NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047346

Metagenome / Metatranscriptome Family F047346

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047346
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 46 residues
Representative Sequence VPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGELITVRPPF
Number of Associated Samples 132
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 63.31 %
% of genes near scaffold ends (potentially truncated) 91.33 %
% of genes from short scaffolds (< 2000 bps) 85.33 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.333 % of family members)
Environment Ontology (ENVO) Unclassified
(29.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.86%    β-sheet: 22.97%    Coil/Unstructured: 62.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF00892EamA 27.33
PF01292Ni_hydr_CYTB 14.67
PF00903Glyoxalase 8.67
PF01713Smr 5.33
PF06262Zincin_1 5.33
PF00033Cytochrome_B 4.67
PF00174Oxidored_molyb 3.33
PF00248Aldo_ket_red 2.00
PF12681Glyoxalase_2 1.33
PF00795CN_hydrolase 0.67
PF00155Aminotran_1_2 0.67
PF08940DUF1918 0.67
PF00211Guanylate_cyc 0.67
PF00872Transposase_mut 0.67
PF01061ABC2_membrane 0.67
PF00480ROK 0.67
PF08352oligo_HPY 0.67
PF12704MacB_PCD 0.67
PF07690MFS_1 0.67
PF02617ClpS 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 14.67
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 14.67
COG3038Cytochrome b561Energy production and conversion [C] 14.67
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 14.67
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 14.67
COG3824Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domainPosttranslational modification, protein turnover, chaperones [O] 5.33
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 4.67
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 3.33
COG3915Uncharacterized conserved proteinFunction unknown [S] 3.33
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.33
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.67
COG2127ATP-dependent Clp protease adapter protein ClpSPosttranslational modification, protein turnover, chaperones [O] 0.67
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.33 %
UnclassifiedrootN/A30.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725004|GPKC_F5V46DG01B526GAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
2228664021|ICCgaii200_c0778780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300001686|C688J18823_11025394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300004006|Ga0055453_10145089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria725Open in IMG/M
3300004114|Ga0062593_100823718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300004643|Ga0062591_102185599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300005186|Ga0066676_10266677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1123Open in IMG/M
3300005186|Ga0066676_10376107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria954Open in IMG/M
3300005186|Ga0066676_10411723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis913Open in IMG/M
3300005337|Ga0070682_101947757Not Available516Open in IMG/M
3300005434|Ga0070709_10666730Not Available807Open in IMG/M
3300005436|Ga0070713_101584174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300005438|Ga0070701_10701583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300005444|Ga0070694_100290410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis1250Open in IMG/M
3300005458|Ga0070681_11636130Not Available570Open in IMG/M
3300005459|Ga0068867_101007308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria756Open in IMG/M
