Basic Information | |
---|---|
Family ID | F047619 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 149 |
Average Sequence Length | 43 residues |
Representative Sequence | LSLIVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER |
Number of Associated Samples | 132 |
Number of Associated Scaffolds | 149 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 93.96 % |
% of genes from short scaffolds (< 2000 bps) | 94.63 % |
Associated GOLD sequencing projects | 128 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (53.691 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.557 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.530 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.268 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.94% β-sheet: 0.00% Coil/Unstructured: 72.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 149 Family Scaffolds |
---|---|---|
PF06831 | H2TH | 16.11 |
PF00583 | Acetyltransf_1 | 4.03 |
PF05175 | MTS | 4.03 |
PF12277 | DUF3618 | 4.03 |
PF00300 | His_Phos_1 | 4.03 |
PF01381 | HTH_3 | 3.36 |
PF00391 | PEP-utilizers | 3.36 |
PF13577 | SnoaL_4 | 2.01 |
PF07040 | DUF1326 | 2.01 |
PF07332 | Phage_holin_3_6 | 2.01 |
PF01906 | YbjQ_1 | 1.34 |
PF08402 | TOBE_2 | 1.34 |
PF00781 | DAGK_cat | 1.34 |
PF13977 | TetR_C_6 | 1.34 |
PF02702 | KdpD | 1.34 |
PF14310 | Fn3-like | 1.34 |
PF09948 | DUF2182 | 1.34 |
PF00582 | Usp | 0.67 |
PF01614 | IclR | 0.67 |
PF10400 | Vir_act_alpha_C | 0.67 |
PF08281 | Sigma70_r4_2 | 0.67 |
PF02545 | Maf | 0.67 |
PF02775 | TPP_enzyme_C | 0.67 |
PF01326 | PPDK_N | 0.67 |
PF14561 | TPR_20 | 0.67 |
PF05199 | GMC_oxred_C | 0.67 |
PF00392 | GntR | 0.67 |
PF14559 | TPR_19 | 0.67 |
PF00067 | p450 | 0.67 |
PF01161 | PBP | 0.67 |
PF12900 | Pyridox_ox_2 | 0.67 |
PF00296 | Bac_luciferase | 0.67 |
PF09995 | MPAB_Lcp_cat | 0.67 |
PF08241 | Methyltransf_11 | 0.67 |
PF08044 | DUF1707 | 0.67 |
PF09339 | HTH_IclR | 0.67 |
PF07508 | Recombinase | 0.67 |
PF06772 | LtrA | 0.67 |
PF00561 | Abhydrolase_1 | 0.67 |
COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
---|---|---|---|
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 16.11 |
COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 2.68 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 2.01 |
COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 1.34 |
COG2205 | K+-sensing histidine kinase KdpD | Signal transduction mechanisms [T] | 1.34 |
COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.67 |
COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.67 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.67 |
COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.67 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.67 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.67 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.67 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.67 |
COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 53.69 % |
Unclassified | root | N/A | 46.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps__Contig_139761 | Not Available | 1074 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100485279 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300004092|Ga0062389_101807146 | Not Available | 791 | Open in IMG/M |
3300005176|Ga0066679_10725618 | Not Available | 642 | Open in IMG/M |
3300005338|Ga0068868_101098971 | Not Available | 731 | Open in IMG/M |
3300005355|Ga0070671_100390109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1190 | Open in IMG/M |
3300005436|Ga0070713_101720968 | Not Available | 609 | Open in IMG/M |
3300005446|Ga0066686_10870224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
3300005535|Ga0070684_100787389 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300005548|Ga0070665_100978465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 858 | Open in IMG/M |
3300005564|Ga0070664_100044814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3735 | Open in IMG/M |
