYLTDGNGAGLMVLRYTGPIPDKHPLPGGR |
Ga0210387_117872191 | 3300021405 | Soil | TREIWQDETTGLIWMTDGNGGGVTALRWTGAIPRHPPLPGAR |
Ga0212128_108207891 | 3300022563 | Thermal Springs | HTREAYVDPATNLIYVTDGNGGGVTVLRYTGPIPQRPPIPGAR |
Ga0256344_10098671 | 3300024860 | Freshwater | RFASPGRKDRHTREIWQDPKTDLLYVTDGNGGGLTVLRYTGPIPANAPSPGAR |
Ga0207680_107188782 | 3300025903 | Switchgrass Rhizosphere | FQDPDTNLIYVTDGNGGGLTVLEWTGPIPKHPPIPGAR |
Ga0207680_108318541 | 3300025903 | Switchgrass Rhizosphere | PDRIGRQTREAYQDPATGLIYLSDGNGGGITVLRWTGPIPADPLPGAR |
Ga0207695_106340541 | 3300025913 | Corn Rhizosphere | EEFQDPTTGLIYMTDGNGGGLTVLRWTGPIPPNPPLPGAR |
Ga0207662_111461092 | 3300025918 | Switchgrass Rhizosphere | FQAPDTGLLYLTDGNGAGLMVLRYTGPIPDKAPIPGGR |
Ga0207704_115248702 | 3300025938 | Miscanthus Rhizosphere | YLSPKYASWENDDRRTREVGQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGAR |
Ga0207648_118708833 | 3300026089 | Miscanthus Rhizosphere | QTREVFQDPDTNLIYVTDGNGGGLTVLEWTGPIPKHPPIPGAR |
Ga0209468_10833052 | 3300026306 | Soil | EVYQDPATGLIYMTDGNGGGLTVLRWTGPVPSKPPIPGAR |
Ga0209761_11632312 | 3300026313 | Grasslands Soil | VFVDPDTNLVYVTDGNGGGLTVLKYTGPIPERAPIPGVR |
Ga0209802_10935113 | 3300026328 | Soil | TSPYADSALDRHTREVFVDPDTNLVYVTDGNGGGLTVLKYTGPIPERAPIPGVR |
Ga0209465_102841952 | 3300027874 | Tropical Forest Soil | HTREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPAKPPIPGVR |
Ga0268266_114053462 | 3300028379 | Switchgrass Rhizosphere | REVGQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGAR |
Ga0307290_100018106 | 3300028791 | Soil | YPDWDSDLIYVTDGNGGGLTVLRYTGALPSRPPIPGVR |
Ga0307294_102660892 | 3300028810 | Soil | FGIEVPGQKGRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGALPSRPPIPGVR |
Ga0302263_104460112 | 3300028869 | Fen | QDPDTNLLYVTDGNGGGLTVLRYTGPIPKDPPLPGAR |
Ga0311327_107050121 | 3300029883 | Bog | LSPRFAGPGKADRETREIFQDPDTNLLYVTDGNGGGLTVLRYTGPIPKNPPLPGAR |
Ga0311361_102582071 | 3300029911 | Bog | PRFAGPGKADRETREIFQDPDTNLLYVTDGNGGGLTVLRYTGPIPKNPPLPGAR |
Ga0302276_102835971 | 3300029992 | Bog | QDPDTNLLYVTDGNGGGLTVLRYTGPIPKNPPLPGAR |
Ga0307500_101621401 | 3300031198 | Soil | VPGQKGRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGALPSRPPIPGVR |
Ga0302323_1001282112 | 3300031232 | Fen | DRETREIFQDPDTNLLYVTDGNGGGLTVLRYTGPIPKDPPLPGAR |
Ga0265340_101728862 | 3300031247 | Rhizosphere | KADRETREIFQDPDTNLLYVTDGNGGGLTVLRYTGPIPKDPPLPGAR |
Ga0272432_10165517 | 3300031470 | Rock | PDTNLLYATDGNGGGLTVLRYTGPIPKDPPIPGAR |
Ga0310915_106996021 | 3300031573 | Soil | VPGQKGRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPTKPPTPGVR |
Ga0306921_123168943 | 3300031912 | Soil | GRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPTKPPIPGVR |
Ga0310910_105235472 | 3300031946 | Soil | PFLPREIGYYLSPPYGGGGNVGRHTREVFQDRDTGLVYTTDGNGGGLTVLRWTGPIPEHPPIPGAR |
Ga0307409_1016467331 | 3300031995 | Rhizosphere | VDRQTREVFQDPETNLIYVTDGNGGGLTVLEWTGPIPKHPPIPAAR |
Ga0310902_108733872 | 3300032012 | Soil | FVGYYLSPKYASWENDDRRTREVGQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGA |
Ga0310906_103423792 | 3300032013 | Soil | DPDTSLLYLTDGNGGGLMVLRYTGPMPTRLPIPGAR |
Ga0310911_108100212 | 3300032035 | Soil | PPGGAGRQTRETYQDPDTGLIYMSDGNGGGLTVLRWMGRIPENPPIPGAR |
Ga0318505_101384791 | 3300032060 | Soil | GRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPTKPPTPGVR |
Ga0310890_115420161 | 3300032075 | Soil | GPVNIHTVRHTREIFQDPDTDLLYLTDGNGGGLMVLRYTGPIPTRLPIPGAR |
Ga0307472_1014648102 | 3300032205 | Hardwood Forest Soil | DRHTRDIFQDPDTGLLYVTDGNGGGLMVLRYTGPIPDLPPIPGGR |
Ga0307472_1027743712 | 3300032205 | Hardwood Forest Soil | TREIFQDPDTNLLYATDGNGGGLMVLRYTGPIPERPPIPGGR |
Ga0310812_102102112 | 3300032421 | Soil | PKFVGYYLSPKYASWENDDRRTREVGQDPTTNLIYITDGNGGGLTVLRYTGPIPATPPLPGAR |
Ga0310914_105356802 | 3300033289 | Soil | GQKGRHTREPYPDWDSDLIYVTDGNGGGLTVLRYTGPLPTKPPIPGVR |
Ga0334940_023028_1_138 | 3300034025 | Biocrust | TGRQTREVAQDPDTGLIYVTDGNGGGLTVLRYTGALPPSPMPAAR |
⦗Top⦘ |