3300005526|Ga0073909_10574847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300005540|Ga0066697_10592929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300005545|Ga0070695_101599685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300005549|Ga0070704_100799507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300005549|Ga0070704_101605804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300005556|Ga0066707_10279963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1091Open in IMG/M
3300005561|Ga0066699_10156435All Organisms → cellular organisms → Bacteria1559Open in IMG/M
3300005562|Ga0058697_10000270All Organisms → cellular organisms → Bacteria24879Open in IMG/M
3300005562|Ga0058697_10787444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300005718|Ga0068866_10493106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium809Open in IMG/M
3300006032|Ga0066696_10828948Not Available590Open in IMG/M
3300006034|Ga0066656_10746542Not Available627Open in IMG/M
3300006046|Ga0066652_101988948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300006163|Ga0070715_10035952All Organisms → cellular organisms → Bacteria2040Open in IMG/M
3300006237|Ga0097621_101817997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300006797|Ga0066659_11231929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium624Open in IMG/M
3300006845|Ga0075421_101783244Not Available663Open in IMG/M
3300009012|Ga0066710_100333817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2235Open in IMG/M
3300009094|Ga0111539_11875234Not Available695Open in IMG/M
3300009098|Ga0105245_10368323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1428Open in IMG/M
3300009098|Ga0105245_10746526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300009100|Ga0075418_11101726Not Available860Open in IMG/M
3300009137|Ga0066709_100122268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3256Open in IMG/M
3300009147|Ga0114129_10176781All Organisms → cellular organisms → Bacteria2907Open in IMG/M
3300009147|Ga0114129_12396370Not Available632Open in IMG/M
3300009176|Ga0105242_12363049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300009840|Ga0126313_10453214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1023Open in IMG/M
3300010039|Ga0126309_11255680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300010041|Ga0126312_10975939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300010042|Ga0126314_11380119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium529Open in IMG/M
3300010337|Ga0134062_10377791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300010371|Ga0134125_10903634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis970Open in IMG/M
3300010371|Ga0134125_12246437Not Available593Open in IMG/M
3300010400|Ga0134122_10550302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis1055Open in IMG/M
3300010403|Ga0134123_10103930All Organisms → cellular organisms → Bacteria2267Open in IMG/M
3300011994|Ga0120157_1002694All Organisms → cellular organisms → Bacteria5973Open in IMG/M
3300012011|Ga0120152_1010950All Organisms → cellular organisms → Bacteria3861Open in IMG/M
3300012019|Ga0120139_1112818Not Available689Open in IMG/M
3300012043|Ga0136631_10330340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300012198|Ga0137364_11438677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300012199|Ga0137383_10611736Not Available797Open in IMG/M
3300012200|Ga0137382_10864116Not Available652Open in IMG/M
3300012200|Ga0137382_10901391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300012201|Ga0137365_10244965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1334Open in IMG/M