3300005610|Ga0070763_10180699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1117 | Open in IMG/M |
3300005614|Ga0068856_100457061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1298 | Open in IMG/M |
3300005764|Ga0066903_107389322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 567 | Open in IMG/M |
3300005840|Ga0068870_10110380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1569 | Open in IMG/M |
3300006755|Ga0079222_12481553 | Not Available | 520 | Open in IMG/M |
3300006797|Ga0066659_11607683 | Not Available | 546 | Open in IMG/M |
3300006806|Ga0079220_12033808 | Not Available | 513 | Open in IMG/M |
3300006903|Ga0075426_10316373 | Not Available | 1143 | Open in IMG/M |
3300007265|Ga0099794_10779763 | Not Available | 511 | Open in IMG/M |
3300007982|Ga0102924_1358334 | Not Available | 562 | Open in IMG/M |
3300009551|Ga0105238_11031809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
3300009551|Ga0105238_12539284 | Not Available | 548 | Open in IMG/M |
3300010360|Ga0126372_11909655 | Not Available | 639 | Open in IMG/M |
3300010360|Ga0126372_12277795 | Not Available | 591 | Open in IMG/M |
3300010366|Ga0126379_10922420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 976 | Open in IMG/M |
3300010373|Ga0134128_12616697 | Not Available | 556 | Open in IMG/M |
3300010379|Ga0136449_100131710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 4979 | Open in IMG/M |
3300010379|Ga0136449_100966366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1377 | Open in IMG/M |
3300010379|Ga0136449_102926877 | Not Available | 669 | Open in IMG/M |
3300010379|Ga0136449_103491933 | Not Available | 599 | Open in IMG/M |
3300010396|Ga0134126_12967382 | Not Available | 513 | Open in IMG/M |
3300010876|Ga0126361_10967435 | Not Available | 577 | Open in IMG/M |
3300011119|Ga0105246_10276698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1344 | Open in IMG/M |
3300012204|Ga0137374_10751390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
3300012207|Ga0137381_10847499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 791 | Open in IMG/M |
3300012210|Ga0137378_10504051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1117 | Open in IMG/M |
3300012351|Ga0137386_11244830 | Not Available | 519 | Open in IMG/M |
3300012356|Ga0137371_10655772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 804 | Open in IMG/M |
3300012357|Ga0137384_10214921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1608 | Open in IMG/M |
3300012359|Ga0137385_10967935 | Not Available | 702 | Open in IMG/M |
3300012361|Ga0137360_11131185 | Not Available | 676 | Open in IMG/M |
3300012930|Ga0137407_12307857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 514 | Open in IMG/M |
3300012989|Ga0164305_11473368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
3300013100|Ga0157373_10477161 | Not Available | 899 | Open in IMG/M |
3300013308|Ga0157375_13292683 | Not Available | 538 | Open in IMG/M |
3300014489|Ga0182018_10208762 | Not Available | 1089 | Open in IMG/M |
3300016270|Ga0182036_10477306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 984 | Open in IMG/M |
3300016387|Ga0182040_10372355 | Not Available | 1113 | Open in IMG/M |
3300017822|Ga0187802_10236220 | Not Available | 706 | Open in IMG/M |
3300017942|Ga0187808_10593316 | Not Available | 515 | Open in IMG/M |
3300017959|Ga0187779_10379539 | Not Available | 918 | Open in IMG/M |
3300017961|Ga0187778_10621133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 726 | Open in IMG/M |
3300017974|Ga0187777_11198491 | Not Available | 555 | Open in IMG/M |
3300018007|Ga0187805_10339819 | Not Available | 693 | Open in IMG/M |
3300018034|Ga0187863_10163017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1243 | Open in IMG/M |
3300018042|Ga0187871_10294951 | Not Available | 898 | Open in IMG/M |
3300018062|Ga0187784_10427063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 1070 | Open in IMG/M |
