| Basic Information | |
|---|---|
| Family ID | F047218 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSSDTGTRQLADGLPGYRLVRREDVELAPALPGRSSGLTTCRLV |
| Number of Associated Samples | 141 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 27.33 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (88.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.17% β-sheet: 2.78% Coil/Unstructured: 93.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF00557 | Peptidase_M24 | 90.00 |
| PF14833 | NAD_binding_11 | 4.00 |
| PF01321 | Creatinase_N | 1.33 |
| PF07883 | Cupin_2 | 0.67 |
| PF00196 | GerE | 0.67 |
| PF01293 | PEPCK_ATP | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 1.33 |
| COG1866 | Phosphoenolpyruvate carboxykinase, ATP-dependent | Energy production and conversion [C] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 88.00 % |
| All Organisms | root | All Organisms | 12.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.33% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.67% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 2.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.33% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.33% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.33% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.33% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.67% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.67% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.67% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.67% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.67% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725002 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Host-Associated | Open in IMG/M |
| 3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
| 3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICC_03394570 | 2067725002 | Soil | VSGDTGTHELADGRPGYRLVRREDAVLADALPGRSSGLTSCRLVDGSL |
| ARcpr5yngRDRAFT_0062782 | 3300000043 | Arabidopsis Rhizosphere | VSSETGTRTLADGRPAYRLVRREEIELADALPGRSSGLNTCRLVDGP |
| Ga0055453_102603702 | 3300004006 | Natural And Restored Wetlands | VTGDTGTRALADGRPGYRLVRREDVVLADALPGRSTGLTTCRLVDGTLGST |
| Ga0055493_101542702 | 3300004049 | Natural And Restored Wetlands | VSSDTGTRQLADGLPGYRLVRREDIELRPALPGNASGLTT |
| Ga0055485_102512981 | 3300004067 | Natural And Restored Wetlands | VSSDTGTRQLADGLPGYRLVRREDIELRPALPGNASGLTTCRLVDGSL |
| Ga0063455_1007322852 | 3300004153 | Soil | MTDSGTRELADGRPSYRLVRREDVELADALPGHSSGLTTCR |
| Ga0062589_1012471281 | 3300004156 | Soil | VTDSGTHELADGLPGYRLVRREDVELAPGLPGRWSGLTSCRLVGGSLGS |
| Ga0062595_1004222391 | 3300004479 | Soil | VSGDSGTRQLADGMPAYRLVRREDVELADALPGHASGLRTCRLV |
| Ga0062592_1025975292 | 3300004480 | Soil | MTGETGTHELADGRPGYRLVRREDIELGDALPGRSSGLTTCRLVDG |