3300012356|Ga0137371_10804287Not Available716Open in IMG/M
3300012506|Ga0157324_1003429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1038Open in IMG/M
3300012895|Ga0157309_10204673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300012951|Ga0164300_10536008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300012960|Ga0164301_10812735Not Available716Open in IMG/M
3300012960|Ga0164301_11696839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300012977|Ga0134087_10326786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300012986|Ga0164304_11328932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300012987|Ga0164307_11004874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300012988|Ga0164306_11185438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300012988|Ga0164306_11210570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300013096|Ga0157307_1145303Not Available547Open in IMG/M
3300013100|Ga0157373_10751084Not Available717Open in IMG/M
3300013102|Ga0157371_10708060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium754Open in IMG/M
3300013308|Ga0157375_11345105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300013763|Ga0120179_1012620All Organisms → cellular organisms → Bacteria → Terrabacteria group2158Open in IMG/M
3300013765|Ga0120172_1008640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3363Open in IMG/M
3300013768|Ga0120155_1111189Not Available760Open in IMG/M
3300014302|Ga0075310_1035341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria943Open in IMG/M
3300015359|Ga0134085_10253401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300015374|Ga0132255_102591808Not Available775Open in IMG/M
3300017966|Ga0187776_10078892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1923Open in IMG/M
3300018056|Ga0184623_10045445All Organisms → cellular organisms → Bacteria1998Open in IMG/M
3300018056|Ga0184623_10106717Not Available1295Open in IMG/M
3300018056|Ga0184623_10336861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300018061|Ga0184619_10108778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis1249Open in IMG/M
3300018081|Ga0184625_10610974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300018431|Ga0066655_10536239Not Available780Open in IMG/M
3300018433|Ga0066667_10880823Not Available769Open in IMG/M
3300018482|Ga0066669_11655506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300019875|Ga0193701_1090404Not Available581Open in IMG/M
3300020059|Ga0193745_1135059Not Available505Open in IMG/M
3300021073|Ga0210378_10218950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300021080|Ga0210382_10475302Not Available554Open in IMG/M
3300024246|Ga0247680_1022743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria907Open in IMG/M
3300024288|Ga0179589_10185798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis903Open in IMG/M
3300025899|Ga0207642_10340319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium882Open in IMG/M
3300025905|Ga0207685_10371476Not Available726Open in IMG/M
3300025908|Ga0207643_11047273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300025910|Ga0207684_10902591Not Available743Open in IMG/M
3300025917|Ga0207660_10308788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1261Open in IMG/M
3300025919|Ga0207657_11487835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300025928|Ga0207700_11084786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300025937|Ga0207669_11915887Not Available507Open in IMG/M