3300019890|Ga0193728_1118895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1200 | Open in IMG/M |
3300019890|Ga0193728_1318694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 578 | Open in IMG/M |
3300020170|Ga0179594_10238254 | Not Available | 685 | Open in IMG/M |
3300020583|Ga0210401_10811244 | Not Available | 795 | Open in IMG/M |
3300021374|Ga0213881_10573794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Subtercola → Subtercola boreus | 513 | Open in IMG/M |
3300021388|Ga0213875_10416770 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300021401|Ga0210393_11088221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
3300021402|Ga0210385_10849418 | Not Available | 700 | Open in IMG/M |
3300021406|Ga0210386_10877770 | Not Available | 768 | Open in IMG/M |
3300021475|Ga0210392_10750062 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300021477|Ga0210398_10640527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
3300021478|Ga0210402_11198807 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300021559|Ga0210409_11481728 | Not Available | 554 | Open in IMG/M |
3300024254|Ga0247661_1053707 | Not Available | 740 | Open in IMG/M |
3300024310|Ga0247681_1029394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 810 | Open in IMG/M |
3300025134|Ga0207416_1060337 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300025911|Ga0207654_10497260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 861 | Open in IMG/M |
3300025921|Ga0207652_11060718 | Not Available | 710 | Open in IMG/M |
3300025929|Ga0207664_11555441 | Not Available | 583 | Open in IMG/M |
3300025941|Ga0207711_11870358 | Not Available | 543 | Open in IMG/M |
3300026498|Ga0257156_1052190 | Not Available | 842 | Open in IMG/M |
3300026551|Ga0209648_10349097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1019 | Open in IMG/M |
3300027662|Ga0208565_1115177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 801 | Open in IMG/M |
3300027787|Ga0209074_10115587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 925 | Open in IMG/M |
3300027853|Ga0209274_10158235 | Not Available | 1143 | Open in IMG/M |
3300027879|Ga0209169_10233945 | Not Available | 962 | Open in IMG/M |
3300027911|Ga0209698_10978211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
3300028775|Ga0302231_10225273 | Not Available | 784 | Open in IMG/M |
3300028775|Ga0302231_10244965 | Not Available | 750 | Open in IMG/M |
3300028792|Ga0307504_10254416 | Not Available | 644 | Open in IMG/M |
3300028808|Ga0302228_10262187 | Not Available | 778 | Open in IMG/M |
3300028828|Ga0307312_10456882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 841 | Open in IMG/M |
3300029701|Ga0222748_1125394 | Not Available | 522 | Open in IMG/M |
3300029882|Ga0311368_10984306 | Not Available | 558 | Open in IMG/M |
3300029944|Ga0311352_10726192 | Not Available | 782 | Open in IMG/M |
3300030056|Ga0302181_10414857 | Not Available | 579 | Open in IMG/M |
3300030490|Ga0302184_10016222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4136 | Open in IMG/M |
3300030503|Ga0311370_12006365 | Not Available | 578 | Open in IMG/M |
3300030524|Ga0311357_11814170 | Not Available | 507 | Open in IMG/M |
3300031028|Ga0302180_10271115 | Not Available | 885 | Open in IMG/M |
3300031543|Ga0318516_10110135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 1562 | Open in IMG/M |
3300031544|Ga0318534_10062553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 2098 | Open in IMG/M |
3300031546|Ga0318538_10183829 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300031549|Ga0318571_10026305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 1576 | Open in IMG/M |
3300031668|Ga0318542_10156610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 1135 | Open in IMG/M |
3300031708|Ga0310686_100096165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
3300031708|Ga0310686_103364429 | Not Available | 847 | Open in IMG/M |
