Basic Information | |
---|---|
Family ID | F047346 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 150 |
Average Sequence Length | 46 residues |
Representative Sequence | VPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGELITVRPPF |
Number of Associated Samples | 132 |
Number of Associated Scaffolds | 150 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 63.31 % |
% of genes near scaffold ends (potentially truncated) | 91.33 % |
% of genes from short scaffolds (< 2000 bps) | 85.33 % |
Associated GOLD sequencing projects | 125 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.333 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.86% β-sheet: 22.97% Coil/Unstructured: 62.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 150 Family Scaffolds |
---|---|---|
PF00892 | EamA | 27.33 |
PF01292 | Ni_hydr_CYTB | 14.67 |
PF00903 | Glyoxalase | 8.67 |
PF01713 | Smr | 5.33 |
PF06262 | Zincin_1 | 5.33 |
PF00033 | Cytochrome_B | 4.67 |
PF00174 | Oxidored_molyb | 3.33 |
PF00248 | Aldo_ket_red | 2.00 |
PF12681 | Glyoxalase_2 | 1.33 |
PF00795 | CN_hydrolase | 0.67 |
PF00155 | Aminotran_1_2 | 0.67 |
PF08940 | DUF1918 | 0.67 |
PF00211 | Guanylate_cyc | 0.67 |
PF00872 | Transposase_mut | 0.67 |
PF01061 | ABC2_membrane | 0.67 |
PF00480 | ROK | 0.67 |
PF08352 | oligo_HPY | 0.67 |
PF12704 | MacB_PCD | 0.67 |
PF07690 | MFS_1 | 0.67 |
PF02617 | ClpS | 0.67 |
COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
---|---|---|---|
COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 14.67 |
COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 14.67 |
COG3038 | Cytochrome b561 | Energy production and conversion [C] | 14.67 |
COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 14.67 |
COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 14.67 |
COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 5.33 |
COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 4.67 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 3.33 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 3.33 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.33 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.67 |
COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.33 % |
Unclassified | root | N/A | 30.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725004|GPKC_F5V46DG01B526G | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
2228664021|ICCgaii200_c0778780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
3300001686|C688J18823_11025394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
3300004006|Ga0055453_10145089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
3300004114|Ga0062593_100823718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
3300004643|Ga0062591_102185599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300005186|Ga0066676_10266677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1123 | Open in IMG/M |
3300005186|Ga0066676_10376107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
3300005186|Ga0066676_10411723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis | 913 | Open in IMG/M |
3300005337|Ga0070682_101947757 | Not Available | 516 | Open in IMG/M |
3300005434|Ga0070709_10666730 | Not Available | 807 | Open in IMG/M |
3300005436|Ga0070713_101584174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
3300005438|Ga0070701_10701583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
3300005444|Ga0070694_100290410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis | 1250 | Open in IMG/M |
3300005458|Ga0070681_11636130 | Not Available | 570 | Open in IMG/M |
3300005459|Ga0068867_101007308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
3300005526|Ga0073909_10574847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
3300005540|Ga0066697_10592929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
