NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F047424

Metagenome Family F047424

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047424
Family Type Metagenome
Number of Sequences 149
Average Sequence Length 88 residues
Representative Sequence MPPAVKDKSKKAAALPAKAPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLER
Number of Associated Samples 110
Number of Associated Scaffolds 149

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.33 %
% of genes near scaffold ends (potentially truncated) 97.99 %
% of genes from short scaffolds (< 2000 bps) 84.56 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.987 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(32.215 % of family members)
Environment Ontology (ENVO) Unclassified
(42.282 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.376 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.97%    β-sheet: 6.56%    Coil/Unstructured: 61.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 149 Family Scaffolds
PF12728HTH_17 39.60
PF13657Couple_hipA 4.03
PF04966OprB 1.34
PF07693KAP_NTPase 1.34
PF03432Relaxase 1.34
PF07804HipA_C 1.34
PF01656CbiA 0.67
PF00202Aminotran_3 0.67
PF14319Zn_Tnp_IS91 0.67
PF02384N6_Mtase 0.67
PF00126HTH_1 0.67
PF03466LysR_substrate 0.67
PF03358FMN_red 0.67
PF13683rve_3 0.67
PF00563EAL 0.67
PF05101VirB3 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 149 Family Scaffolds
COG3550Serine/threonine protein kinase HipA, toxin component of the HipAB toxin-antitoxin moduleSignal transduction mechanisms [T] 1.34
COG3659Carbohydrate-selective porin OprBCell wall/membrane/envelope biogenesis [M] 1.34
COG3843Type IV secretory pathway, VirD2 component (relaxase)Intracellular trafficking, secretion, and vesicular transport [U] 1.34
COG4928Predicted P-loop ATPase, KAP-likeGeneral function prediction only [R] 1.34
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.67
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.67
COG3702Type IV secretory pathway, VirB3 componentIntracellular trafficking, secretion, and vesicular transport [U] 0.67
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.67
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.67

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.99 %
UnclassifiedrootN/A2.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_104004073All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300001213|JGIcombinedJ13530_105304584All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300004092|Ga0062389_101050265All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300004152|Ga0062386_101219733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae625Open in IMG/M
3300009635|Ga0116117_1078137All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300009665|Ga0116135_1057694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1358Open in IMG/M
3300009762|Ga0116130_1314936All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300010048|Ga0126373_12254806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300014153|Ga0181527_1114644All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1238Open in IMG/M
3300014158|Ga0181521_10117144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1595Open in IMG/M
3300014160|Ga0181517_10382781All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300014160|Ga0181517_10486315All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300014161|Ga0181529_10318544All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae862Open in IMG/M
3300014169|Ga0181531_10438004All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300014199|Ga0181535_10395867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii810Open in IMG/M
3300014201|Ga0181537_10223603All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300014201|Ga0181537_10404734All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300014201|Ga0181537_10546352All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300014489|Ga0182018_10461405All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae675Open in IMG/M
3300014491|Ga0182014_10489050All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae604Open in IMG/M
3300014491|Ga0182014_10499967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300014492|Ga0182013_10597391All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae563Open in IMG/M
3300014494|Ga0182017_10311852All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300014494|Ga0182017_10689941All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300014496|Ga0182011_10887021All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae556Open in IMG/M