3300031713|Ga0318496_10741378 | Not Available | 541 | Open in IMG/M |
3300031713|Ga0318496_10838850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
3300031723|Ga0318493_10521629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
3300031736|Ga0318501_10247618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 942 | Open in IMG/M |
3300031748|Ga0318492_10803808 | Not Available | 506 | Open in IMG/M |
3300031765|Ga0318554_10509458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
3300031769|Ga0318526_10292437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
3300031769|Ga0318526_10395931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
3300031769|Ga0318526_10489843 | Not Available | 502 | Open in IMG/M |
3300031770|Ga0318521_10656641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 636 | Open in IMG/M |
3300031771|Ga0318546_10218358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1306 | Open in IMG/M |
3300031782|Ga0318552_10235015 | Not Available | 929 | Open in IMG/M |
3300031782|Ga0318552_10266974 | Not Available | 869 | Open in IMG/M |
3300031797|Ga0318550_10280162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 809 | Open in IMG/M |
3300031798|Ga0318523_10241728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
3300031798|Ga0318523_10578657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 553 | Open in IMG/M |
3300031819|Ga0318568_10191320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 1260 | Open in IMG/M |
3300031819|Ga0318568_10825041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
3300031821|Ga0318567_10677342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
3300031823|Ga0307478_11248496 | Not Available | 618 | Open in IMG/M |
3300031832|Ga0318499_10356576 | Not Available | 562 | Open in IMG/M |
3300031897|Ga0318520_10409354 | Not Available | 830 | Open in IMG/M |
3300031910|Ga0306923_11252089 | Not Available | 790 | Open in IMG/M |
3300031912|Ga0306921_12494857 | Not Available | 537 | Open in IMG/M |
3300031947|Ga0310909_10668312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 865 | Open in IMG/M |
3300032001|Ga0306922_12426792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
3300032009|Ga0318563_10182109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 1131 | Open in IMG/M |
3300032010|Ga0318569_10616630 | Not Available | 505 | Open in IMG/M |
3300032052|Ga0318506_10178419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
3300032055|Ga0318575_10269150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 861 | Open in IMG/M |
3300032063|Ga0318504_10512690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
3300032065|Ga0318513_10178530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1019 | Open in IMG/M |
3300032067|Ga0318524_10577006 | Not Available | 592 | Open in IMG/M |
3300032089|Ga0318525_10014517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3638 | Open in IMG/M |
3300032089|Ga0318525_10035131 | All Organisms → cellular organisms → Bacteria | 2458 | Open in IMG/M |
3300032089|Ga0318525_10107223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1426 | Open in IMG/M |
3300032089|Ga0318525_10439859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
3300032160|Ga0311301_10548175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura formosensis | 1692 | Open in IMG/M |
3300032261|Ga0306920_104102439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aliadipatigenens | 527 | Open in IMG/M |
3300032893|Ga0335069_10005759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 18153 | Open in IMG/M |
3300032896|Ga0335075_10753964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 923 | Open in IMG/M |
3300032898|Ga0335072_10046629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5868 | Open in IMG/M |
3300033412|Ga0310810_11231826 | Not Available | 601 | Open in IMG/M |