3300005545|Ga0070695_101599685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300005549|Ga0070704_100799507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
3300005549|Ga0070704_101605804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
3300005556|Ga0066707_10279963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1091 | Open in IMG/M |
3300005561|Ga0066699_10156435 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
3300005562|Ga0058697_10000270 | All Organisms → cellular organisms → Bacteria | 24879 | Open in IMG/M |
3300005562|Ga0058697_10787444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
3300005718|Ga0068866_10493106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 809 | Open in IMG/M |
3300006032|Ga0066696_10828948 | Not Available | 590 | Open in IMG/M |
3300006034|Ga0066656_10746542 | Not Available | 627 | Open in IMG/M |
3300006046|Ga0066652_101988948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
3300006163|Ga0070715_10035952 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
3300006237|Ga0097621_101817997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
3300006797|Ga0066659_11231929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
3300006845|Ga0075421_101783244 | Not Available | 663 | Open in IMG/M |
3300009012|Ga0066710_100333817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2235 | Open in IMG/M |
3300009094|Ga0111539_11875234 | Not Available | 695 | Open in IMG/M |
3300009098|Ga0105245_10368323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1428 | Open in IMG/M |
3300009098|Ga0105245_10746526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
3300009100|Ga0075418_11101726 | Not Available | 860 | Open in IMG/M |
3300009137|Ga0066709_100122268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3256 | Open in IMG/M |
3300009147|Ga0114129_10176781 | All Organisms → cellular organisms → Bacteria | 2907 | Open in IMG/M |
3300009147|Ga0114129_12396370 | Not Available | 632 | Open in IMG/M |
3300009176|Ga0105242_12363049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
3300009840|Ga0126313_10453214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
3300010039|Ga0126309_11255680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300010041|Ga0126312_10975939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300010042|Ga0126314_11380119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 529 | Open in IMG/M |
3300010337|Ga0134062_10377791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
3300010371|Ga0134125_10903634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis | 970 | Open in IMG/M |
3300010371|Ga0134125_12246437 | Not Available | 593 | Open in IMG/M |
3300010400|Ga0134122_10550302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis | 1055 | Open in IMG/M |
3300010403|Ga0134123_10103930 | All Organisms → cellular organisms → Bacteria | 2267 | Open in IMG/M |
3300011994|Ga0120157_1002694 | All Organisms → cellular organisms → Bacteria | 5973 | Open in IMG/M |
3300012011|Ga0120152_1010950 | All Organisms → cellular organisms → Bacteria | 3861 | Open in IMG/M |
3300012019|Ga0120139_1112818 | Not Available | 689 | Open in IMG/M |
3300012043|Ga0136631_10330340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
3300012198|Ga0137364_11438677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
3300012199|Ga0137383_10611736 | Not Available | 797 | Open in IMG/M |
3300012200|Ga0137382_10864116 | Not Available | 652 | Open in IMG/M |
3300012200|Ga0137382_10901391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
3300012201|Ga0137365_10244965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1334 | Open in IMG/M |
3300012356|Ga0137371_10804287 | Not Available | 716 | Open in IMG/M |