3300014496|Ga0182011_11032888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300014498|Ga0182019_10970456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae616Open in IMG/M
3300014498|Ga0182019_11169858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300014499|Ga0182012_10123737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1903Open in IMG/M
3300014499|Ga0182012_10272923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1150Open in IMG/M
3300014655|Ga0181516_10092823All Organisms → cellular organisms → Bacteria1522Open in IMG/M
3300014657|Ga0181522_10814739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300014838|Ga0182030_10104851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3872Open in IMG/M
3300014838|Ga0182030_10412013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1400Open in IMG/M
3300014838|Ga0182030_10784834All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium875Open in IMG/M
3300014839|Ga0182027_10293736All Organisms → cellular organisms → Bacteria → Acidobacteria1842Open in IMG/M
3300014839|Ga0182027_11372135All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300014839|Ga0182027_11833029All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae586Open in IMG/M
3300014839|Ga0182027_12022150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae551Open in IMG/M
3300017938|Ga0187854_10088723All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300017988|Ga0181520_10405295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae988Open in IMG/M
3300017988|Ga0181520_11096639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300018008|Ga0187888_1165240All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300018025|Ga0187885_10263821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae785Open in IMG/M
3300018026|Ga0187857_10294350All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae742Open in IMG/M
3300018034|Ga0187863_10294262All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae903Open in IMG/M
3300018042|Ga0187871_10218568All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300018043|Ga0187887_10043141All Organisms → cellular organisms → Bacteria2793Open in IMG/M
3300018044|Ga0187890_10708736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300018047|Ga0187859_10232445All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae987Open in IMG/M
3300018057|Ga0187858_10945184All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300019787|Ga0182031_1287114All Organisms → cellular organisms → Bacteria → Acidobacteria1684Open in IMG/M
3300019788|Ga0182028_1462660All Organisms → cellular organisms → Bacteria → Acidobacteria2115Open in IMG/M
3300022861|Ga0224528_1010287All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2931Open in IMG/M
3300022861|Ga0224528_1063692All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300022877|Ga0224527_1019053All Organisms → cellular organisms → Bacteria1677Open in IMG/M
(restricted) 3300023060|Ga0224519_1032777All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300023068|Ga0224554_1132487All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300023068|Ga0224554_1140077All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300023088|Ga0224555_1010486All Organisms → cellular organisms → Bacteria5820Open in IMG/M
3300023088|Ga0224555_1028487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2425Open in IMG/M
3300023090|Ga0224558_1033574All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2304Open in IMG/M
3300023091|Ga0224559_1164306All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300023101|Ga0224557_1035365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2477Open in IMG/M
3300023258|Ga0224535_1125285All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300025434|Ga0208690_1022743Not Available1065Open in IMG/M
3300025612|Ga0208691_1162242All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300026456|Ga0255351_1029203All Organisms → cellular organisms → Bacteria1290Open in IMG/M
3300026456|Ga0255351_1030648All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica1244Open in IMG/M
3300027609|Ga0209221_1107042All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae716Open in IMG/M
3300027634|Ga0209905_1041441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300027634|Ga0209905_1042790All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300027634|Ga0209905_1066006Not Available589Open in IMG/M
3300028068|Ga0255355_1000497All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae23320Open in IMG/M
3300028082|Ga0255352_1012901All Organisms → cellular organisms → Bacteria1793Open in IMG/M
3300028082|Ga0255352_1035270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae775Open in IMG/M