3300034163|Ga0370515_0044486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1971 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.56% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.38% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.37% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.03% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.68% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.01% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.01% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.01% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.01% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.01% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.01% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.34% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.34% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.34% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.34% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.34% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.34% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.67% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.67% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.67% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.67% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.67% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.67% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.67% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_02551650 | 2199352024 | Soil | ALSLLVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER |
JGIcombinedJ26739_1004852791 | 3300002245 | Forest Soil | IRAAVAAGLSLVALHLIPGTAAAPAEVFGLIWWFVLTGRKDLAPPAER* |
Ga0062389_1018071461 | 3300004092 | Bog Forest Soil | AVAAALSLAVLQLIPGTAAALADITGLMTWFVLTGRRDLAPGRKW* |
Ga0066679_107256182 | 3300005176 | Soil | VLSLLVLRLIPGTAAAPADVFGLGLWFVLTGRKDLAPPPER* |
Ga0068868_1010989711 | 3300005338 | Miscanthus Rhizosphere | LSLIVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER* |
Ga0070671_1003901093 | 3300005355 | Switchgrass Rhizosphere | LRAIIAAVLSLIVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER* |
Ga0070713_1017209681 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AAALALVVLQAIPGTPAAPADVLGLVLWFVVTGRRDLAPPPER* |
Ga0066686_108702242 | 3300005446 | Soil | IIAAVLSLLVLQLIPGTPAAPADVLALVLWFVLTGRKDLAPPPER* |
Ga0070684_1007873891 | 3300005535 | Corn Rhizosphere | VIAAALSLLVLHMIPGSAAAPADVFGLALWFVLSGRRDLAPPPER* |
Ga0070665_1009784651 | 3300005548 | Switchgrass Rhizosphere | LALRAIIVGALSLIVLQLIPGSPAAPADILGLIIWFMLTGRKDLAPPPER* |
Ga0070664_1000448145 | 3300005564 | Corn Rhizosphere | QLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER* |
Ga0070763_101806991 | 3300005610 | Soil | LSLAVLALIPGAPAAPADVAGVIVWFVLTGRRDLAPPPER* |
Ga0068856_1004570611 | 3300005614 | Corn Rhizosphere | AALSLLVLRTIPGSPAAPADVLGLILWFVLTGRRDLAPPPER* |
Ga0066903_1073893222 | 3300005764 | Tropical Forest Soil | LGVLALIPGQPAGPADIAAVIIWFVLTGRKDLAPPPER* |
Ga0068870_101103801 | 3300005840 | Miscanthus Rhizosphere | AIIVGALSLIVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER* |
Ga0079222_124815532 | 3300006755 | Agricultural Soil | LRAIIAAALSLIVLQLIPGSPAAPADILGLIIWFMLTGRKDLAPPPDR* |
Ga0066659_116076832 | 3300006797 | Soil | SLVVLALIPGTAAAPADVLGLGLWFVLTARSDLAPPPGR* |
Ga0079220_120338081 | 3300006806 | Agricultural Soil | ATLLSLVVLSLIPASAAAPADVFGLGLWFVLTARSDLAPPLGR* |
Ga0075426_103163732 | 3300006903 | Populus Rhizosphere | LALRAIIAAVLSLAVLQLIPGSPAAPADVLGLGLWFVLTARADLGPPPGR* |
Ga0099794_107797631 | 3300007265 | Vadose Zone Soil | VLSLLVLNLIPGQPAAPADILGLIIWFVLTGRKDLAPPPER* |
Ga0102924_13583342 | 3300007982 | Iron-Sulfur Acid Spring | GAAAAVAAGVSLVLLHLIRGTAAAAADVFGSIWWFVLTGRRDLAPPPER* |
Ga0105238_110318091 | 3300009551 | Corn Rhizosphere | IAAALSLIVLQLIPGSPAAPADILGLIIWFMLTGRKDLAPPPER* |
Ga0105238_125392842 | 3300009551 | Corn Rhizosphere | VLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER* |
Ga0126372_119096551 | 3300010360 | Tropical Forest Soil | AALSLLVLNLIPGSPAAPADLLGLAIWFVLTGRHDLAPPPER* |