3300012506|Ga0157324_1003429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
3300012895|Ga0157309_10204673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
3300012951|Ga0164300_10536008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
3300012960|Ga0164301_10812735 | Not Available | 716 | Open in IMG/M |
3300012960|Ga0164301_11696839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300012977|Ga0134087_10326786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
3300012986|Ga0164304_11328932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300012987|Ga0164307_11004874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
3300012988|Ga0164306_11185438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
3300012988|Ga0164306_11210570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
3300013096|Ga0157307_1145303 | Not Available | 547 | Open in IMG/M |
3300013100|Ga0157373_10751084 | Not Available | 717 | Open in IMG/M |
3300013102|Ga0157371_10708060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 754 | Open in IMG/M |
3300013308|Ga0157375_11345105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
3300013763|Ga0120179_1012620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2158 | Open in IMG/M |
3300013765|Ga0120172_1008640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3363 | Open in IMG/M |
3300013768|Ga0120155_1111189 | Not Available | 760 | Open in IMG/M |
3300014302|Ga0075310_1035341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
3300015359|Ga0134085_10253401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
3300015374|Ga0132255_102591808 | Not Available | 775 | Open in IMG/M |
3300017966|Ga0187776_10078892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1923 | Open in IMG/M |
3300018056|Ga0184623_10045445 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
3300018056|Ga0184623_10106717 | Not Available | 1295 | Open in IMG/M |
3300018056|Ga0184623_10336861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
3300018061|Ga0184619_10108778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis | 1249 | Open in IMG/M |
3300018081|Ga0184625_10610974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
3300018431|Ga0066655_10536239 | Not Available | 780 | Open in IMG/M |
3300018433|Ga0066667_10880823 | Not Available | 769 | Open in IMG/M |
3300018482|Ga0066669_11655506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
3300019875|Ga0193701_1090404 | Not Available | 581 | Open in IMG/M |
3300020059|Ga0193745_1135059 | Not Available | 505 | Open in IMG/M |
3300021073|Ga0210378_10218950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
3300021080|Ga0210382_10475302 | Not Available | 554 | Open in IMG/M |
3300024246|Ga0247680_1022743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
3300024288|Ga0179589_10185798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis | 903 | Open in IMG/M |
3300025899|Ga0207642_10340319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 882 | Open in IMG/M |
3300025905|Ga0207685_10371476 | Not Available | 726 | Open in IMG/M |
3300025908|Ga0207643_11047273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300025910|Ga0207684_10902591 | Not Available | 743 | Open in IMG/M |
3300025917|Ga0207660_10308788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1261 | Open in IMG/M |
3300025919|Ga0207657_11487835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300025928|Ga0207700_11084786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
3300025937|Ga0207669_11915887 | Not Available | 507 | Open in IMG/M |
3300025938|Ga0207704_10455696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1022 | Open in IMG/M |
3300025942|Ga0207689_11276655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
3300025949|Ga0207667_11057154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