| Ga0062591_1012828511 | 3300004643 | Soil | MTGDTGTRELADGRPAYRLVRREDIELVGALPGHSSGLTRCLLVSGGLG |
| Ga0070666_104598142 | 3300005335 | Switchgrass Rhizosphere | VTGETGTRELADGRPGYRLVRREDIALADALPGRSSGLTT |
| Ga0070682_1008500381 | 3300005337 | Corn Rhizosphere | VSSETGTRTLADGRPAYRLVRREEIELADALPGRSSGLNTCRLVDGPS |
| Ga0070698_1005039161 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDTGTRQLADGIPGYRLVRREDVELAPALPGQSSGLTTC |
| Ga0070679_1001821853 | 3300005530 | Corn Rhizosphere | VSSETGTRTLADDRLAYRLVRREEIELADALPGRSSGLTTCRLV |
| Ga0070679_1006636522 | 3300005530 | Corn Rhizosphere | VTGETGTRELADGRPGYRLVRREDIALADALPGRSSGLTTCR |
| Ga0070684_1020522422 | 3300005535 | Corn Rhizosphere | MSSDTGTRQLADGLPGYRLVRREDVELRPALPGHSSGLTACR |
| Ga0066694_100460784 | 3300005574 | Soil | VSSETGTRQLGDGMPGYRLVRREDMELADALPGRSSGLTTCR |
| Ga0068859_1016563331 | 3300005617 | Switchgrass Rhizosphere | VSEETGTRTLADGLPAYRLVRREDIELAAGLPGRSDGL |
| Ga0066905_1004137221 | 3300005713 | Tropical Forest Soil | MSETGTRELADGRPGYRLVRREDVELAPALPGRSSGLTTC |
| Ga0068861_1023854951 | 3300005719 | Switchgrass Rhizosphere | MSDTGTRELADGRPGYRLVRREDVELAEALPGHSSGLTSCRLV |
| Ga0068870_109134291 | 3300005840 | Miscanthus Rhizosphere | MSSDTGTRQLADGLPGYRLVRREDVALAPALPGRSSGLTTCRLVDG |
| Ga0081455_103629892 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VSGDTGTRALEDGRPGYRLVRREDAVLADALPGRSSGLGSCRLVDGSL |
| Ga0066651_106529131 | 3300006031 | Soil | VTSDTGTRELADGRPGYRLVRREDVELADALPGRSNGLSSCRLVG |
| Ga0070712_1010482942 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSDTGTRYLADGMPSYRLVRREDVQLAEGLPGRSSNLESCRLV |
| Ga0074064_114976482 | 3300006603 | Soil | VTGETGTRELADGRPGYRLVRREDVALADALPGRSSGLTTCRLVDGTLG |
| Ga0079222_104887621 | 3300006755 | Agricultural Soil | VSGDSGTRELADGLPGYRLVRREDVELADALPGRSRGLRSCRLVGG |
| Ga0066659_118841542 | 3300006797 | Soil | VSGESGTRYLADGMPAYRLVRREDVELAEALPGHATGLCSCRLVGGALGS |
| Ga0066660_107029911 | 3300006800 | Soil | LSAESGTRELADGRPAYRLVRHEDVELKEALPGRSSGLTT |
| Ga0075425_1026835911 | 3300006854 | Populus Rhizosphere | MTETGTRELADGRPGYRLVRREDVELAPALPGRSSGLTTCRLVDG |
| Ga0075434_1006305511 | 3300006871 | Populus Rhizosphere | VTGETGTRDLADGRPGYRLVRREDAALADALPGRSSGLTTCRLVDG |
| Ga0075434_1022501532 | 3300006871 | Populus Rhizosphere | VTETGTRELADGRPGYRLVRREEVELAPALPGRSS |
| Ga0075424_1022489261 | 3300006904 | Populus Rhizosphere | VTETGTRELADGRPGYRLVRREEVELAPALPGRSSGLTTCRL |
| Ga0075435_1003168891 | 3300007076 | Populus Rhizosphere | MSDSGTRDLADGRPGYRLVRRADVELVEALPGHSSGLNS |
| Ga0066710_1031913021 | 3300009012 | Grasslands Soil | MSGDTGTRELADGRPGYRLVRREDVELAEALPARSGGLTTCR |
| Ga0105240_111773421 | 3300009093 | Corn Rhizosphere | MTNGDSGTRRLADGMPSYRLVRREDVQLAQALPGRASGLE |
| Ga0111539_127570121 | 3300009094 | Populus Rhizosphere | VTETGTRELADGRPGYRLVRREEVELAPALPGRSSGLTT |