3300025938|Ga0207704_10455696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1022Open in IMG/M
3300025942|Ga0207689_11276655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300025949|Ga0207667_11057154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria797Open in IMG/M
3300025949|Ga0207667_11381790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium678Open in IMG/M
3300026075|Ga0207708_10673738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria882Open in IMG/M
3300026306|Ga0209468_1186154Not Available525Open in IMG/M
3300026330|Ga0209473_1088696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1298Open in IMG/M
3300027873|Ga0209814_10416323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300027909|Ga0209382_10694338Not Available1096Open in IMG/M
3300028713|Ga0307303_10188756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300028717|Ga0307298_10166588Not Available643Open in IMG/M
3300028721|Ga0307315_10080281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria941Open in IMG/M
3300028755|Ga0307316_10179647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300028755|Ga0307316_10238285All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300028782|Ga0307306_10087768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium817Open in IMG/M
3300028782|Ga0307306_10181676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300028784|Ga0307282_10309227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia762Open in IMG/M
3300028799|Ga0307284_10263358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300028814|Ga0307302_10077478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1572Open in IMG/M
3300028828|Ga0307312_10423816Not Available875Open in IMG/M
3300028875|Ga0307289_10426967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300028880|Ga0307300_10087709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria926Open in IMG/M
3300028881|Ga0307277_10259765Not Available767Open in IMG/M
3300028881|Ga0307277_10347028Not Available661Open in IMG/M
3300028881|Ga0307277_10458963Not Available571Open in IMG/M
3300031716|Ga0310813_12121022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300031731|Ga0307405_10217342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1400Open in IMG/M
3300031740|Ga0307468_102022571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300031944|Ga0310884_10429106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300032013|Ga0310906_10162337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis1317Open in IMG/M
3300032075|Ga0310890_11151003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300032159|Ga0268251_10000007All Organisms → cellular organisms → Bacteria328409Open in IMG/M
3300033550|Ga0247829_10775925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium798Open in IMG/M
3300033551|Ga0247830_11039110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300034144|Ga0334962_031264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.67%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.67%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.67%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.33%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.67%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.67%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.67%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.67%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.67%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725004Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011994Permafrost microbial communities from Nunavut, Canada - A7_65cm_12MEnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012506Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610Host-AssociatedOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014302Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300024246Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034144Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 58SNSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKC_043480402067725004SoilMARYVGRENVRKRLEPLAGGPGRTTYADGAARIETD
ICCgaii200_077878022228664021SoilVPRFVGRENVRKRLAPLEGEPGRMTYADGAAQIETAD
C688J18823_1102539423300001686SoilVRSVARYVGRENVRKRLEPLVGAPGRTTYADGAARIEIADETITVRP
Ga0055453_1014508913300004006Natural And Restored WetlandsMARYIGRENVRKRLEPLAEGRSTYADGAVRIETSDGTITVRPPF
Ga0062593_10082371813300004114SoilVARYVGRENVRKRLQPLGGGPGRTSYGGGSARIETADETL
Ga0062591_10218559923300004643SoilVARYVGRENVRKRFAPLEGTPGRTVYADDAARFEAGETTV
Ga0066676_1026667713300005186SoilMPRYVGRENVRKRLDAIDEGRVVYAEGAARIETPDETITVRPPFGLAHARV
Ga0066676_1037610713300005186SoilMARFVGRENVRKRLAPLAGEPGRTIYAGGEARIDTAGELIVVRPPFGLAHEGEYEVV
Ga0066676_1041172313300005186SoilLPRFVGRENVRKRLGPLEGEPGRTTYADGVVRIEAAGEVITVRPPFGLP
Ga0070682_10194775723300005337Corn RhizosphereMARYVGRENVRKRLEPLAGLSGRTTYADGAARIETGNETITVRPPFGLAHARVY
Ga0070709_1066673013300005434Corn, Switchgrass And Miscanthus RhizosphereVPRYVGRENVRKRLAPLQGEPGRTTYADGEVRIEAPGEQIVVR
Ga0070713_10158417423300005436Corn, Switchgrass And Miscanthus RhizosphereVPRFVGRENVRKRLAPLEGEPGRTTYADGEVRIEAPGEQIVVRPSF
Ga0070701_1070158313300005438Corn, Switchgrass And Miscanthus RhizosphereVARYVGRENVRKRLEPLAGQAGRTTYADGAATLETADETIT
Ga0070700_10057303633300005441Corn, Switchgrass And Miscanthus RhizosphereVHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPFGLA
Ga0070694_10029041033300005444Corn, Switchgrass And Miscanthus RhizosphereVPRFVGRENVRKRLAPLEGEPGRTVYADGAVRIEAASEVITVRPPFGLPHAGE
Ga0070681_1163613023300005458Corn RhizosphereMARYVGRENVRKRLEPLAGAAGRTTYGEGAARIETADETIT
Ga0068867_10100730813300005459Miscanthus RhizosphereVARYVGRENVRKRLEPLAGLPGRTTYADGAARIETGDETITVRPPFGLAHARVY
Ga0073909_1057484723300005526Surface SoilMARYVGRENVRKRLEPLAGLPGRTTYGDGSVRIQTDDETITVRPPFGLAHARVYES
Ga0066697_1059292913300005540SoilVARFVGRDNVRKRLAPLEGEPGRTSYSDGEARIEAAGEVIVVRPP
Ga0070695_10159968523300005545Corn, Switchgrass And Miscanthus RhizosphereVARYVGRENVRKRLEPLAGLPGRTTYADGAARIETGNETITVRPPFGLAHAR
Ga0070704_10079950713300005549Corn, Switchgrass And Miscanthus RhizosphereVQRFVGRENVRKRLAPLEGEPGRTTYAVGVVRIEAAGELISVRPPFGLAHAGEYEVV
Ga0070704_10160580413300005549Corn, Switchgrass And Miscanthus RhizosphereVARYVGRENVRKRLEPLAGLPGRTTYADGSARIETGNETITVRPPFGL
Ga0066707_1027996313300005556SoilVRKRLAGLEEGRTVYADGAARIESGGETLVVRPPFGLAHEGEYDRVELGPL
Ga0066699_1015643543300005561SoilVARFVGRDNVRKRLAPLEGEPGRTSYSDGAARIEAGGEVITVRPPFGL
Ga0058697_10000270173300005562AgaveMGRFVGRENVRKRLATLEGEQGRTIYADGAARLELPDVRVGA*
Ga0058697_1078744423300005562AgaveMPRYVGRENVRKRLEPLEGQPGRTIYADGAVSIETV
Ga0068866_1049310633300005718Miscanthus RhizosphereVHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPFGLAHARVYER
Ga0066696_1082894813300006032SoilMARFVGRENLRKRLAPLEGGPGRASYADGSLRIETAG
Ga0066656_1074654213300006034SoilMARFVGRENVRKRLAPLAGEPGRTTYAGGKARIETAGELIVVRPPFGLAHEGEYEVV
Ga0066652_10198894823300006046SoilMARYIGRENVRKRLAALEEGRVVYADGAARIETEGETITVRP
Ga0070715_1003595243300006163Corn, Switchgrass And Miscanthus RhizosphereVPRFVGRENVRKRLAPLEGEPGRTTYAVGVVRIEAAGE
Ga0097621_10181799723300006237Miscanthus RhizosphereMARYVGRENVRKRLEPLAGAAGRTTYGEGAARIETAD
Ga0074056_1032928513300006574SoilVRKRLSPLEGEPGRTGYADGVVRIETPAEAIAVRPPFGLA
Ga0066659_1123192913300006797SoilVPRFVGRENVRKRLAPLEGEPGRTAYADGEVHIDAPGELIGVRPPFGL
Ga0075421_10178324413300006845Populus RhizosphereMTRYVGRENVRKRLAPLEGQPGRTVYVSGAARIETAEETITVRPP
Ga0066710_10033381743300009012Grasslands SoilVGRENVAKRLSQLEGGRAVYAGGSARFETPVETITVRPPFGLAHE
Ga0111539_1187523423300009094Populus RhizosphereMARYVGRENVRKRLAPLEGQPGRTVYAGGTARIETADETITVG
Ga0105245_1036832333300009098Miscanthus RhizosphereVPRFVGRENVRKRLAPLEGEPGRTVYADGAVRIEAASEVITVRPPFGLPHAGEY
Ga0105245_1074652623300009098Miscanthus RhizosphereMARYVGRENVRKRLEPLAGAAGRTTYGQGAARIETADETITVRPPFGLAHARVYELV
Ga0075418_1110172623300009100Populus RhizosphereMARYVGRENVRKRLAALEGKPGRTVYAGGTARIET
Ga0066709_10012226853300009137Grasslands SoilMARYIGRENVRKRLEPLREGRTTYSGGAVRIETPDETITVRPPFGLAREGAYDRIEL
Ga0114129_1017678153300009147Populus RhizosphereVPRFVGRENVRKRLAPLEGEPGRTTYADGAARIETTNEVITVR
Ga0114129_1239637023300009147Populus RhizosphereVPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGEQIT
Ga0105242_1236304923300009176Miscanthus RhizosphereVPRFVGRENVRKRLAPLEGGPGRTVYADGAVRIEAASEVITVRPPFGLA
Ga0126313_1045321433300009840Serpentine SoilMARFVGRENVRKRLAPLAGGPGRTVYADGAVRIEVPAETIVVRPPFGLAYAGEYESV
Ga0126309_1125568013300010039Serpentine SoilMSRFIGRDNVRKRLAPLDGAPGRTTYTDGAVRIEPENGESLVVRPPFG
Ga0126312_1097593913300010041Serpentine SoilVTRRYIGRDNVRKRLEWLEGSPGRTTYADGAVLVEPEHGEALVVR
Ga0126314_1138011913300010042Serpentine SoilMARFVGRENVRKRLAPLVGGPGRTVYADGAARIEVPAETIVIRPPFGL
Ga0134062_1037779123300010337Grasslands SoilMARFVGRENVRKRLAGLGSEGRTVYADDAARIESGEETFVVRPPFGLAHEGSYEH
Ga0134125_1090363433300010371Terrestrial SoilVPRFVGRENVRKRLAPLEGEPGRTTYADGAARIEAAGELITVRPPFGLGHAGE
Ga0134125_1224643713300010371Terrestrial SoilMARFVGRENLRKRLEPLVGLPGRTMYGDGAARIEAGGEVVVVRPPF
Ga0134122_1055030213300010400Terrestrial SoilVPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGEQVTVRPPFGLGHAGEY
Ga0134123_1010393013300010403Terrestrial SoilVPRFVGRENVRKRLASLEGEPGRTTYADGAVRIEAADEMTTV
Ga0120157_100269473300011994PermafrostMARFVGRENVRKRLAPLEGAQGRTSYANGVVRIELPGE
Ga0120152_101095033300012011PermafrostVNTRFIGRDNVRKRLAPLEGTPGRTVYADGAVSIEAASEQLVVRPSFGLAHEGSYDSV
Ga0120139_111281813300012019PermafrostMARFVGRENVRKRLAPLEGEQGRTSYANGVVRIELPGETIVVRPPFGLAHEDEYGTG
Ga0136631_1033034013300012043Polar Desert SandMTVRFIGRDNVRKRLEPGEGAPGRTVYAGGAVRIEPDDGEPLTVRPSF
Ga0137364_1143867713300012198Vadose Zone SoilVPRFVGRENVRKRLAPLSREPGRTTYADGAVRIETAGEVITVRPPF
Ga0137383_1061173623300012199Vadose Zone SoilVPRFVGRENVRKRLAPLEGEPGRTAYADGEVRIDAPGELIVVRPPFGLLHQGEYE
Ga0137382_1086411613300012200Vadose Zone SoilMARFVGRANVRKRLAPLEGEPGRTTYAGGEARIETARETIVVR
Ga0137382_1090139113300012200Vadose Zone SoilMARYIGRENVHKRLDALETGRVVYADGAARMETAEETITVRPPFGLAHAREYKSLELG
Ga0137365_1024496533300012201Vadose Zone SoilVARFVGRENLRKRLAPLEGEPGRTRYANGAARIELPGEVLVVR
Ga0137371_1080428713300012356Vadose Zone SoilVARFVGRENVRKRLTPLEGQQGRTSYADGTVRIELPGEAIFVRPP
Ga0157324_100342923300012506Arabidopsis RhizosphereMARYVGRENVRKRLEPLAGLPGRTTYADGAARIETDSETITVRPPFGLVHA
Ga0157309_1020467323300012895SoilVARYVGRENVRKRFAPLEGTPGRTVYADDAARFEAGETTVVRPPF
Ga0164300_1053600813300012951SoilVARYVGRENVRKRLSPLQGLPGRTTYSHGAARIETGEETITVRPPFG
Ga0164301_1081273523300012960SoilVPRYVGRENVRKRLAPLEGEPGRTTYADGQVQIEAPGETVVVRPPFGLPHEGEYET
Ga0164301_1169683913300012960SoilVARYVGRENVRKRLEPLVGARGRTSYGGRSARIETADETLVVTPA
Ga0134087_1032678613300012977Grasslands SoilMARFVGRENVRKRLAGLGSEGRTVYADGAARIESGEETLVVRPPFGLAHEG
Ga0164304_1132893213300012986SoilVARYVGRENVRKRLEPLAGARGRTSYGGRSARIETADETLVV
Ga0164307_1100487413300012987SoilVARYVGRENVRKRLEPLAGLPGRTTYADAAARIETAEETITVRPPFGL
Ga0164306_1118543813300012988SoilMARFVGRENLRKRLEPLAGEEGRTLYADGAARIEA