3300025949|Ga0207667_11381790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 678 | Open in IMG/M |
3300026075|Ga0207708_10673738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
3300026306|Ga0209468_1186154 | Not Available | 525 | Open in IMG/M |
3300026330|Ga0209473_1088696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1298 | Open in IMG/M |
3300027873|Ga0209814_10416323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
3300027909|Ga0209382_10694338 | Not Available | 1096 | Open in IMG/M |
3300028713|Ga0307303_10188756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
3300028717|Ga0307298_10166588 | Not Available | 643 | Open in IMG/M |
3300028721|Ga0307315_10080281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
3300028755|Ga0307316_10179647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
3300028755|Ga0307316_10238285 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300028782|Ga0307306_10087768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 817 | Open in IMG/M |
3300028782|Ga0307306_10181676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
3300028784|Ga0307282_10309227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 762 | Open in IMG/M |
3300028799|Ga0307284_10263358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
3300028814|Ga0307302_10077478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1572 | Open in IMG/M |
3300028828|Ga0307312_10423816 | Not Available | 875 | Open in IMG/M |
3300028875|Ga0307289_10426967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
3300028880|Ga0307300_10087709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 926 | Open in IMG/M |
3300028881|Ga0307277_10259765 | Not Available | 767 | Open in IMG/M |
3300028881|Ga0307277_10347028 | Not Available | 661 | Open in IMG/M |
3300028881|Ga0307277_10458963 | Not Available | 571 | Open in IMG/M |
3300031716|Ga0310813_12121022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300031731|Ga0307405_10217342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1400 | Open in IMG/M |
3300031740|Ga0307468_102022571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
3300031944|Ga0310884_10429106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
3300032013|Ga0310906_10162337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis | 1317 | Open in IMG/M |
3300032075|Ga0310890_11151003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300032159|Ga0268251_10000007 | All Organisms → cellular organisms → Bacteria | 328409 | Open in IMG/M |
3300033550|Ga0247829_10775925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 798 | Open in IMG/M |
3300033551|Ga0247830_11039110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
3300034144|Ga0334962_031264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.67% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.67% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.67% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.33% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.33% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.67% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.67% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.67% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.67% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.67% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.67% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034144 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 58SNS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKC_04348040 | 2067725004 | Soil | MARYVGRENVRKRLEPLAGGPGRTTYADGAARIETD |
ICCgaii200_07787802 | 2228664021 | Soil | VPRFVGRENVRKRLAPLEGEPGRMTYADGAAQIETAD |
C688J18823_110253942 | 3300001686 | Soil | VRSVARYVGRENVRKRLEPLVGAPGRTTYADGAARIEIADETITVRP |