| Ga0105245_113661012 | 3300009098 | Miscanthus Rhizosphere | MSSDTGTRQLADGLPGYRLVRRADVELAPALPGRSSGLTTCRLVGGALGST |
| Ga0114129_111502032 | 3300009147 | Populus Rhizosphere | MSSDTGTRQLADGLPGYRLVRREDVELRPALPGHSSGL |
| Ga0075423_128375202 | 3300009162 | Populus Rhizosphere | GRRLPVTGDTGTRDLADGRPGYRLVRREDVALADALPGRSSGLTT* |
| Ga0105242_104310041 | 3300009176 | Miscanthus Rhizosphere | VTGETGTRELADGRPGYRLVRREDVALADALPGRSS |
| Ga0105237_120653652 | 3300009545 | Corn Rhizosphere | LNGETGTRELADGRPGYRLVRREDVALVDALPGRSTGLTTCRLVDGTL |
| Ga0105056_10060371 | 3300009801 | Groundwater Sand | MSADTGTRQLADGMPGYRLVRREDVDLAVALPGRSRGLTSC |
| Ga0105058_10263472 | 3300009837 | Groundwater Sand | MSADTGTRQLADGMPGYRLVRREDVDLADALPGRSRGL |
| Ga0126315_106140642 | 3300010038 | Serpentine Soil | MSETGTRELADGRPGYRVVRREDIELAPGLPGRSSGLTS |
| Ga0126309_109183501 | 3300010039 | Serpentine Soil | MTSETGTRLLDDGLPGYRLVRREDVELAEALPGRSSGLTT |
| Ga0134125_127419352 | 3300010371 | Terrestrial Soil | VSEESGTRTLADGLPAYRLVRREDIELAAGLPGRS |
| Ga0134124_111370561 | 3300010397 | Terrestrial Soil | VTGETGTRELADGRPGYRLVRREDIALADTLPGRSTGLTTC |
| Ga0134122_117842091 | 3300010400 | Terrestrial Soil | MSSDTGTRQLADGLPGYRLVRREDVALAPALPGRSSGLTTCRLVDGSLG |
| Ga0138513_1000568502 | 3300011000 | Soil | VSTDTGTRELADGRPAYRLVRREDVELADALPGRSGGLT |
| Ga0105246_116377352 | 3300011119 | Miscanthus Rhizosphere | VSSETGTRTLADGRPAYRLVRREEIELADALPGRSSGLNTCRLVDGPSGST |
| Ga0137386_105454771 | 3300012351 | Vadose Zone Soil | VSPETGTRQLPEGLPGYRLVRREDVELADALPGRSSGLTSCRLVGGTL |
| Ga0157347_10165551 | 3300012502 | Arabidopsis Rhizosphere | MSDSGTRELADGLPGYRLVRREDVELAPGLPGRSSGLTSCR |
| Ga0157338_10442712 | 3300012515 | Arabidopsis Rhizosphere | MSDSGTRELADGLPGYRLVRREDVELAPGLPGRSRGLTSCRVVGGSLG |
| Ga0157286_101336401 | 3300012908 | Soil | MSSETGTRQLADGLPSYRLVRREDVALAEALPGRASGLTS |
| Ga0157298_100227401 | 3300012913 | Soil | MTETGTRDLADGRPGYRLVRREDVELAPALPGRSSGLTTCRLVD |
| Ga0157310_101288411 | 3300012916 | Soil | MTETGTRDLADGRPGYRLVRREDVELAPALPGRSSGLTTCRLVDGTLGST |
| Ga0164300_100844591 | 3300012951 | Soil | MTGDTGTRELADGRPAYRLVRREDIEFVDARAGHSSGL |
| Ga0164305_113270441 | 3300012989 | Soil | VSGDSGTHRLADGLPGYRLVRREDVELTDALPGRSS |
| Ga0157373_107986621 | 3300013100 | Corn Rhizosphere | MTNGDSGTRRLADGMPSYRLVRREDVQLAQALPGRASGLETCRLV |
| Ga0157370_100345626 | 3300013104 | Corn Rhizosphere | MTNGDSGTRRLADGMPSYRLVRREDVQLAQALPGRASGLETCRLVDGS |
| Ga0157369_104696691 | 3300013105 | Corn Rhizosphere | VSGDSGTRELADGLPGYRLVRREDVELADALPGRSR |
| Ga0075354_11593332 | 3300014308 | Natural And Restored Wetlands | MTGESGTHELADGRPGYRLVRREDVAFADLYPGRASGFECCRLVDGST |
| Ga0157377_113422992 | 3300014745 | Miscanthus Rhizosphere | MSDTGTRELADGRPGYRLVRREDVELAEALPGHSSGLNSCRLVGGA |
| Ga0173483_103957561 | 3300015077 | Soil | VSGDTGTHDLADGRPGYRLVRREDAVLGDALPGRSSG |
| Ga0132256_1025119622 | 3300015372 | Arabidopsis Rhizosphere | MTSDTGTRYLADGLPSYRLVRREDAQLAEGLPGRSSSLHSCRLVGG |