Ga0164306_1121057013300012988SoilVPRFVGRENVRKRLEPLEGQPGRTTYADGAVQIETAGETITVRPSFGLPHAG
Ga0157307_114530313300013096SoilMPRYVGRENVRKRLEPLQGRPGRTTYADGAVRIETADETITVRPPFGLAHARV
Ga0157373_1075108413300013100Corn RhizosphereVPRFVGRENVRKRLAPLEGEPGRTTYAVGVVRIEAAGELIS
Ga0157371_1070806023300013102Corn RhizosphereVHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPFGLAHARAYERV
Ga0157375_1134510513300013308Miscanthus RhizosphereVARYVGRENVRKRLEPLAGTPGRTTYSKGVARIETAEETITVRPPFGLAHARVYERV
Ga0120179_101262053300013763PermafrostMARFVGRENVRKRLAPLEGEPGRTSYANGVVRIELPGEAIVVRPPFG
Ga0120172_100864013300013765PermafrostMVRFVGRENVRKRLAPLEGEQGRTSYANGVVRIELPGE
Ga0120155_111118913300013768PermafrostVARFVGRENVRKRLAPLEGEQGRTSYADGVARIELPGET
Ga0120123_102476613300013770PermafrostVRKRLGPLEGEPGRTAYAEGAVRIEAPGETITVKPPFGLAHARVYE
Ga0075310_103534123300014302Natural And Restored WetlandsVSGRWIGRANVRKRLAPREGAPGRTTYADGAVRIEPEEGERLLVRPPFGLTH
Ga0134085_1025340123300015359Grasslands SoilMARYVGRENVHKRLAALEEGHVTYADGAARIETPDEAITVRPPFGLAHAREYK
Ga0132255_10259180823300015374Arabidopsis RhizosphereVIDGEARFIGRANVRKRLAPLDGQSGRTSYADGAARIETATEEIAVRPPFGLAHVGE
Ga0187776_1007889233300017966Tropical PeatlandVARYVGRENLRKRLEPLESVPGRTVYAGGGARIETAEETITVRPPFGLAHE
Ga0184623_1004544553300018056Groundwater SedimentMARFVGRENVRKRLAPLEGEQGRTSYANGVVRIELPGEAIVVRP
Ga0184623_1010671713300018056Groundwater SedimentMRLWNRGRGGPSFVGRENVRKRLAPLEGEQGRTSYANGVVRIELPGEAIVVRP
Ga0184623_1033686133300018056Groundwater SedimentVGRENVRKRLSPLEGEQGRTTYARGVARIETGTGTLVVRPPFGL
Ga0184619_1010877813300018061Groundwater SedimentMATLPVRPLVPRFVGRENVRKRLAPLEAEPGRTTYADGAARIEAAGEVITVRP
Ga0184625_1061097413300018081Groundwater SedimentVARYVGRENVRKRLEPLADGAGRMVYSGAAVRIETAAETITVR
Ga0066655_1053623913300018431Grasslands SoilMTRYVGRENVRKRLEPLAGHPGRTVYSGGTARIETADETITVRPPFGLPHEA
Ga0066667_1088082313300018433Grasslands SoilLPRFVGRENVRKRLGPLEGEPGRTTYADGLVRIEAAGEVITVRPAFGLPHAGEYRVV
Ga0066669_1165550613300018482Grasslands SoilVARFVGRDNVRKRLAPLEGEPGRTTYAAGKVRIETAGEVIVVRPAFGLAHE
Ga0184644_121488023300019269Groundwater SedimentVHKRLGSLQGEPGRAVYADGAARIELPAETIIVTP
Ga0193701_109040413300019875SoilMARFVGRENLRKRLEPLVDFPGRTIYGDGAARIEAGGEVLVVRPPFGLAHSGEYE
Ga0193745_113505913300020059SoilVARYVGRENVRKRLEPLEGEQGTTSYAGGVARIALPGETIVVRPPFGLAHEQEY
Ga0210378_1021895023300021073Groundwater SedimentMARFVGRENVRKRLAPLEGEQGRTSYANGVVRIELPGEAIVVR
Ga0210382_1047530213300021080Groundwater SedimentMVRYVGRENVRKRLQPLAGAAGRTTYSGGVARIETAAETITVRPPFGLAHEAVYERV
Ga0247680_102274313300024246SoilVARYVGRGNVRKRLEPLAGTLGRTSYKGGSARIETADETLTVTPLF
Ga0179589_1018579813300024288Vadose Zone SoilVPRFVGRENVRKRLAPLEGEPGRTAYADGEVRIDAP
Ga0207642_1034031933300025899Miscanthus RhizosphereVQRFVGRENVRKRLAPLEGEPGRTTYAVGVVRIEAAGELITVRP
Ga0207685_1037147613300025905Corn, Switchgrass And Miscanthus RhizosphereVPRYVGRENMRKRLAPLAGEPGRTSYRDGEVRIEAPGEQIV
Ga0207643_1104727313300025908Miscanthus RhizosphereVARYVGRENVRKRLEPLAGARGRTSYGGRSARIETADETLVVTPAFGLEHAAEYDR
Ga0207684_1090259123300025910Corn, Switchgrass And Miscanthus RhizosphereVPRYVGRENVRKRLAPLEGEAGRTTYADGEVRIDAPGEQIVVRPP
Ga0207660_1030878813300025917Corn RhizosphereVARYVGRGNVRKRLEPLAGTLGRTSYKGGSARIETADET
Ga0207657_1148783523300025919Corn RhizosphereVARYVGRENVRKRLEPLAGLPGRTTYSQGVARIETAEETITVRPPF
Ga0207681_1048643613300025923Switchgrass RhizosphereVHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPF
Ga0207700_1108478613300025928Corn, Switchgrass And Miscanthus RhizosphereVARYVGRENVRKRLEPLAGTLGRTSYGGGSARIETADETL
Ga0207669_1191588713300025937Miscanthus RhizosphereMAERRFIVRDNVRKRLAPLEGRPGRTVYRDGEVRLELDEETLVVRPPFGLAH