Ga0126372_122777951 | 3300010360 | Tropical Forest Soil | ALSLIVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER* |
Ga0126379_109224202 | 3300010366 | Tropical Forest Soil | RAALAAGLSLAVLALIPGQAAAPADVAILITWFTLTGRKDLASPPEQ* |
Ga0134128_126166972 | 3300010373 | Terrestrial Soil | AIIAAMLSLIVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER* |
Ga0136449_1001317103 | 3300010379 | Peatlands Soil | VLSLIVLQLIPGTAAAPADICGLITWFVLSGRRDLAPPPER* |
Ga0136449_1009663664 | 3300010379 | Peatlands Soil | LRAVIAAVLSLAVLQLIPGTAAAPADITGLIVWFVLTARRDLAPPSER* |
Ga0136449_1029268772 | 3300010379 | Peatlands Soil | VLALVPGQPAAPAGITGLIIWFVLTGRRDLAPPPER* |
Ga0136449_1034919332 | 3300010379 | Peatlands Soil | AALLSLAVLQLIPGTAAAPADVGGLILWFVLTGRRDLAPPPER* |
Ga0134126_129673821 | 3300010396 | Terrestrial Soil | LRAIIAAVLSVVVLALIPGSAAGPADVAGLGLWFVLTARSDLAPPPGR* |
Ga0126361_109674351 | 3300010876 | Boreal Forest Soil | IRAAIAAALSLAVLQLIPGTAAAPADITGLIIWFVLTGRRDLAPRPER* |
Ga0105246_102766983 | 3300011119 | Miscanthus Rhizosphere | AIIVGALSLIVLQLIPGSPAAPADILGLIIWFMLTGRKDLAPPPER* |
Ga0137374_107513902 | 3300012204 | Vadose Zone Soil | IIAAALSLIVLRLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER* |
Ga0137381_108474992 | 3300012207 | Vadose Zone Soil | AAVLSLLVLQLIPGTPAAPADVLALVLWFVLTGRKDLAPPPER* |
Ga0137378_105040514 | 3300012210 | Vadose Zone Soil | VVLQLIPGTPAAPADVLGLVLWFVLTGRRDLAPPPER* |
Ga0137386_112448303 | 3300012351 | Vadose Zone Soil | VRAALAAVLSLLVLNLIPGQPAAPADILGLAIWFVLTGRRDLAPPPER* |
Ga0137371_106557721 | 3300012356 | Vadose Zone Soil | VLRLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER* |
Ga0137384_102149211 | 3300012357 | Vadose Zone Soil | AAVLSLIVLQLIPGPPAAPADVLALVLWFVLTGRKDLAPPPER* |
Ga0137385_109679351 | 3300012359 | Vadose Zone Soil | AIIAAVLSLVVLQLIPGTPAAPADVLGLVLWFVLTGRRVLAPPPER* |
Ga0137360_111311852 | 3300012361 | Vadose Zone Soil | LSRAVIAAVLSLLVLQLIPGTAAAPADVFGLALWFVLTGRKDLAPPPER* |
Ga0137407_123078572 | 3300012930 | Vadose Zone Soil | RAIIAAVLSLLVLQLIPGTPAAPADVLALVLWFVLTGRKDLAPPPER* |
Ga0164305_114733682 | 3300012989 | Soil | QLIPGTPAAPADVLALVLWFVLTGRKDLAPPPER* |
Ga0157373_104771612 | 3300013100 | Corn Rhizosphere | MHLAIRGVIAAALSLLVLHMIPGSAAAPADVFGLALWFVLSGRRDLAPPPER* |
Ga0157375_132926832 | 3300013308 | Miscanthus Rhizosphere | RAFIAAVLSLVVLQAIPGTPAAPADVLALVLWFVLTGRKDLAPPPER* |
Ga0182018_102087622 | 3300014489 | Palsa | RLAIRALIGAAASLGVLALVPGQPAAPAAITMIITWFVLTGRRDLAPPPER* |
Ga0182036_104773062 | 3300016270 | Soil | AAVAGLAVLALIPGTPAAPADVGGLVLWFVLTGRRDLAPPPER |
Ga0182040_103723554 | 3300016387 | Soil | RLAIRALIAAGLALIVLQLIPGTPAAPADILGLILWFVLTGRKDLAPPPDR |
Ga0187802_102362202 | 3300017822 | Freshwater Sediment | SLAVLSLIPGDPAAPADVAVLITWFVLTGRKDLAPPPER |
Ga0187808_105933161 | 3300017942 | Freshwater Sediment | IAAGLALFVLWLIPGTAAAPADITGLILWFTLTARSDLAPPPRR |
Ga0187779_103795392 | 3300017959 | Tropical Peatland | LSLAVLALIPGQPAAPADVAIVITWFALTGRKDLAPPPER |
Ga0187778_106211331 | 3300017961 | Tropical Peatland | LTVLALIPGQPAAPADVAILITWFALTGRKDLAPPPER |
Ga0187777_111984911 | 3300017974 | Tropical Peatland | AALLSLVVLWLIPGSPAAPADVGGLILWFALTARSDLAPPPRH |
Ga0187805_103398191 | 3300018007 | Freshwater Sediment | RAMIAAVLSLVVLQLIPGTAAAPADIGGLIVWFVLTGRRDLAPPPER |
Ga0187863_101630171 | 3300018034 | Peatland | AAIAAALSLAILQLIPGTAAAPADITGMLTWFVLTGRRDLAPRPER |
Ga0187871_102949513 | 3300018042 | Peatland | LALIPGTTAAPADITGLITWFALTGRRDLAPPPER |
Ga0187784_104270631 | 3300018062 | Tropical Peatland | LLRAAVAAGLSLLVLHLIPGSPAATADVFGLVLWFVLTGRRDLAPPPER |
Ga0193728_11188953 | 3300019890 | Soil | LSLIVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER |
Ga0193728_13186941 | 3300019890 | Soil | AVLSLLVLQLIPGTPAAPADVLALTLWFVLTGRKDLAPPPER |
Ga0179594_102382542 | 3300020170 | Vadose Zone Soil | SLMVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER |
Ga0210401_108112441 | 3300020583 | Soil | LRLLIRGAAAAALCLVVLHLIPGTAAAPADVFGLTWWFVLTGRKDLAPPPER |