| Ga0132256_1033731491 | 3300015372 | Arabidopsis Rhizosphere | MTDETGTRYLADGLPSYRLVRREDVALDTALPDHASGLTKASLIGGHNGATHTGLSL |
| Ga0132255_1016147671 | 3300015374 | Arabidopsis Rhizosphere | VSGDSGTRELADGRPGYRLVRREDAELKPALPGRS |
| Ga0132255_1053297551 | 3300015374 | Arabidopsis Rhizosphere | MSGDSGTRDLEDGRPGYRLVRREDIVLADALPGRSSGLTACRLVD |
| Ga0182032_109806561 | 3300016357 | Soil | MSSESGTRRLADGMPSYRLVRREDVQLADALPGRSDGLLTC |
| Ga0182039_107631851 | 3300016422 | Soil | MSADTGTRYLADGLPSYRLVRREDATLSEGLPGRSSNLKS |
| Ga0187809_100021891 | 3300017937 | Freshwater Sediment | MSGDTGTRYLADGMPSYRLVRREDVQLAEGLPGRSSNLES |
| Ga0187786_104671301 | 3300017944 | Tropical Peatland | VSGDSGTRQLPDGMTAYRLVRREDVELVDGLPGHSS |
| Ga0187780_113803861 | 3300017973 | Tropical Peatland | MSSDTGTRYLADGLPSYRLVRREDVELADGLPGRSSNLQSCRL |
| Ga0187823_100163803 | 3300017993 | Freshwater Sediment | VSEESGTRYLADGLPGYRLVRREDVALVDALPGRSSGLKSCRLVGGSLGS |
| Ga0184634_101788612 | 3300018031 | Groundwater Sediment | MTGETGTHELADGRPGYRLVRREDIELGDALPGRS |
| Ga0187773_112394612 | 3300018064 | Tropical Peatland | VSGDSGTRHLADGMPAYRLVRREDVELAEGLPGRSSGLRSCRLVGGELG |
| Ga0184640_103639721 | 3300018074 | Groundwater Sediment | MTGETGTHELADGRPGYRLVRREDIELGDALPDRSSGLTTCRLVDGMLG |
| Ga0184633_105103771 | 3300018077 | Groundwater Sediment | MSSDTGTRQLADGMPGYRLVRREDIELDDALPGRSGGLTTCRLVDG |
| Ga0066667_105776951 | 3300018433 | Grasslands Soil | MTDSGTRELADGRPSYRLVRREDVELADALPGHSSGLTTCRL |
| Ga0066662_122586992 | 3300018468 | Grasslands Soil | MSGESGTRELADGRPAYRLVRREEIELAPGLPGRSSGLTSCRLVGGAQG |
| Ga0173481_100103633 | 3300019356 | Soil | MTETGTRDLADGRPGYRLVRREDVELAPALPGRSSGLTTCRLVDGT |
| Ga0173481_103083412 | 3300019356 | Soil | MSSETGTRQLADGLPSYRLVRREDVALAEALPGRASGLTSCRLVGGTLG |
| Ga0193705_10619771 | 3300019869 | Soil | MSDTGTRELADGRPGYRLVRREDVELAEALPGHSSGLNSCR |
| Ga0206352_105452672 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSETGTRRLADGMPSYRLVRREDAQFAEALPGHARGLESCRLVD |
| Ga0206353_111395661 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGNSNTGESGTRELADGRPAYRLVRREDVEFVDALPGRSDGLTT |
| Ga0210382_101486801 | 3300021080 | Groundwater Sediment | MSSDTGTRQLADGVPGYRLVRRKDVELAPALPGRSSGLTTCRLVGG |
| Ga0212128_107705261 | 3300022563 | Thermal Springs | MTSHTGTRQLADGMPGYRLVRREDVELTEALPGRSSGLTTCRLVGGTLGS |
| Ga0247786_10412382 | 3300022883 | Soil | VSGDTGTHELADGRPGYRLVRREDAVLADALPGRS |
| Ga0247787_10205812 | 3300022893 | Soil | VSSETGTRTLADGRPAYRLVRREEIELADALPGRSSGLNTCRL |
| Ga0247789_10483971 | 3300023266 | Soil | MSSDTGTRELAEGLPGYRLVRREDVELRPALPGRSS |
| Ga0247794_103090141 | 3300024055 | Soil | VSGDTGTHDLADGRPGYRLVRREDAVLGDALPGRSSGLASCRLVDGS |
| Ga0247690_10032701 | 3300024287 | Soil | MSDSGTRELADGLPGYRLVRREDVELAPGLPGRSRGLTSCR |