3300028082|Ga0255352_1045779All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300028084|Ga0255356_1040938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae876Open in IMG/M
3300028090|Ga0255349_1027535Not Available1295Open in IMG/M
3300028268|Ga0255348_1054745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300028552|Ga0302149_1129836All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae653Open in IMG/M
3300028565|Ga0302145_10218456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae635Open in IMG/M
3300028565|Ga0302145_10290818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300028566|Ga0302147_10255360All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300028572|Ga0302152_10003244All Organisms → cellular organisms → Bacteria → Proteobacteria6136Open in IMG/M
3300028574|Ga0302153_10062138All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1255Open in IMG/M
3300028748|Ga0302156_10035889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni2780Open in IMG/M
3300028748|Ga0302156_10161888All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1079Open in IMG/M
3300028766|Ga0302269_1037393All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300028779|Ga0302266_10247782All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300028785|Ga0302201_10141187All Organisms → cellular organisms → Bacteria → Acidobacteria1042Open in IMG/M
3300028798|Ga0302222_10020204All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum2729Open in IMG/M
3300028806|Ga0302221_10171994All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300028813|Ga0302157_10065738All Organisms → cellular organisms → Bacteria → Acidobacteria2439Open in IMG/M
3300028813|Ga0302157_10433930All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300028854|Ga0302268_1083834All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae797Open in IMG/M
3300028859|Ga0302265_1181203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae642Open in IMG/M
3300028873|Ga0302197_10307279All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae714Open in IMG/M
3300028909|Ga0302200_10372067All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae669Open in IMG/M
3300029908|Ga0311341_10229753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1136Open in IMG/M
3300029908|Ga0311341_10581252All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae632Open in IMG/M
3300029911|Ga0311361_11146487All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300029913|Ga0311362_10790826All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae787Open in IMG/M
3300029914|Ga0311359_10006372All Organisms → cellular organisms → Bacteria16922Open in IMG/M
3300029914|Ga0311359_10593018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium819Open in IMG/M
3300029915|Ga0311358_10062588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4121Open in IMG/M
3300029915|Ga0311358_10116998All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2662Open in IMG/M
3300029918|Ga0302143_1170819All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300029919|Ga0302141_1008131All Organisms → cellular organisms → Bacteria → Acidobacteria2920Open in IMG/M
3300029922|Ga0311363_11387563All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae573Open in IMG/M
3300029939|Ga0311328_10171321All Organisms → cellular organisms → Bacteria → Acidobacteria1711Open in IMG/M
3300029939|Ga0311328_11003088All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300029945|Ga0311330_10267689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1498Open in IMG/M
3300029952|Ga0311346_10969820All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300029953|Ga0311343_10211544All Organisms → cellular organisms → Bacteria → Acidobacteria1997Open in IMG/M
3300029953|Ga0311343_11471701All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300029982|Ga0302277_1086320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica1400Open in IMG/M
3300029985|Ga0302280_1204610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300029988|Ga0302190_10033023All Organisms → cellular organisms → Bacteria → Acidobacteria2671Open in IMG/M
3300030004|Ga0302186_10219385All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300030049|Ga0302191_10367318All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300030518|Ga0302275_10260696All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300030519|Ga0302193_10374674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae728Open in IMG/M
3300030687|Ga0302309_10146021All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300030688|Ga0311345_10422931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1183Open in IMG/M