Ga0213881_105737942 | 3300021374 | Exposed Rock | AVAAALALLVLNLIPGQPAAPADITLLVTWFLLTGRRDLAPPPPR |
Ga0213875_104167701 | 3300021388 | Plant Roots | LLVRAAVAAVLSLAVLQLIPGQPAALADVGGLILWFLLTGRRDLAPPPER |
Ga0210393_110882211 | 3300021401 | Soil | RAAVAAGVSVVLLHLIPGTAAAAADVFGSIWWFVLTGRRDLAPPPER |
Ga0210385_108494182 | 3300021402 | Soil | VLHLIPGTAAAPADIFGLTWWFVLTGRKDLAPPPER |
Ga0210386_108777701 | 3300021406 | Soil | AVAAALSLVVLHLIPGTAAAPADVFGLTWWFVLTGRKDLAPPPER |
Ga0210392_107500621 | 3300021475 | Soil | VIAAVLSLAVLQLIPGTAAAPADVTGLIIWFVLTGRRDLAPPPER |
Ga0210398_106405272 | 3300021477 | Soil | AVIAAALALVVLQLIPGTTAAPADITGVITWFVLTGRRDLAPPPER |
Ga0210402_111988072 | 3300021478 | Soil | LAVLQLIPATAAAPADVAGLIIWFVLTGRRDLAPPPER |
Ga0210409_114817281 | 3300021559 | Soil | LRLIPGTAAAPADVFGLTWWFVLTGRKDLAPPPER |
Ga0247661_10537072 | 3300024254 | Soil | AIIVGALSLIVLQLIPGSPAAPADILGLIIWFMLTGRKDLAPPPER |
Ga0247681_10293942 | 3300024310 | Soil | GALSLIVLQLIPGSPAAPADILGLIIWFMLTGRKDLAPPPER |
Ga0207416_10603373 | 3300025134 | Iron-Sulfur Acid Spring | GVSLVLLHLIRGTAAAAADVFGSIWWFVLTGRRDLAPPPER |
Ga0207654_104972602 | 3300025911 | Corn Rhizosphere | AALSLIVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER |
Ga0207652_110607181 | 3300025921 | Corn Rhizosphere | SLIVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER |
Ga0207664_115554411 | 3300025929 | Agricultural Soil | RPLHLALRAIIVGALSLIVLQLIPGSPAAPADILGLIIWFMLTGRKDLAPPPER |
Ga0207711_118703582 | 3300025941 | Switchgrass Rhizosphere | ALSLIVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER |
Ga0257156_10521901 | 3300026498 | Soil | RVLNLIPGQPAAPADILGLIIWFVLTGRKDLAPPPER |
Ga0209648_103490972 | 3300026551 | Grasslands Soil | VALTVLQLIPGTAAAAADVFGMIWWFVLTGRKDLPPPPER |
Ga0208565_11151771 | 3300027662 | Peatlands Soil | AAIAIGLSLAVLALVPGQPAAPADVAVLITWFALTGRKDLAPPPER |
Ga0209074_101155872 | 3300027787 | Agricultural Soil | IAAALSLIVLQLIPGSPAAPADILGLIIWFMLTGRKDLAPPPDR |
Ga0209274_101582353 | 3300027853 | Soil | SLVVLHLIPGTAAAPADVFGLTWWFVLTGRKDLAPPPER |
Ga0209169_102339452 | 3300027879 | Soil | VVLHLIPGTAAAPADIFGLTWWFVLTGRKDLAPPPER |
Ga0209698_109782111 | 3300027911 | Watersheds | SLAVLALIPGDPAAPADVAVLITWFVLTGRKDLASPPER |
Ga0302231_102252731 | 3300028775 | Palsa | VLSLVVLQLIPGTTAAPADITGLITWFALTGRRDLAPPPER |
Ga0302231_102449652 | 3300028775 | Palsa | LSLVVLHLIPGTAAAPADVGGLIWWFVLTGRKDLAPPPER |
Ga0307504_102544162 | 3300028792 | Soil | SLVVLQLIPGSPAVPADILGLIIWFVLTGRKDLAPPPER |
Ga0302228_102621873 | 3300028808 | Palsa | ALIAALVSLAVLRLIPGQPAAPADIVGVILWFVLTGRSDLAPPPRR |
Ga0307312_104568821 | 3300028828 | Soil | RAIIAAALSLIVLQLIPGSPAVPADILGLIIWFVLTGRKDLAPPPER |
Ga0222748_11253941 | 3300029701 | Soil | RLLVRGAVAAALSLVVLHLITGTAAAPADVFGLTWWFVLTGRKDLAPPPER |
Ga0311368_109843062 | 3300029882 | Palsa | AALSLVVLHLIPGTAAAPADVGGLIWWFVLTGRKDLAPPPER |
Ga0311352_107261921 | 3300029944 | Palsa | LAIRALIAALVSLAVLRLIPGQPAAPADIVGVILWFVLTGRSDLAPPPRR |
Ga0302181_104148572 | 3300030056 | Palsa | AAITAGLCLAVLTLIPGQPAAPADVAGLILWFTLTGRRDVAPPPER |
Ga0302184_100162223 | 3300030490 | Palsa | LRAVIAVALALVIVRLIPGTAAAPADILGVILWFVLTGRRDLAPRPER |
Ga0311370_120063652 | 3300030503 | Palsa | LLIRAMIVAVLYLVVLALIPGTTAAPADLTGLLTWFVLTGRRDLAPPPER |
Ga0311357_118141701 | 3300030524 | Palsa | GHLLLRAVIAAALALIVLQLIPGTTAAPADITGVITWFVLTGRRDLAPPPER |
Ga0302180_102711153 | 3300031028 | Palsa | AVITAALALVVLALIPGTTAAPADITGLITWFALTGRRDLAPPPER |
Ga0318516_101101353 | 3300031543 | Soil | LFLRAVIAAALSLLVLNLIPGSPAAPADILGLAIWFVLTGRHDLAPPVQHVP |
Ga0318534_100625531 | 3300031544 | Soil | SLAVLALIPGTAAAPADVGGLVVWFVLTGRRDLAAPPER |
Ga0318538_101838292 | 3300031546 | Soil | HQQGQGRADVAAALSLLVLHLIPGTAAAPADVFGLIWWFVLTGRKDLAPPPER |
Ga0318571_100263051 | 3300031549 | Soil | GRLFLRAVIAAALSLLVLNLIPGSPAAPADILGLAIWFVLTGRHDLAPPVQHVP |
Ga0318542_101566102 | 3300031668 | Soil | VAVLASLAVLALIPGTAAAPADVGGLVVWFVLTGRRDLAPPPER |
Ga0310686_1000961652 | 3300031708 | Soil | LALIPGTPAAPADVAGVIVWFVLTGRRDLAPPPER |
Ga0310686_1033644291 | 3300031708 | Soil | ALSLVVLHLIPGTAAAPADVFGLTWWFVLTGRKDLAPPPER |
Ga0318496_107413782 | 3300031713 | Soil | LYLIPGTAAAPADMFGLIWWFVLTGRKDLAPPPER |
Ga0318496_108388502 | 3300031713 | Soil | SLAVLALIPGQPAAPADIAIVITWFVLTGRKDLAPPPER |
Ga0318493_105216291 | 3300031723 | Soil | SLSLVVLQLIPGTAAAPADVFGLIWWFVLTGRKDLAPPPER |
Ga0318501_102476181 | 3300031736 | Soil | LIVLQLIPGTPAAPADILGLILWFVLTGRKDLAPPPDR |
Ga0318492_108038082 | 3300031748 | Soil | ALVVLQLIPGTPAAPADVLGLIIWFVLTGRKDLAPPPER |
Ga0318554_105094581 | 3300031765 | Soil | ALIVLQLIPGTPAAPADILGLILWFVLTGRKDLAPPPER |
Ga0318526_102924373 | 3300031769 | Soil | LAVLALIPGTAAAPADITGLVIWFVLTGRKDLAPPAER |
Ga0318526_103959311 | 3300031769 | Soil | SLAVLQLIPGSPAAAADITGLVLWFLLTGRSDLAPPPEQ |
Ga0318526_104898431 | 3300031769 | Soil | VLNLIPGSPAAPADILGLAIWFVLTGRHDLAPPVQHVP |
Ga0318521_106566412 | 3300031770 | Soil | IRAGVAAGLSLAVLALIPGQPAAPADVGGLIAWFVLTGRRDLAPPPER |
Ga0318546_102183581 | 3300031771 | Soil | AVIAAALSLLVLNLIPGSPAAPADILGLAIWFVLTGRHDLAPPVQHVP |
Ga0318552_102350154 | 3300031782 | Soil | LQLIPGTPAAPADVLGLIIWFVLTGRKDLAPPPER |
Ga0318552_102669741 | 3300031782 | Soil | VAASLSLVVLQLIPGTAAAPADVFGLIWWFVLTGRKDLAPPPER |
Ga0318550_102801621 | 3300031797 | Soil | AVAGLAVLALIPGTPAAPADVGALVVWFVLTGRRDLAPPPER |
Ga0318523_102417283 | 3300031798 | Soil | IVLQLIPGTPAAPADILGLILWFVLTGRKDLAPPAER |
Ga0318523_105786572 | 3300031798 | Soil | VLASLAVLALIPGTAAAPADVGGLVVWFVLTGRRDLAPPPER |
Ga0318568_101913202 | 3300031819 | Soil | AVLALIPGTAAAPADVGGLVVWFVLTGRRDLAAPPER |
Ga0318568_108250411 | 3300031819 | Soil | AVLALIPGQPAAPADIAIVITWFVLTGRKDLAPPPER |
Ga0318567_106773421 | 3300031821 | Soil | ALIVLQLIPGTPAAPADILGLILWFVLTGRKDLAPPAER |
Ga0307478_112484961 | 3300031823 | Hardwood Forest Soil | LIRGAVAAALSLVVLRLIPGTAAAPADVFGLTWWFVLTGRKDLAPPPER |
Ga0318499_103565761 | 3300031832 | Soil | AVLALIPGTAAAPADVGGLVVWFVLTGRRDLAPPPER |
Ga0318520_104093541 | 3300031897 | Soil | VLYLIPGTAAAPADMFGLIWWFVLTGRKDLAPPPER |
Ga0306923_112520892 | 3300031910 | Soil | VLALIPGQPAAPADVGGLIVWFVLTGRRDLAPPPER |
Ga0306921_124948571 | 3300031912 | Soil | LSVLALTLLPGRPAPAAVLALITWFVLTGRHDLAPPPDR |
Ga0310909_106683122 | 3300031947 | Soil | GLSLAVLALIPGQAAAPADVAILITWFTLTGRKDLAPPPEQ |
Ga0306922_124267922 | 3300032001 | Soil | RAVIAAALSLLVLNLIPGQPAAPADVFGLILWFVLTGRKDLAPPPER |
Ga0318563_101821092 | 3300032009 | Soil | GLAVLALIPGTPAAPADVGGLVVWFVLTGRRDLAPPPER |
Ga0318569_106166301 | 3300032010 | Soil | AGVAVLASLAVLALIPGTAAAPADVGGLVVWFVLTGRRDLAAPPER |
Ga0318506_101784193 | 3300032052 | Soil | LQLIPGTPAAPADILGLILWFVLTGRKDLAPPPDR |
Ga0318575_102691501 | 3300032055 | Soil | LSLLVLNLIPGQPAAPADVFGLILWFVLTGRKDLAPPPER |
Ga0318504_105126901 | 3300032063 | Soil | IRAALAAGLSLAVLALIPGQAAAPADVAILITWFTLTGRKDLAPPPEQ |
Ga0318513_101785303 | 3300032065 | Soil | ALIVLQLIPGTPAAPADILGLILWFVLTGRKDLAPPPDR |
Ga0318524_105770062 | 3300032067 | Soil | VLAAVLSLAVLQLIPGSPAAPADITALIVWFVLTGRKDLAPPPER |
Ga0318525_100145176 | 3300032089 | Soil | SLAVLALIPGTAAAPADITGLVIWFVLTGRKDLAPPAER |
Ga0318525_100351314 | 3300032089 | Soil | LLIRAAVAAALSLAVLQLIPGSPAAAADITGLVLWFLLTGRSDLAPPPEQ |
Ga0318525_101072231 | 3300032089 | Soil | VVLHLIPQTAAAPADVFGLIWWFVLTGRKDLAPPPER |
Ga0318525_104398591 | 3300032089 | Soil | SLLVLNLIPGQPAAPADVFGLILWFVLTGRKDLAPPPER |
Ga0311301_105481751 | 3300032160 | Peatlands Soil | LAAGLSLAVLALIPGQPAAPADVAVLITWFALSGRKDLAPPPER |
Ga0306920_1041024391 | 3300032261 | Soil | LAAVLSLAVLQLIPGQPAALADVGGLILWFLLTSRRDLAPPPER |
Ga0335069_100057598 | 3300032893 | Soil | VALLRGLIASVLSLVVLQLIPGTPAAPADITGLLVWFALTGRKDLAPRA |
Ga0335075_107539642 | 3300032896 | Soil | AAGLSLAVLALVPGQPAAPADVAIVITWFVLTGRKDLAPPPGQ |
Ga0335072_100466291 | 3300032898 | Soil | GLSLAVLAVVPGQPMAVADVATLITWFLVTGRKDLAPPPER |
Ga0310810_112318262 | 3300033412 | Soil | LRAIIAAVLSLIVLQLIPGSPAAPADILGLIIWFVLTGRKDLAPPPER |
Ga0370515_0044486_1849_1971 | 3300034163 | Untreated Peat Soil | LSLAVLNLSPGRPAEPAVITGLIIWFVLTSRGDLAPPPGQ |
⦗Top⦘ |