Ga0207704_1045569623300025938Miscanthus RhizosphereVARYVGRENVRKRLEPLAGLPGRTTYADGAARIETGEETIT
Ga0207689_1127665513300025942Miscanthus RhizosphereVPRFVGRENVRKRLAPLEGEPGRTIYADGAVRIEAAGEVITVRPPFG
Ga0207667_1105715423300025949Corn RhizosphereVARYVGRENVRKRLEPLAGLPGRTTYSDGAARIETGDETITVRPPFGLA
Ga0207667_1138179023300025949Corn RhizosphereVHKRLGPLEGEPGRAVYADGAARIELATETITVRPPFGLAHARVYEK
Ga0207708_1067373813300026075Corn, Switchgrass And Miscanthus RhizosphereMARFVGRENVRKRLEPLAGTPGRTTYADGAARLETADETITVRP
Ga0207648_1102926723300026089Miscanthus RhizosphereVHKRLGPLEGEPGRAVYADGVARIELATETITVRPPFGL
Ga0209468_118615413300026306SoilMARFVGRENVRKRLAPLAGEPGRTTYAGGKARIETAGELTVV
Ga0209473_108869613300026330SoilMARFVGRENVRRRLAPLAGEPGRTIYAGGEARIETAGELIVVRPPFGLAHEGE
Ga0209814_1041632313300027873Populus RhizosphereMPRYVGRENVRKRLEPLEGQPGRTTYADGAVRIETADETITVRPPFGLAHARVHE
Ga0209382_1069433823300027909Populus RhizosphereMTRYVGRENVRKRLAPLEGQPGRTVYVSGAARIETAEETITVRPPF
Ga0268265_1115051023300028380Switchgrass RhizosphereVHKRLGPLEGEPGRAVYADGAARIELATETITVRPPF
Ga0307321_108607923300028704SoilVHKRLGPLEGEPGRAVYADGAAQIELAAETITVRPPF
Ga0307303_1018875613300028713SoilVARYVGRENVRKRLEPLDGVPGRTTYADGAARVETAAET
Ga0307298_1016658833300028717SoilVGRENVRKRLAPLEGEQGRTRYAEGVARIELPGEIIVVRPPFGLA
Ga0307315_1008028113300028721SoilVARYVGRENVRKRLEPLAGLPGRTTYADGAARIETEDETITV
Ga0307316_1017964723300028755SoilVRKRLEPLAGQRGRTTYSKGAARIETADETITVRPPFGLAHA
Ga0307316_1023828513300028755SoilMARYVGRENVRKRLEPLDGVPGRTTYSDGAARVETAAETITVRPPFGLAHARVYES
Ga0307320_1033047613300028771SoilVHKRLGPLEGEPGRAVYADGAARIELPAETITVTPPFGL
Ga0307306_1008776823300028782SoilVHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPFGLAHARVYERVEL
Ga0307306_1018167623300028782SoilVPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGEVITVRPPFGLAHEGEYEVVR
Ga0307282_1003077413300028784SoilVRKRLGPLEGEPGRTAYAEGAVRIEAPGETIAVRPPF
Ga0307282_1030922723300028784SoilMARFVGRENVRKRLAPLEGEPGRSRYGDGEVRIETACEVIVIRLPFGLAHEGEYEAVR
Ga0307284_1026335813300028799SoilVPRFVGRENVRKRLAPLEGEAGRTTYADGEARIEAAGETIVVRPPFGLAHEGEYEVVQLE
Ga0307302_1007747813300028814SoilMVRYVGRENVRKRLQPLAGAAGRTTYSGGVARIETAAETITVR
Ga0307312_1042381633300028828SoilVARYVGRENVRKRLEPLEGEQGTTSYAGGVARIELPGEVIVVRPPF
Ga0307289_1042696723300028875SoilVARYVGRENVRKRLEPLAGQAGRTTYADGAVTIET
Ga0307300_1008770913300028880SoilVGRENVRKRFEPLVGQAGRTTYVDGAVTIETGEETIV
Ga0307277_1025976513300028881SoilVSRFVGRENVRKRLAPLEGEQGRTSYADGMVRIELSGQTIVVRPPFGLPHEH
Ga0307277_1034702833300028881SoilMARFVGRDNLRRRLAALEGERGRTRYADGAVRIELAAEV
Ga0307277_1045896313300028881SoilMARFVGRENLRKRLAPLAGEEGRTLYADGAARIEAGGDVVI
Ga0308204_1018771213300031092SoilVHKRLGPLEGEPGRAVYADGAARIELAAETITVRPPFGLAHAR
Ga0310813_1212102213300031716SoilVPRFVGRENVRKRLASLDGEPGRTAYADGAVRIEAAGEVIAVRPP
Ga0307405_1021734233300031731RhizosphereMPRYVGRENVRKRLEPLAGQPGRTTYGDGAARIETADETITVRP
Ga0307468_10202257113300031740Hardwood Forest SoilVPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGELITVRPPF
Ga0310884_1042910613300031944SoilVARYVGRENVRKRLEPLAGTLGRTSYGGGSARIETADETLV
Ga0310906_1016233733300032013SoilVPRFVGRENVRKRLAPLEGEPGRTTYADGAVRIEAAGELITVRPPFGL
Ga0310890_1115100313300032075SoilVARYVGRENVRKRLEPLAGARGRTSYGGRSARIETADETLVVTPAFGLE
Ga0268251_100000071623300032159AgaveMGRFVGRENVRKRLATLEGEQGRTIYADGAARLELPDVRVGA
Ga0247829_1077592513300033550SoilVHKRLGPLEGEPGRAVYADGAARIELATETITVRPPFGLAHARVYDE
Ga0247830_1103911023300033551SoilLAAERRYVGRANVRKRLAPLDGTPGRTLYADGAVRIEPDDGEPLVVTPPFGLAHAREYP
Ga0334962_031264_544_6873300034144Sub-Biocrust SoilMRRFLGRENVRKRLAPLEGAPGRTIYADGAARIETARESLLVRPPFGL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.