| Ga0209751_100548165 | 3300025327 | Soil | MSSDTGTRQLADGMPGYRLVRREDVELAEGLPGHSSGLASCRLVGG |
| Ga0207682_100554231 | 3300025893 | Miscanthus Rhizosphere | MSSDTGTRELADGLPGYRLVRREDVELRPALPGRASGLTAYRLVDGSL |
| Ga0207710_101266871 | 3300025900 | Switchgrass Rhizosphere | VTGETGTRELADGRPGYRLVRREDIALADALPGRSSGLTTCRLVDGTL |
| Ga0207688_104642112 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTETGTRELADGRPGYRLVRREDIELAPALPGRSSGLTT |
| Ga0207680_112237442 | 3300025903 | Switchgrass Rhizosphere | VTGETGTRELADGRPGYRLVRREDIALADALPGRSSGLTTCRLVDGA |
| Ga0207685_104717821 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSGTRELADGLPGYRLVRREDVELAPGLPGRSSGLTSCRVVGGALG |
| Ga0207707_114467601 | 3300025912 | Corn Rhizosphere | MTNDSGTRELADGRPGYRLVRREDVDLAPGLPDHSSGLTNCRLVS |
| Ga0207663_100120555 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSGTRELADGLPGYRLVRREDVELAPGLPGRSRGLTSCRVVGG |
| Ga0207652_112059051 | 3300025921 | Corn Rhizosphere | MSSESGTRELADGRPSYRLVRREDVELTDGLPGRSSGL |
| Ga0207652_117831961 | 3300025921 | Corn Rhizosphere | VSGETGTRTLADGLPAYRLVRREDIELADALPGRSAGLTSCRLVD |
| Ga0207687_109915581 | 3300025927 | Miscanthus Rhizosphere | MSSDTGTRQLADGLPGYRLVRRADVELAPALPGRSSGLTTCRLVG |
| Ga0207664_107185081 | 3300025929 | Agricultural Soil | MSETGTRELADGRPAYRLVRREDVELAPALPGHSSGLTSCRLVGGALGST |
| Ga0207690_109903832 | 3300025932 | Corn Rhizosphere | MSESGTRELADGRPAYRLVRSEDVDLAAALPGRSTG |
| Ga0207686_108000152 | 3300025934 | Miscanthus Rhizosphere | VTGETGTRELADGRPGYRLVRREDVALADALPGRSSGLTTCRLVD |
| Ga0207686_115182022 | 3300025934 | Miscanthus Rhizosphere | MSSDTGTRQLADGLPGYRLVRRADVELAPALPGRSSGLTT |
| Ga0207691_113317801 | 3300025940 | Miscanthus Rhizosphere | MSSDTGTRQLADGLPGYRLVRREDVELAPALPGRSSGLTTCRLV |
| Ga0207702_101661391 | 3300026078 | Corn Rhizosphere | MTGNSNTGESGTRELADGRPAYRLVRREDVELVDALPGRSDGLTTCRLVGG |
| Ga0207641_112015802 | 3300026088 | Switchgrass Rhizosphere | MSSDTGTRELADGLPGYRLVRREDVELRPALPGRSSGLTAYRLVDG |
| Ga0207698_125305221 | 3300026142 | Corn Rhizosphere | MSSDTGTRELADGLPGYRLVRREDVELRPALPGRSSGLRAYRLVD |
| Ga0209474_104871592 | 3300026550 | Soil | LSAESGTRELADGRPAYRLVRHEDVELKEGLPGRSSGLTTCR |
| Ga0247682_10053871 | 3300028146 | Soil | MSDSGTRELADGLPGYRLVRREDVELAPGLPGRSRGLT |
| Ga0247818_104520881 | 3300028589 | Soil | MTGETGTLELADGRPGYRLVRREDIELSDALPGRSSGLEA |
| Ga0247823_103559422 | 3300028590 | Soil | VSSETGTRTLADGRPAYRLVRREEIELADALPGRSSGLNTCRLVD |
| Ga0265336_100343761 | 3300028666 | Rhizosphere | VSGDSGTRYLADGMPAYRLVRREDVDLAEALPGHASGLRTCRL |
| Ga0307293_102621402 | 3300028711 | Soil | MSSDTGTRQLADGMPGYRLVRREDVELAPALPGRSTGLTTCRLVGGTLGS |
| Ga0307301_101329601 | 3300028719 | Soil | MSSDTGTRQLADGMPGYRLVRREDVELAPALPGRSSG |
| Ga0307297_101194452 | 3300028754 | Soil | MSSDTGTRQLADGMPGYRLVRREDVDLAPALPDRS |
| Ga0307306_101729192 | 3300028782 | Soil | MSSDTGTRQLADGMPGYRLVRREDVDLAPALPDRSSGLTTCR |