3300030688|Ga0311345_11045134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae609Open in IMG/M
3300030688|Ga0311345_11187127All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300030739|Ga0302311_10042068All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum4010Open in IMG/M
3300030746|Ga0302312_10217564All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae732Open in IMG/M
3300030943|Ga0311366_10949116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae744Open in IMG/M
3300031234|Ga0302325_11815637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae763Open in IMG/M
3300031234|Ga0302325_12089755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae694Open in IMG/M
3300031258|Ga0302318_10002094All Organisms → cellular organisms → Bacteria4255Open in IMG/M
3300031261|Ga0302140_10672286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae762Open in IMG/M
3300031524|Ga0302320_10131819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA23854Open in IMG/M
3300031524|Ga0302320_10274790All Organisms → cellular organisms → Bacteria2276Open in IMG/M
3300031524|Ga0302320_11350269All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300031708|Ga0310686_103099555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae853Open in IMG/M
3300031708|Ga0310686_112335910All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300031708|Ga0310686_113870617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae600Open in IMG/M
3300031788|Ga0302319_11602941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae573Open in IMG/M
3300032562|Ga0316226_1238701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii732Open in IMG/M
3300032668|Ga0316230_1306136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300033405|Ga0326727_10414117All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300033818|Ga0334804_081274All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300033822|Ga0334828_095370All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300033823|Ga0334837_016675All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni2888Open in IMG/M
3300033982|Ga0371487_0264331All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300033982|Ga0371487_0379904All Organisms → cellular organisms → Bacteria616Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog32.21%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil16.11%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog9.40%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen7.38%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.71%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog6.04%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.01%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost2.01%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.01%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.01%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.34%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.34%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.67%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.67%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.67%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300022861Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T25EnvironmentalOpen in IMG/M
3300022877Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T0EnvironmentalOpen in IMG/M
3300023060 (restricted)Peat soil microbial communities from Stordalen Mire, Sweden - IR.B.S.T0EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300023258Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026456Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027634Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1MEnvironmentalOpen in IMG/M
3300028068Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T75EnvironmentalOpen in IMG/M
3300028082Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T0EnvironmentalOpen in IMG/M
3300028084Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T100EnvironmentalOpen in IMG/M
3300028090Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v15EnvironmentalOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028566Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028766Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028854Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_1EnvironmentalOpen in IMG/M
3300028859Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300028909Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300029919Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029985Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1EnvironmentalOpen in IMG/M
3300029988Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3EnvironmentalOpen in IMG/M
3300030004Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1EnvironmentalOpen in IMG/M
3300030049Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030687Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300032668Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10400407323300001213WetlandMPSAVKDKSKRASALPQTRAKAPKIKFQADLAPSEDLMVRRLKAELEMASNSDFLADAVALFRWAVSERKRGHRIVSESTSGERKVLLFPRLERVAPELTLPQAEIA
JGIcombinedJ13530_10530458413300001213WetlandMPPTLKEKSKQPVAESRARTKTPKTKFQADLAPAEDLMVRRLKAELELSSNSDFLVDAVALFRWAVSERKRGHRILSESSTGERKVLLFPRLERVAPELT
Ga0062389_10105026513300004092Bog Forest SoilMRATVKDKSKRTAPKVRKSKFQADLAPSEDSIVRALKAELQMTSNTDFLSDALALFRWAVSERKRGHVIISESSTGDRKILVFPRLERVAPEVALPHVDIHWNDRE
Ga0062386_10121973313300004152Bog Forest SoilMPPAVKEKSKKAATLPAKTPTPRKTKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALLRWAVSERKRGHHIVSESSTGERKI
Ga0116117_107813733300009635PeatlandMPSSAKAKSKKVTPLSAKTPSPRKLKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALLRWAVSERKRGHHIVSESSTGVRKILLFPRLERVAP
Ga0116135_105769433300009665PeatlandMPPAVKEKNKKAAALPAKAPTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILIFPRLERVAPEVTLPHVDIRWTD
Ga0116130_131493613300009762PeatlandMPPAVKDKSKKAFALPAKAPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHHIVSESL
Ga0126373_1225480623300010048Tropical Forest SoilMARAASQKKAPPRVPKTKFQADLAPAEDRIVRALKAELEMTSNTDFLSDALALFRWAVSERKRGHTIVSESATGERKILVFPRLERVAPEVALPHADIQWTDT
Ga0181527_111464413300014153BogMPPEVKSKKAVALPAKAPTARKTKFQADLAPSEDSMVRILKAELQMTSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLERVAPEVTL
Ga0181521_1011714453300014158BogMPPAVKEKSKNAPSLLAKAPSPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHHIVSESLT
Ga0181517_1038278113300014160BogMPPAVKEKNKKAAALPAKAPTPRKSKFQADLAPAEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILIFPRLERVAPE
Ga0181517_1048631513300014160BogMPPAVKEKSKKVAALPAKAPLPCKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHHIVSESSTGERKILLFPRLERVAPEVTLPHVDIQWT
Ga0181529_1031854413300014161BogMPPAVKEKNKKAAALPAKAPTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILIF
Ga0181531_1043800423300014169BogMSPAAKEKSKKAAPAPPAKPRKAKFQADLAPSEDSMVRVLKADLQLTSNTDFLSDALALFRWAVSERKRGNRIFSESSTGERKVLLFPSLERVAPEVSLPHVEIQWT
Ga0181535_1039586713300014199BogMPPTAKEKPKNTTGLPSKTPALRKTKFQADLAPSEESGLRTLKAEMQMTSNTDFLSDALALFRWAVS
Ga0181537_1022360313300014201BogMSPAAKEKSKKAAPAPPAKPRKAKFQADLAPSEDSMVRVLKADLQLTSNTDFLSDALALFRWAVSERK
Ga0181537_1040473423300014201BogMPAAVKEKAKNTLPSPKVRKSKFQADLAPSEDSIVRALKAELQMTSNTDFLSDALALFRWAVSERKRGHIIVSESSTGER
Ga0181537_1054635223300014201BogMPATVKEKSKNTAPSPKVRKSKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALFRWAVSERKRGHIIVSESSTGERKILVLPRLERVAPEVALPHVDIHWN
Ga0182018_1046140513300014489PalsaMPPAVKEKSKKATALPAKAPTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERM
Ga0182014_1048905023300014491BogMPPAVKDKSKKAFALPAKAPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESS
Ga0182014_1049996713300014491BogMSPAAKEKSKKASPASPVKPRKAKFQADLAPSEDSMVRVLKADLQLTSNTDFLSDALALFRWAVSERKRGNRIFSES
Ga0182013_1059739113300014492BogMPPAVKEKSKNVAALPAKAPLPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKR
Ga0182017_1031185233300014494FenMPPAFKDKSKKAAALPAKAPTARKTKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPRLERVAPEVTL
Ga0182017_1068994123300014494FenMPPAVKEKSKNVAALPAKAPSPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHRIVSESLTGERKILLFPRLERVAPEVTLPHVDIRWTDKE
Ga0182011_1088702123300014496FenMSPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERK
Ga0182011_1103288813300014496FenMPPAVKDKSKKAAALPAKAPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLER
Ga0182019_1097045613300014498FenMPPAVKEKSKNLAAPPAKAPSLRKLKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALFRWAVS
Ga0182019_1116985823300014498FenMPPTVKEKSKNAAALPAKAPTPRKSKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALFRWAVSERKRGHHIVSESSTGERKVLIFPRL
Ga0182012_1012373733300014499BogMPPAVKSKKSVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVS
Ga0182012_1027292333300014499BogMPSTVKEKSKNVAALPAKAPTPRKSKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHRIVSESSTGERKILLF
Ga0181516_1009282313300014655BogMSPAAKEKSKKAAPAPPAKPRKAKFQADLAPSEDSMVRVLKADLQLTSNTDFLSDALALFRWAVSERKRGNRIFSESSTGERKVLLFPSLERVAPEV
Ga0181522_1081473913300014657BogMPPTVKEKSKNVAALPAKAPTPRKSKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHRIVSESSTGERKILL
Ga0182030_1010485143300014838BogMPPAVKEKSKNVAAPPAKAPSLRKLKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERRILIFPRLERVAPEVTLPHVDILWTDK
Ga0182030_1041201343300014838BogMPPAVKEKSKSAAALPAKVPSPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPRL
Ga0182030_1078483423300014838BogMPPAVKDKNKKSAILPAKAPTPRKSKFQADLAPSEDSMVRVLKADLQMSSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILIF
Ga0182027_1029373613300014839FenMPPAFKDKSKKAAALPAKAPTARKTKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALFRWAVSERKR
Ga0182027_1137213523300014839FenMPPAVKSKKAVALPAKVPTSRKSKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALFRWAVSERKRGHRIVSESSTGERKILLFPR
Ga0182027_1183302923300014839FenMPPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRW
Ga0182027_1202215023300014839FenMRPTVKSKKAVALTAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSER
Ga0187854_1008872343300017938PeatlandMPPAVKSKKAVALQAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPRLERVAPEVTL
Ga0181520_1040529523300017988BogMPPAVKAKSKQSARAHAKSAALPKRTHKTKFQADLAPSEDHMVRALKAELQMSSNSDFLSDALTLLRWAVSERKRGHRIV
Ga0181520_1109663913300017988BogMPPAVKEKSKKATALLAKAPTPRKTKFQADLAPSEDSMVRVLKAELQMTSNTDFLTDALALFRWAVSERKRGHRIVSESSTGERKILIFPRLERVAPEVTLP
Ga0187888_116524023300018008PeatlandMPPAVKSKKAVALQAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPRLERVAPEVTLPHVDIR
Ga0187885_1026382133300018025PeatlandMPPAVKSKKAVALQAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPR
Ga0187857_1029435033300018026PeatlandMPPAVKSKKAVALQAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVTERKRGHHIVSESSTGERK
Ga0187863_1029426233300018034PeatlandMPPAVKEKPKKAATFPAKAPTLRKSKFQADLAPSEDRMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRIVS
Ga0187871_1021856823300018042PeatlandMPSSVKAKSKKVVPLSAKTQSPRKLKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALLRWAVSERKRGHHIVSESSTGVRKILLFPRLERVAPEVTLPHVDIQWT
Ga0187887_1004314113300018043PeatlandMPPAVKEKSKQAAHAKPPVLPKRTHKTKFQADLVPSEDQMVRALKAELQMSSNSDFLSDALTLFRWAVSERKRGHRIVSESSTGERKV
Ga0187890_1070873613300018044PeatlandMPPAVKSKKTVALPAKVPTARKTKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLERVAPEVTL
Ga0187859_1023244513300018047PeatlandMPPAVKSKKTVALPAKVPTARKTKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALFRW
Ga0187858_1094518413300018057PeatlandMPPAVKSKKAVALQAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKI
Ga0182031_128711423300019787BogMPPAVKSKKSVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGNAKSCSFLVWSGLPRR
Ga0182028_146266053300019788FenMPPTVKEKSKNAAALPAKAPTPRKSKFQADLAPSEDSMVRALKAELQMTSNTDFLSDALALFRWAVSERKRGHHIVSESSTGERKVLIFPVWSALLRK
Ga0224528_101028713300022861SoilMSPAAKEKSKKVASSPKPRKAKFQADLAPSEDSMVRVLKAELQLTSNTDFLSDALALFRWAVSE
Ga0224528_106369213300022861SoilMPPAVKEKSKNVAALPAKAPSPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVTERKRGHHIVSESSTGERKILLFPRLERVAPEMTLPRVDVQWT
Ga0224527_101905333300022877SoilMSPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRW
(restricted) Ga0224519_103277723300023060SoilMSPAAKEKSKKASPASPVKPRKAKFQADLAPSEDSMVRVLKADLQLTSNTDFLSDALALFRWAVSERKRGNRIFSESSTGERKVLLFPSLERVAPEVSLPHVE
Ga0224554_113248713300023068SoilMPPAVKSKKSVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESST
Ga0224554_114007713300023068SoilMSPAVKSGKTVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISDSSTGERKILLFPRLERVAPEVTLPHVDIHWTDNEL
Ga0224555_101048613300023088SoilMPQAVKEKSKKAATLPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHII
Ga0224555_102848753300023088SoilMPPAVKDKSKKAFALPAKAPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHII
Ga0224558_103357443300023090SoilMPPAVKSKKAVALQAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHII
Ga0224559_116430623300023091SoilMPPAVKEKSKSAAALPAKVPSPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPRLERVAPEVTLPHVDIRWT
Ga0224557_103536513300023101SoilMPPAVKDKSKKAFALPAKAPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPRLE
Ga0224535_112528513300023258SoilMPPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIVSESSTGE
Ga0208690_102274323300025434PeatlandMPSSVKAKSKKVVPLSAKTQSPRKLKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALLRWAVSERKRGHHIVSESSTGVRKILLFPRLERVAP
Ga0208691_116224213300025612PeatlandMPSSVKAKSKKVVPLSAKTQSPRKLKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALLRWAVSERKRGHHIVSESSTGVRKIL
Ga0255351_102920343300026456SoilMPPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESST
Ga0255351_103064823300026456SoilMSPAAKEKSKKASPASPVKPRKAKFQADLAPSEDSMVRVLKADLQLTSNTDFLSDALALFRWAVSERKRGNRIFSESSTGERKVLLFPSLERVAPEVSLP
Ga0209221_110704213300027609Forest SoilMPAAVKEKAKNTVPSSKVRKSKFQADLAPSEDSIVRALKAELQMTSNTDFLSDALALFRWAVSERKR
Ga0209905_104144123300027634Thawing PermafrostMPRAVKEKSKKAATLPAKTPTPRKTKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLERVAPE
Ga0209905_104279023300027634Thawing PermafrostMPPEVKQKSKNLAALPAKAPSPRKLKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALLRWAVSERKRGHHI
Ga0209905_106600623300027634Thawing PermafrostMSPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAV
Ga0255355_100049713300028068SoilMPPAVKEKSKNVAALPAKAPSPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVTERKRGHHIVSESSTGERKILLFP
Ga0255352_101290113300028082SoilMPPAVKEKSKNVAALPAKAPSPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVTERKRGHHIVSES
Ga0255352_103527013300028082SoilMPPALKEKSKKKAALATKATSHRKTKFQADLAPSEDSMVRILKAELQMTSNTDFLSDALALFRWAVSERKLGHRIVSESSNGERKI
Ga0255352_104577913300028082SoilMSPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIVSESSTGE
Ga0255356_104093813300028084SoilMPPAVKSKKAVALPAKAPTARKTKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIVSESSTGE
Ga0255349_102753553300028090SoilMPPAVKSKKAVALPAKAPTARKTKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIV
Ga0255348_105474513300028268SoilMSPAAKEKSKKASPASPVKPRKAKFQADLAPSEDSMVRVLKADLQLTSNTDFLSDALALFRWAVSERKRGNRIFSESSTGERKVLLFPSLERVA
Ga0302149_112983613300028552BogMPPAVKSKKAVALPAKAPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPR
Ga0302145_1021845613300028565BogMPPAVKSKKAVALPAKAPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILL
Ga0302145_1029081813300028565BogMPSTVKEKSKNVAALPAKAPTPRKSKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHRIVSESSTGERKILLFPRLERVAPEVTLPHVDIRWTD
Ga0302147_1025536013300028566BogMPPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLERVAPEVTLPHVDIRWTDK
Ga0302152_1000324413300028572BogMPPAVKSKKAVALPAKAPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPRLERVAPEV
Ga0302153_1006213823300028574BogMPPAVKEKSKNVAALPAKAPSPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVTERKRGHHIVSESSTGERKILLFPRLERVA
Ga0302156_1003588913300028748BogMPPAVKSKKAVALPAKAPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESS
Ga0302156_1016188813300028748BogMPSTVKEKSKNVAALPAKAPTPRKSKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHRIV
Ga0302269_103739313300028766BogMPPAVKSKKSVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPRLE
Ga0302266_1024778223300028779BogMPPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLERVAPEVTLPHVDIRWT
Ga0302201_1014118713300028785BogMPPEVKQKSKNLAALPAKAPSPRKLKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALLRWAVSERKRGHHIVSESS
Ga0302222_1002020443300028798PalsaMPAAVKEKSKNKAPAPKVRKSKFQADLAPSEDSIVRALKAELEMTSNTDFLSDALALFRWAVSERKRGHIIVSESSTGERKILVFPRLERVAPEVA
Ga0302221_1017199413300028806PalsaMPAAVKEKSKNKAPAPKVRKSKFQADLAPSEDSIVRALKAELEMTSNTDFLSDALALFRWAVSERKRGHIIVSESSTGERKILVFPRLERVAPEVALPQVDI
Ga0302157_1006573813300028813BogMPPAVKSKKSVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILL
Ga0302157_1043393013300028813BogMPPAVKEKSKNVAALPAKAPSPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVTERKRGHHIVSESSTGERKILLFPRLERVAPEMTLPRD
Ga0302268_108383413300028854BogMPPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLERVAPE
Ga0302265_118120323300028859BogMPPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLERV
Ga0302197_1030727933300028873BogMPPAVKEKSKNVAALPAKAPLPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVS
Ga0302200_1037206713300028909BogMPPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLERVA
Ga0311341_1022975333300029908BogMPSTVKEKSKNVAALPAKAPTPRKSKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHRIVSESSTGERKILLFPRLERVAPEVT
Ga0311341_1058125213300029908BogMPPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALFRWAVSERKRGHRIVSESST
Ga0311361_1114648713300029911BogMPPEVKQKSKNLAALPAKAPSPRKLKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALLRWAVSERKRGHHIVSESSTGERKILLFPRLERVAPEVTL
Ga0311362_1079082623300029913BogMPPAVKEKNKKAAALPAKAPTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRIV
Ga0311359_10006372193300029914BogMPSTVKEKSKNVAALPAKAPTPRKSKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHRIVS
Ga0311359_1059301823300029914BogMPPAVKEKSKNVAAPPAKAPSLRKLKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERRILIFPRLERVAPE
Ga0311358_1006258813300029915BogMPPEVKQKSKNLAALPAKAPSPRKLKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALLRWAVSERKRGHHIVSESSTGERKILLFPRLER
Ga0311358_1011699813300029915BogMPPAVKEKNKKAAALPAKAPTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILIFPRL
Ga0302143_117081913300029918BogMPPAVKSKKAVALPAKAPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPRLERVAPEVTLPHVDIRWTDKEL
Ga0302141_100813113300029919BogMPPAVKSKKSVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPRLERVAPEV
Ga0311363_1138756323300029922FenMPPAVKEKNKKAAALPAKTSTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSE
Ga0311328_1017132113300029939BogMPPEVKQKSKNLAALPAKAPSPRKLKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALLRWAVSERKRGHHIVSESSTGERKILLFPRLERVAPEVTLP
Ga0311328_1100308813300029939BogMPPAVKEKNKKAAALSAKVPTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRILSESSTGERKILIFPRLERVAPEVTLPQ
Ga0311330_1026768943300029945BogMPSTVKEKSKNVAALPAKAPTPRKSKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHRIVSESSTGERKILLFPRLERVA
Ga0311346_1096982023300029952BogMPSAVKSKKAVALPAKVPTSRKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIVSESSTGER
Ga0311343_1021154443300029953BogMPQAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRVLKAELQMTSNTDFLTDALALLRWAVSERKRGHHIVS
Ga0311343_1147170113300029953BogMPPAVKEKSKNVAAPPAKAPSLRKLKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERRILIFPRLERVAPEVTLPHV
Ga0302277_108632013300029982BogMSPAAKEKSKKASPASPVKPRKAKFQADLAPSEDSMVRVLKADLQLTSNTDFLSDALALFRWAVSERKRGNRIFSESSTGERKVLLFPSLERVAPEV
Ga0302280_120461023300029985FenMPPAVKEKNKKAAALPAKTSTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILIFPRLERVAPEVTLPHVDIR
Ga0302190_1003302313300029988BogMPPAVKSKKSVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESSTGERKILLFPRLERVAPEVTLPHVDIHWTDK
Ga0302186_1021938513300030004BogMSPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIVSESSTG
Ga0302191_1036731823300030049BogMPPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLERVAPEVTLPHVDIRW
Ga0302275_1026069613300030518BogMSPAAKEKSKKAASTLKPRKTKFQADLAPSEDSMVRVLKADLQLTSNTDFLSDALSLFRWAVSERKRGNRIFSESPTGERKVLLFPSLERVAPEVS
Ga0302193_1037467423300030519BogMSPAAKEKSKKAASTLKPRKTKFQADLAPSEDSMVRVLKADLQLTSNTDFLSDALSLFRWAVSERKRGNRI
Ga0302309_1014602133300030687PalsaMPAAVKEKSKNKAPAPKVRKSKFQADLAPSEDSIVRALKAELEMTSNTDFLSDALALFRWAVS
Ga0311345_1042293113300030688BogMPPAVKEKNKKAAALSAKAPTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILIFPRLERVAPEVTVPHVDIRWTDK
Ga0311345_1104513423300030688BogMPPAVKEKSKNVAALPAKAPLPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALLRWAVSERKRGHRIV
Ga0311345_1118712723300030688BogMPSAVKSKKAVALPAKVPTSRKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHH
Ga0302311_1004206843300030739PalsaMPAAVKEKSKNKAPAPKVRKSKFQADLAPSEDTIVRALKAELEMTSNTDFLSDALALFRWAVSERKRGHIIVSESST
Ga0302312_1021756413300030746PalsaMPPAAKEKNKKAAALSAKAPTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILIFPRLER
Ga0311366_1094911623300030943FenMPSALKENSKKNAALAAKASTPRKSKFQADLAPSEDRMVRVLKAELQMTSNTDFLSDALALFHWAVSERKS
Ga0302325_1181563713300031234PalsaMPPAVKEKPKKAATFPAKAPTLRKSKFQADLAPSEDRMVRVLKAELQMTSNTDFLSDALALFRWAVS
Ga0302325_1208975523300031234PalsaMPAAVKEKAKKSAPSTKVRKSKFQADLAPSEDSIVRALKAELEMTSNTDFLSDALALFRWAVSERKRGHIIVSESSTGERKILVFPRLERVAP
Ga0302318_1000209413300031258BogMSPAVKSKKAVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIVSES
Ga0302140_1067228613300031261BogMPPAVKEKNKKAAALSAKAPTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSE
Ga0302320_1013181963300031524BogMPPAVKEKSKKATALLAKAPTPRKTKFQADLAPSEDSMVRVLKAELQMTSNTDFLTDALALFRWAVSE
Ga0302320_1027479013300031524BogMRPAVKEKSKNVAPLPAKAPSPRKLKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALTLLRWAVSERKRGHRIVSESSTG
Ga0302320_1135026933300031524BogMPAAVKEKSKNKAPAPKVRKSKFQADLAPSEDSIVRALKAELEMTSNTDFLSDALALFRWAVSERKRGHIIVSESSTGERKILVFPRLE
Ga0310686_10309955513300031708SoilMPPAVKEKNKKATALPAKAPTPRKSKFQADLAPAEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSER
Ga0310686_11233591023300031708SoilMPPAVKEKNKKAVALSAKVPTPRKSKFQADLAPSEDSMVRVLKAELQMSSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILIFPRLERVAPEVTLPHVD
Ga0310686_11387061713300031708SoilMPAAVKEKSKNKAPAPKVRKSKFQADIAPSEDSIVRALKAELEMTSNTDFLSDALALFRWAVSERKRGHIIVSESSTGERKILVFP
Ga0302319_1160294123300031788BogMPATVKEKSKNTAPSPKVRKSKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALFRWAVSERR
Ga0316226_123870113300032562FreshwaterMPPTAKEKPKNATGLPAKIPAPRKTKFQADLAPSEESGLRALKAEMQMTSNTDFLSDALALFRWAVSERKRGHRILSESSSGERMVLVFPRLERVAPDATLPHVDIR
Ga0316230_130613623300032668FreshwaterMPPEVKDKSKKAATLPAKTPTTRKTKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALFRWAVSERKRGHRIVSES
Ga0326727_1041411723300033405Peat SoilMPAAVKEKAKNTVPSPKVRKSKFQADLAPSEDSIVRALKAELQMTSNTDFLSDALALFRWAVSERKRGHIIVSESSTGERKILVFPRLERVAPEVAL
Ga0334804_081274_1_2523300033818SoilMPPEVKQKSKNLAALPAKAPSPRKLKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALLRWAVSERKRGHHIVSESSTGER
Ga0334828_095370_3_2363300033822SoilMPPEVKQKSKNLAALPAKAPSPRKLKFQADLAPSEDSMVRILKAELQMTSNTDFLTDALALLRWAVSERKRGHHIVSE
Ga0334837_016675_1_2343300033823SoilMPPAVKSKKSVALPAKVPTARKSKFQADLAPSEDSMVRILKTELQMTSNTDFLTDALALLRWAVSERKRGHHIISESS
Ga0371487_0264331_2_3193300033982Peat SoilMPPAVKSKKTVALPAKVPTARKTKFQADLAPSEDSMVRILKTELQMTSNTDFLSDALALFRWAVSERKRGHRIVSESSTGERKILLFPRLERVAPEVTLPHVDIPW
Ga0371487_0379904_300_6143300033982Peat SoilMPPAVKEKSQNVAALPAKAPSPRKLKFQADLAPSEDSMVRVLKAELQMTSNTDFLSDALALFRWVVSERKRGHRIVSESSTGERKILIFPRLERVAPEVTLPHVD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.