Ga0055453_101450891 | 3300004006 | Natural And Restored Wetlands | MARYIGRENVRKRLEPLAEGRSTYADGAVRIETSDGTITVRPPF |
Ga0062593_1008237181 | 3300004114 | Soil | VARYVGRENVRKRLQPLGGGPGRTSYGGGSARIETADETL |
Ga0062591_1021855992 | 3300004643 | Soil | VARYVGRENVRKRFAPLEGTPGRTVYADDAARFEAGETTV |
Ga0066676_102666771 | 3300005186 | Soil | MPRYVGRENVRKRLDAIDEGRVVYAEGAARIETPDETITVRPPFGLAHARV |
Ga0066676_103761071 | 3300005186 | Soil | MARFVGRENVRKRLAPLAGEPGRTIYAGGEARIDTAGELIVVRPPFGLAHEGEYEVV |
Ga0066676_104117231 | 3300005186 | Soil | LPRFVGRENVRKRLGPLEGEPGRTTYADGVVRIEAAGEVITVRPPFGLP |
Ga0070682_1019477572 | 3300005337 | Corn Rhizosphere | MARYVGRENVRKRLEPLAGLSGRTTYADGAARIETGNETITVRPPFGLAHARVY |
Ga0070709_106667301 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRYVGRENVRKRLAPLQGEPGRTTYADGEVRIEAPGEQIVVR |
Ga0070713_1015841742 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRFVGRENVRKRLAPLEGEPGRTTYADGEVRIEAPGEQIVVRPSF |
Ga0070701_107015831 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VARYVGRENVRKRLEPLAGQAGRTTYADGAATLETADETIT |
Ga0070700_1005730363 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPFGLA |
Ga0070694_1002904103 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRFVGRENVRKRLAPLEGEPGRTVYADGAVRIEAASEVITVRPPFGLPHAGE |
Ga0070681_116361302 | 3300005458 | Corn Rhizosphere | MARYVGRENVRKRLEPLAGAAGRTTYGEGAARIETADETIT |
Ga0068867_1010073081 | 3300005459 | Miscanthus Rhizosphere | VARYVGRENVRKRLEPLAGLPGRTTYADGAARIETGDETITVRPPFGLAHARVY |
Ga0073909_105748472 | 3300005526 | Surface Soil | MARYVGRENVRKRLEPLAGLPGRTTYGDGSVRIQTDDETITVRPPFGLAHARVYES |
Ga0066697_105929291 | 3300005540 | Soil | VARFVGRDNVRKRLAPLEGEPGRTSYSDGEARIEAAGEVIVVRPP |
Ga0070695_1015996852 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VARYVGRENVRKRLEPLAGLPGRTTYADGAARIETGNETITVRPPFGLAHAR |
Ga0070704_1007995071 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRFVGRENVRKRLAPLEGEPGRTTYAVGVVRIEAAGELISVRPPFGLAHAGEYEVV |
Ga0070704_1016058041 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VARYVGRENVRKRLEPLAGLPGRTTYADGSARIETGNETITVRPPFGL |
Ga0066707_102799631 | 3300005556 | Soil | VRKRLAGLEEGRTVYADGAARIESGGETLVVRPPFGLAHEGEYDRVELGPL |
Ga0066699_101564354 | 3300005561 | Soil | VARFVGRDNVRKRLAPLEGEPGRTSYSDGAARIEAGGEVITVRPPFGL |
Ga0058697_1000027017 | 3300005562 | Agave | MGRFVGRENVRKRLATLEGEQGRTIYADGAARLELPDVRVGA* |
Ga0058697_107874442 | 3300005562 | Agave | MPRYVGRENVRKRLEPLEGQPGRTIYADGAVSIETV |
Ga0068866_104931063 | 3300005718 | Miscanthus Rhizosphere | VHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPFGLAHARVYER |
Ga0066696_108289481 | 3300006032 | Soil | MARFVGRENLRKRLAPLEGGPGRASYADGSLRIETAG |
Ga0066656_107465421 | 3300006034 | Soil | MARFVGRENVRKRLAPLAGEPGRTTYAGGKARIETAGELIVVRPPFGLAHEGEYEVV |
Ga0066652_1019889482 | 3300006046 | Soil | MARYIGRENVRKRLAALEEGRVVYADGAARIETEGETITVRP |
Ga0070715_100359524 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRFVGRENVRKRLAPLEGEPGRTTYAVGVVRIEAAGE |
Ga0097621_1018179972 | 3300006237 | Miscanthus Rhizosphere | MARYVGRENVRKRLEPLAGAAGRTTYGEGAARIETAD |
Ga0074056_103292851 | 3300006574 | Soil | VRKRLSPLEGEPGRTGYADGVVRIETPAEAIAVRPPFGLA |
Ga0066659_112319291 | 3300006797 | Soil | VPRFVGRENVRKRLAPLEGEPGRTAYADGEVHIDAPGELIGVRPPFGL |
Ga0075421_1017832441 | 3300006845 | Populus Rhizosphere | MTRYVGRENVRKRLAPLEGQPGRTVYVSGAARIETAEETITVRPP |
Ga0066710_1003338174 | 3300009012 | Grasslands Soil | VGRENVAKRLSQLEGGRAVYAGGSARFETPVETITVRPPFGLAHE |
Ga0111539_118752342 | 3300009094 | Populus Rhizosphere | MARYVGRENVRKRLAPLEGQPGRTVYAGGTARIETADETITVG |
Ga0105245_103683233 | 3300009098 | Miscanthus Rhizosphere | VPRFVGRENVRKRLAPLEGEPGRTVYADGAVRIEAASEVITVRPPFGLPHAGEY |
Ga0105245_107465262 | 3300009098 | Miscanthus Rhizosphere | MARYVGRENVRKRLEPLAGAAGRTTYGQGAARIETADETITVRPPFGLAHARVYELV |
Ga0075418_111017262 | 3300009100 | Populus Rhizosphere | MARYVGRENVRKRLAALEGKPGRTVYAGGTARIET |
Ga0066709_1001222685 | 3300009137 | Grasslands Soil | MARYIGRENVRKRLEPLREGRTTYSGGAVRIETPDETITVRPPFGLAREGAYDRIEL |
Ga0114129_101767815 | 3300009147 | Populus Rhizosphere | VPRFVGRENVRKRLAPLEGEPGRTTYADGAARIETTNEVITVR |
Ga0114129_123963702 | 3300009147 | Populus Rhizosphere | VPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGEQIT |
Ga0105242_123630492 | 3300009176 | Miscanthus Rhizosphere | VPRFVGRENVRKRLAPLEGGPGRTVYADGAVRIEAASEVITVRPPFGLA |
Ga0126313_104532143 | 3300009840 | Serpentine Soil | MARFVGRENVRKRLAPLAGGPGRTVYADGAVRIEVPAETIVVRPPFGLAYAGEYESV |
Ga0126309_112556801 | 3300010039 | Serpentine Soil | MSRFIGRDNVRKRLAPLDGAPGRTTYTDGAVRIEPENGESLVVRPPFG |
Ga0126312_109759391 | 3300010041 | Serpentine Soil | VTRRYIGRDNVRKRLEWLEGSPGRTTYADGAVLVEPEHGEALVVR |
Ga0126314_113801191 | 3300010042 | Serpentine Soil | MARFVGRENVRKRLAPLVGGPGRTVYADGAARIEVPAETIVIRPPFGL |
Ga0134062_103777912 | 3300010337 | Grasslands Soil | MARFVGRENVRKRLAGLGSEGRTVYADDAARIESGEETFVVRPPFGLAHEGSYEH |
Ga0134125_109036343 | 3300010371 | Terrestrial Soil | VPRFVGRENVRKRLAPLEGEPGRTTYADGAARIEAAGELITVRPPFGLGHAGE |
Ga0134125_122464371 | 3300010371 | Terrestrial Soil | MARFVGRENLRKRLEPLVGLPGRTMYGDGAARIEAGGEVVVVRPPF |
Ga0134122_105503021 | 3300010400 | Terrestrial Soil | VPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGEQVTVRPPFGLGHAGEY |
Ga0134123_101039301 | 3300010403 | Terrestrial Soil | VPRFVGRENVRKRLASLEGEPGRTTYADGAVRIEAADEMTTV |
Ga0120157_10026947 | 3300011994 | Permafrost | MARFVGRENVRKRLAPLEGAQGRTSYANGVVRIELPGE |
Ga0120152_10109503 | 3300012011 | Permafrost | VNTRFIGRDNVRKRLAPLEGTPGRTVYADGAVSIEAASEQLVVRPSFGLAHEGSYDSV |
Ga0120139_11128181 | 3300012019 | Permafrost | MARFVGRENVRKRLAPLEGEQGRTSYANGVVRIELPGETIVVRPPFGLAHEDEYGTG |
Ga0136631_103303401 | 3300012043 | Polar Desert Sand | MTVRFIGRDNVRKRLEPGEGAPGRTVYAGGAVRIEPDDGEPLTVRPSF |
Ga0137364_114386771 | 3300012198 | Vadose Zone Soil | VPRFVGRENVRKRLAPLSREPGRTTYADGAVRIETAGEVITVRPPF |
Ga0137383_106117362 | 3300012199 | Vadose Zone Soil | VPRFVGRENVRKRLAPLEGEPGRTAYADGEVRIDAPGELIVVRPPFGLLHQGEYE |
Ga0137382_108641161 | 3300012200 | Vadose Zone Soil | MARFVGRANVRKRLAPLEGEPGRTTYAGGEARIETARETIVVR |
Ga0137382_109013911 | 3300012200 | Vadose Zone Soil | MARYIGRENVHKRLDALETGRVVYADGAARMETAEETITVRPPFGLAHAREYKSLELG |
Ga0137365_102449653 | 3300012201 | Vadose Zone Soil | VARFVGRENLRKRLAPLEGEPGRTRYANGAARIELPGEVLVVR |
Ga0137371_108042871 | 3300012356 | Vadose Zone Soil | VARFVGRENVRKRLTPLEGQQGRTSYADGTVRIELPGEAIFVRPP |
Ga0157324_10034292 | 3300012506 | Arabidopsis Rhizosphere | MARYVGRENVRKRLEPLAGLPGRTTYADGAARIETDSETITVRPPFGLVHA |
Ga0157309_102046732 | 3300012895 | Soil | VARYVGRENVRKRFAPLEGTPGRTVYADDAARFEAGETTVVRPPF |
Ga0164300_105360081 | 3300012951 | Soil | VARYVGRENVRKRLSPLQGLPGRTTYSHGAARIETGEETITVRPPFG |
Ga0164301_108127352 | 3300012960 | Soil | VPRYVGRENVRKRLAPLEGEPGRTTYADGQVQIEAPGETVVVRPPFGLPHEGEYET |
Ga0164301_116968391 | 3300012960 | Soil | VARYVGRENVRKRLEPLVGARGRTSYGGRSARIETADETLVVTPA |
Ga0134087_103267861 | 3300012977 | Grasslands Soil | MARFVGRENVRKRLAGLGSEGRTVYADGAARIESGEETLVVRPPFGLAHEG |
Ga0164304_113289321 | 3300012986 | Soil | VARYVGRENVRKRLEPLAGARGRTSYGGRSARIETADETLVV |
Ga0164307_110048741 | 3300012987 | Soil | VARYVGRENVRKRLEPLAGLPGRTTYADAAARIETAEETITVRPPFGL |
Ga0164306_111854381 | 3300012988 | Soil | MARFVGRENLRKRLEPLAGEEGRTLYADGAARIEA |
Ga0164306_112105701 | 3300012988 | Soil | VPRFVGRENVRKRLEPLEGQPGRTTYADGAVQIETAGETITVRPSFGLPHAG |
Ga0157307_11453031 | 3300013096 | Soil | MPRYVGRENVRKRLEPLQGRPGRTTYADGAVRIETADETITVRPPFGLAHARV |
Ga0157373_107510841 | 3300013100 | Corn Rhizosphere | VPRFVGRENVRKRLAPLEGEPGRTTYAVGVVRIEAAGELIS |
Ga0157371_107080602 | 3300013102 | Corn Rhizosphere | VHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPFGLAHARAYERV |
Ga0157375_113451051 | 3300013308 | Miscanthus Rhizosphere | VARYVGRENVRKRLEPLAGTPGRTTYSKGVARIETAEETITVRPPFGLAHARVYERV |
Ga0120179_10126205 | 3300013763 | Permafrost | MARFVGRENVRKRLAPLEGEPGRTSYANGVVRIELPGEAIVVRPPFG |
Ga0120172_10086401 | 3300013765 | Permafrost | MVRFVGRENVRKRLAPLEGEQGRTSYANGVVRIELPGE |
Ga0120155_11111891 | 3300013768 | Permafrost | VARFVGRENVRKRLAPLEGEQGRTSYADGVARIELPGET |
Ga0120123_10247661 | 3300013770 | Permafrost | VRKRLGPLEGEPGRTAYAEGAVRIEAPGETITVKPPFGLAHARVYE |
Ga0075310_10353412 | 3300014302 | Natural And Restored Wetlands | VSGRWIGRANVRKRLAPREGAPGRTTYADGAVRIEPEEGERLLVRPPFGLTH |
Ga0134085_102534012 | 3300015359 | Grasslands Soil | MARYVGRENVHKRLAALEEGHVTYADGAARIETPDEAITVRPPFGLAHAREYK |
Ga0132255_1025918082 | 3300015374 | Arabidopsis Rhizosphere | VIDGEARFIGRANVRKRLAPLDGQSGRTSYADGAARIETATEEIAVRPPFGLAHVGE |
Ga0187776_100788923 | 3300017966 | Tropical Peatland | VARYVGRENLRKRLEPLESVPGRTVYAGGGARIETAEETITVRPPFGLAHE |
Ga0184623_100454455 | 3300018056 | Groundwater Sediment | MARFVGRENVRKRLAPLEGEQGRTSYANGVVRIELPGEAIVVRP |
Ga0184623_101067171 | 3300018056 | Groundwater Sediment | MRLWNRGRGGPSFVGRENVRKRLAPLEGEQGRTSYANGVVRIELPGEAIVVRP |
Ga0184623_103368613 | 3300018056 | Groundwater Sediment | VGRENVRKRLSPLEGEQGRTTYARGVARIETGTGTLVVRPPFGL |
Ga0184619_101087781 | 3300018061 | Groundwater Sediment | MATLPVRPLVPRFVGRENVRKRLAPLEAEPGRTTYADGAARIEAAGEVITVRP |
Ga0184625_106109741 | 3300018081 | Groundwater Sediment | VARYVGRENVRKRLEPLADGAGRMVYSGAAVRIETAAETITVR |
Ga0066655_105362391 | 3300018431 | Grasslands Soil | MTRYVGRENVRKRLEPLAGHPGRTVYSGGTARIETADETITVRPPFGLPHEA |
Ga0066667_108808231 | 3300018433 | Grasslands Soil | LPRFVGRENVRKRLGPLEGEPGRTTYADGLVRIEAAGEVITVRPAFGLPHAGEYRVV |
Ga0066669_116555061 | 3300018482 | Grasslands Soil | VARFVGRDNVRKRLAPLEGEPGRTTYAAGKVRIETAGEVIVVRPAFGLAHE |
Ga0184644_12148802 | 3300019269 | Groundwater Sediment | VHKRLGSLQGEPGRAVYADGAARIELPAETIIVTP |
Ga0193701_10904041 | 3300019875 | Soil | MARFVGRENLRKRLEPLVDFPGRTIYGDGAARIEAGGEVLVVRPPFGLAHSGEYE |
Ga0193745_11350591 | 3300020059 | Soil | VARYVGRENVRKRLEPLEGEQGTTSYAGGVARIALPGETIVVRPPFGLAHEQEY |
Ga0210378_102189502 | 3300021073 | Groundwater Sediment | MARFVGRENVRKRLAPLEGEQGRTSYANGVVRIELPGEAIVVR |
Ga0210382_104753021 | 3300021080 | Groundwater Sediment | MVRYVGRENVRKRLQPLAGAAGRTTYSGGVARIETAAETITVRPPFGLAHEAVYERV |
Ga0247680_10227431 | 3300024246 | Soil | VARYVGRGNVRKRLEPLAGTLGRTSYKGGSARIETADETLTVTPLF |
Ga0179589_101857981 | 3300024288 | Vadose Zone Soil | VPRFVGRENVRKRLAPLEGEPGRTAYADGEVRIDAP |
Ga0207642_103403193 | 3300025899 | Miscanthus Rhizosphere | VQRFVGRENVRKRLAPLEGEPGRTTYAVGVVRIEAAGELITVRP |
Ga0207685_103714761 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRYVGRENMRKRLAPLAGEPGRTSYRDGEVRIEAPGEQIV |
Ga0207643_110472731 | 3300025908 | Miscanthus Rhizosphere | VARYVGRENVRKRLEPLAGARGRTSYGGRSARIETADETLVVTPAFGLEHAAEYDR |
Ga0207684_109025912 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRYVGRENVRKRLAPLEGEAGRTTYADGEVRIDAPGEQIVVRPP |
Ga0207660_103087881 | 3300025917 | Corn Rhizosphere | VARYVGRGNVRKRLEPLAGTLGRTSYKGGSARIETADET |
Ga0207657_114878352 | 3300025919 | Corn Rhizosphere | VARYVGRENVRKRLEPLAGLPGRTTYSQGVARIETAEETITVRPPF |
Ga0207681_104864361 | 3300025923 | Switchgrass Rhizosphere | VHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPF |
Ga0207700_110847861 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VARYVGRENVRKRLEPLAGTLGRTSYGGGSARIETADETL |
Ga0207669_119158871 | 3300025937 | Miscanthus Rhizosphere | MAERRFIVRDNVRKRLAPLEGRPGRTVYRDGEVRLELDEETLVVRPPFGLAH |
Ga0207704_104556962 | 3300025938 | Miscanthus Rhizosphere | VARYVGRENVRKRLEPLAGLPGRTTYADGAARIETGEETIT |
Ga0207689_112766551 | 3300025942 | Miscanthus Rhizosphere | VPRFVGRENVRKRLAPLEGEPGRTIYADGAVRIEAAGEVITVRPPFG |
Ga0207667_110571542 | 3300025949 | Corn Rhizosphere | VARYVGRENVRKRLEPLAGLPGRTTYSDGAARIETGDETITVRPPFGLA |
Ga0207667_113817902 | 3300025949 | Corn Rhizosphere | VHKRLGPLEGEPGRAVYADGAARIELATETITVRPPFGLAHARVYEK |
Ga0207708_106737381 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MARFVGRENVRKRLEPLAGTPGRTTYADGAARLETADETITVRP |
Ga0207648_110292672 | 3300026089 | Miscanthus Rhizosphere | VHKRLGPLEGEPGRAVYADGVARIELATETITVRPPFGL |
Ga0209468_11861541 | 3300026306 | Soil | MARFVGRENVRKRLAPLAGEPGRTTYAGGKARIETAGELTVV |
Ga0209473_10886961 | 3300026330 | Soil | MARFVGRENVRRRLAPLAGEPGRTIYAGGEARIETAGELIVVRPPFGLAHEGE |
Ga0209814_104163231 | 3300027873 | Populus Rhizosphere | MPRYVGRENVRKRLEPLEGQPGRTTYADGAVRIETADETITVRPPFGLAHARVHE |
Ga0209382_106943382 | 3300027909 | Populus Rhizosphere | MTRYVGRENVRKRLAPLEGQPGRTVYVSGAARIETAEETITVRPPF |
Ga0268265_111505102 | 3300028380 | Switchgrass Rhizosphere | VHKRLGPLEGEPGRAVYADGAARIELATETITVRPPF |
Ga0307321_10860792 | 3300028704 | Soil | VHKRLGPLEGEPGRAVYADGAAQIELAAETITVRPPF |
Ga0307303_101887561 | 3300028713 | Soil | VARYVGRENVRKRLEPLDGVPGRTTYADGAARVETAAET |
Ga0307298_101665883 | 3300028717 | Soil | VGRENVRKRLAPLEGEQGRTRYAEGVARIELPGEIIVVRPPFGLA |
Ga0307315_100802811 | 3300028721 | Soil | VARYVGRENVRKRLEPLAGLPGRTTYADGAARIETEDETITV |
Ga0307316_101796472 | 3300028755 | Soil | VRKRLEPLAGQRGRTTYSKGAARIETADETITVRPPFGLAHA |
Ga0307316_102382851 | 3300028755 | Soil | MARYVGRENVRKRLEPLDGVPGRTTYSDGAARVETAAETITVRPPFGLAHARVYES |
Ga0307320_103304761 | 3300028771 | Soil | VHKRLGPLEGEPGRAVYADGAARIELPAETITVTPPFGL |
Ga0307306_100877682 | 3300028782 | Soil | VHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPFGLAHARVYERVEL |
Ga0307306_101816762 | 3300028782 | Soil | VPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGEVITVRPPFGLAHEGEYEVVR |
Ga0307282_100307741 | 3300028784 | Soil | VRKRLGPLEGEPGRTAYAEGAVRIEAPGETIAVRPPF |
Ga0307282_103092272 | 3300028784 | Soil | MARFVGRENVRKRLAPLEGEPGRSRYGDGEVRIETACEVIVIRLPFGLAHEGEYEAVR |
Ga0307284_102633581 | 3300028799 | Soil | VPRFVGRENVRKRLAPLEGEAGRTTYADGEARIEAAGETIVVRPPFGLAHEGEYEVVQLE |
Ga0307302_100774781 | 3300028814 | Soil | MVRYVGRENVRKRLQPLAGAAGRTTYSGGVARIETAAETITVR |
Ga0307312_104238163 | 3300028828 | Soil | VARYVGRENVRKRLEPLEGEQGTTSYAGGVARIELPGEVIVVRPPF |
Ga0307289_104269672 | 3300028875 | Soil | VARYVGRENVRKRLEPLAGQAGRTTYADGAVTIET |
Ga0307300_100877091 | 3300028880 | Soil | VGRENVRKRFEPLVGQAGRTTYVDGAVTIETGEETIV |
Ga0307277_102597651 | 3300028881 | Soil | VSRFVGRENVRKRLAPLEGEQGRTSYADGMVRIELSGQTIVVRPPFGLPHEH |
Ga0307277_103470283 | 3300028881 | Soil | MARFVGRDNLRRRLAALEGERGRTRYADGAVRIELAAEV |
Ga0307277_104589631 | 3300028881 | Soil | MARFVGRENLRKRLAPLAGEEGRTLYADGAARIEAGGDVVI |
Ga0308204_101877121 | 3300031092 | Soil | VHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPFGLAHAR |
Ga0310813_121210221 | 3300031716 | Soil | VPRFVGRENVRKRLASLDGEPGRTAYADGAVRIEAAGEVIAVRPP |
Ga0307405_102173423 | 3300031731 | Rhizosphere | MPRYVGRENVRKRLEPLAGQPGRTTYGDGAARIETADETITVRP |
Ga0307468_1020225711 | 3300031740 | Hardwood Forest Soil | VPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGELITVRPPF |
Ga0310884_104291061 | 3300031944 | Soil | VARYVGRENVRKRLEPLAGTLGRTSYGGGSARIETADETLV |
Ga0310906_101623373 | 3300032013 | Soil | VPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGELITVRPPFGL |
Ga0310890_111510031 | 3300032075 | Soil | VARYVGRENVRKRLEPLAGARGRTSYGGRSARIETADETLVVTPAFGLE |
Ga0268251_10000007162 | 3300032159 | Agave | MGRFVGRENVRKRLATLEGEQGRTIYADGAARLELPDVRVGA |
Ga0247829_107759251 | 3300033550 | Soil | VHKRLGPLEGEPGRAVYADGAARIELATETITVRPPFGLAHARVYDE |
Ga0247830_110391102 | 3300033551 | Soil | LAAERRYVGRANVRKRLAPLDGTPGRTLYADGAVRIEPDDGEPLVVTPPFGLAHAREYP |
Ga0334962_031264_544_687 | 3300034144 | Sub-Biocrust Soil | MRRFLGRENVRKRLAPLEGAPGRTIYADGAARIETARESLLVRPPFGL |
⦗Top⦘ |