| Ga0307323_101094432 | 3300028787 | Soil | MNSDTGTRQLADGIPGYRLVRREDVALAPALPGRSSGVTTCRF |
| Ga0307503_107813431 | 3300028802 | Soil | MTGETGTHELADGRPGYRLVRRDDIELGDALPGRSSG |
| Ga0247825_104829091 | 3300028812 | Soil | MTGETGTHELADGRPGYRLVRREDIELSDALPGRSSGLTTCRLVDGTLG |
| Ga0307312_104479832 | 3300028828 | Soil | MSSDTGTRQLADGIPGYRLVRREDVALAPALPGRSSGVTTCRFVDGSLGST |
| Ga0307286_103218341 | 3300028876 | Soil | MSSDTGTRQLADGMPGYRLVRREDVELAPALPGRSSGLTTCRLV |
| Ga0307304_101758842 | 3300028885 | Soil | MSDTGTRELADGRPGYRLVRREDVELAETLPGHSSGLTSC |
| Ga0307499_101368662 | 3300031184 | Soil | VSSETGTRQLADGLPGYRLVRREDVTLAPALPGRSSGLTTCRLV |
| Ga0265330_101664242 | 3300031235 | Rhizosphere | VSGDSGTRYLADGMPAYRLVRREDVDLAEALPGHASG |
| Ga0318534_100443801 | 3300031544 | Soil | MSSESGTRRLADGMPSYRLVRREDVQLADALPGRSDGLLT |
| Ga0265342_106694391 | 3300031712 | Rhizosphere | VSGDSGTRYLADGMPAYRLVRREDVDLAEALPGRASGLRTCRRVGGSLGS |
| Ga0306918_105356592 | 3300031744 | Soil | MSADTGTRYLADGLPSYRLVRREDATLSEGLPGRSSNLKSCRLVGGSL |
| Ga0310892_110530061 | 3300031858 | Soil | VTGETGTRELADGRPGYRLVRREDVALADALPGRSSGLTTCRLVDG |
| Ga0310892_112347841 | 3300031858 | Soil | VSSETGTRTLADGRPAYRLVRREEIELADALPGRSS |
| Ga0311367_117072442 | 3300031918 | Fen | VSSDSGTRYLADGMPSYRLVRREDVELADGLPGHSS |
| Ga0308175_1030712981 | 3300031938 | Soil | VSPETGTRRLADGMSSYRLVRREDAQLAEALPGHARGLESCRLVD |
| Ga0310901_102085282 | 3300031940 | Soil | VSSETGTRTLADGRPAYRLVRREEIELADALPGRSSG |
| Ga0310906_108706721 | 3300032013 | Soil | MSSDTGTRELADGMPGYRLVRREDVELRPALPGHSSGLTACRLVDGSL |
| Ga0318513_101721852 | 3300032065 | Soil | MSSESGTRRLADGMPSYRLVRREDVQLADALPGRSAGLLTCRLVGGSLGST |
| Ga0310895_102805312 | 3300032122 | Soil | MSSDTGTRELADGMPGYRLVRREDVELRPALPGHSSGLT |
| Ga0310889_106788681 | 3300032179 | Soil | VTGETGTRELADGRPGYRLVRREDIALADALPGRSSGLTTC |
| Ga0310896_103746052 | 3300032211 | Soil | VTGETGTRELADGRPGYRLVRREDVALADALPGRSSGLTTC |
| Ga0335085_116374182 | 3300032770 | Soil | VSGESGTRYLADGMPGYRLVRREDVQLADALPGRSSGLRTC |
| Ga0335082_105010481 | 3300032782 | Soil | VTGDSGTRQLPDGMTAYRLVRREDVELVDGLPGHSS |
| Ga0335080_113913041 | 3300032828 | Soil | MSSDSGTRQLADGMPSYRLVRREDVELADGLPGHSSGLK |
| Ga0335072_112875062 | 3300032898 | Soil | VSGDTGTRYLGDGMPGHRLVRREDVELVEALPGHASGL |
| Ga0364929_0221492_491_631 | 3300034149 | Sediment | MSSDTGTRQLADGMPGYRLVRREDVELAPALPGRSSGLTTCRLVGGT |
| Ga0364934_0096582_2_124 | 3300034178 | Sediment | MTGDTGTRELADGRPGYRLVRRDDIELAGALPGRSSGLKTC |
| Ga0373950_0009948_1_120 | 3300034818 | Rhizosphere Soil | MSDSGTRELADGLPGYRLVRREDVELAAGLPGRSRGLTSC |
| Ga0373958_0040317_2_106 | 3300034819 | Rhizosphere Soil | MSDSGTRELADGLPGYRLVRREDIELAPGLPGRSR |
| Ga0373958_0045883_777_908 | 3300034819 | Rhizosphere Soil | MSDSGTRELADGLPGYRLVRREDVELAPGLPGRSSGLTSCRVVG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |