NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047185

Metagenome / Metatranscriptome Family F047185

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047185
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 105 residues
Representative Sequence MYLPVAVQKQPQINAAIAEVVSELSPSVKYIRYDIGQDWSGQWAIFFRVLLSDDAARNRLRDVATRVVWRTSDRLDIPSLGLFPYFDFRSESEQAKVPEPAWELN
Number of Associated Samples 107
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 57.33 %
% of genes near scaffold ends (potentially truncated) 32.67 %
% of genes from short scaffolds (< 2000 bps) 75.33 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.81

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(18.667 % of family members)
Environment Ontology (ENVO) Unclassified
(37.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(34.667 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.60%    β-sheet: 20.30%    Coil/Unstructured: 39.10%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.81
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.218.1.6: Nucleotidyltransferased1px5a21px50.63
d.218.1.2: Nucleotidyltransferased2fmpa32fmp0.63
d.80.1.3: Tautomerase/MIFd3gada_3gad0.62
d.80.1.0: Tautomerase/MIFd4dh4a_4dh40.62
d.80.1.0: Tautomerase/MIFd4lhpa_4lhp0.62

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF14403CP_ATPgrasp_2 2.00
PF00413Peptidase_M10 2.00
PF04255DUF433 1.33
PF01738DLH 1.33
PF00665rve 1.33
PF01833TIG 1.33
PF01381HTH_3 1.33
PF01934HepT-like 1.33
PF13676TIR_2 1.33
PF13193AMP-binding_C 1.33
PF12867DinB_2 1.33
PF13662Toprim_4 0.67
PF14498Glyco_hyd_65N_2 0.67
PF02866Ldh_1_C 0.67
PF01081Aldolase 0.67
PF13462Thioredoxin_4 0.67
PF00856SET 0.67
PF13286HD_assoc 0.67
PF08545ACP_syn_III 0.67
PF02163Peptidase_M50 0.67
PF00118Cpn60_TCP1 0.67
PF09084NMT1 0.67
PF00486Trans_reg_C 0.67
PF08379Bact_transglu_N 0.67
PF01180DHO_dh 0.67
PF02091tRNA-synt_2e 0.67
PF02457DAC 0.67
PF01909NTP_transf_2 0.67
PF12706Lactamase_B_2 0.67
PF00005ABC_tran 0.67
PF01850PIN 0.67
PF01408GFO_IDH_MocA 0.67
PF07995GSDH 0.67
PF16661Lactamase_B_6 0.67
PF00076RRM_1 0.67
PF02535Zip 0.67
PF08534Redoxin 0.67
PF07589PEP-CTERM 0.67
PF02452PemK_toxin 0.67
PF01053Cys_Met_Meta_PP 0.67
PF00480ROK 0.67
PF04012PspA_IM30 0.67
PF01610DDE_Tnp_ISL3 0.67
PF02082Rrf2 0.67
PF12704MacB_PCD 0.67
PF00202Aminotran_3 0.67
PF00171Aldedh 0.67
PF02913FAD-oxidase_C 0.67
PF05685Uma2 0.67
PF00561Abhydrolase_1 0.67
PF08808RES 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG5549Predicted Zn-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 2.00
COG1842Phage shock protein ATranscription [K] 1.33
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.33
COG2361HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 1.33
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 1.33
COG2445Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 familyGeneral function prediction only [R] 1.33
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 1.33
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 1.33
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 1.33
COG4584TransposaseMobilome: prophages, transposons [X] 1.33
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.67
COG0039Malate/lactate dehydrogenaseEnergy production and conversion [C] 0.67
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.67
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.67
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.67
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.67
COG0167Dihydroorotate dehydrogenaseNucleotide transport and metabolism [F] 0.67
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.67
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.67
COG0428Zinc transporter ZupTInorganic ion transport and metabolism [P] 0.67
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.67
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.67
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.67
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.67
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 0.67
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.67
COG0752Glycyl-tRNA synthetase, alpha subunitTranslation, ribosomal structure and biogenesis [J] 0.67
COG08002-keto-3-deoxy-6-phosphogluconate aldolaseCarbohydrate transport and metabolism [G] 0.67
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.67
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.67
COG1305Transglutaminase-like enzyme, putative cysteine proteasePosttranslational modification, protein turnover, chaperones [O] 0.67
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.67
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 0.67
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.67
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 0.67
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.67
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.67
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.67
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.67
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.67
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.67
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 0.67
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 0.67
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.67
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.67
COG3464TransposaseMobilome: prophages, transposons [X] 0.67
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.67
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.67
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.67
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.67
COG5654Predicted toxin component of a toxin-antitoxin system, contains RES domainDefense mechanisms [V] 0.67

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.33 %
UnclassifiedrootN/A0.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10323355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4550Open in IMG/M
3300003219|JGI26341J46601_10054380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41244Open in IMG/M
3300004080|Ga0062385_10130912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41267Open in IMG/M
3300004080|Ga0062385_10769679Not Available627Open in IMG/M
3300004092|Ga0062389_104725325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4513Open in IMG/M
3300004152|Ga0062386_100166838All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300004474|Ga0068968_1429248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4612Open in IMG/M
3300004614|Ga0068956_1250083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4752Open in IMG/M
3300005458|Ga0070681_10076537All Organisms → cellular organisms → Bacteria3304Open in IMG/M
3300005534|Ga0070735_10623557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4639Open in IMG/M
3300006052|Ga0075029_100064516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2142Open in IMG/M
3300006052|Ga0075029_100110532All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1659Open in IMG/M
3300006052|Ga0075029_100298129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41028Open in IMG/M
3300006059|Ga0075017_100050891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2784Open in IMG/M
3300006059|Ga0075017_101447426All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4541Open in IMG/M
3300006086|Ga0075019_10936673All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4557Open in IMG/M
3300006162|Ga0075030_100113332All Organisms → cellular organisms → Bacteria → Proteobacteria2206Open in IMG/M
3300006162|Ga0075030_100672270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4820Open in IMG/M
3300006176|Ga0070765_101628764All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4607Open in IMG/M
3300006354|Ga0075021_10890934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4577Open in IMG/M
3300006638|Ga0075522_10219341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium952Open in IMG/M
3300009088|Ga0099830_11634742All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4537Open in IMG/M
3300009500|Ga0116229_10711726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4819Open in IMG/M
3300009520|Ga0116214_1130916All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4929Open in IMG/M
3300009523|Ga0116221_1023764All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA43155Open in IMG/M
3300009545|Ga0105237_10002116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia25058Open in IMG/M
3300009616|Ga0116111_1001045All Organisms → cellular organisms → Bacteria20756Open in IMG/M
3300009628|Ga0116125_1007812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42886Open in IMG/M
3300009628|Ga0116125_1041165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41165Open in IMG/M
3300009633|Ga0116129_1000502All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia25233Open in IMG/M
3300009635|Ga0116117_1028020All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41402Open in IMG/M
3300009640|Ga0116126_1221537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter602Open in IMG/M
3300010341|Ga0074045_10014964All Organisms → cellular organisms → Bacteria6267Open in IMG/M
3300011090|Ga0138579_1176516All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4588Open in IMG/M
3300012189|Ga0137388_10637100All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4991Open in IMG/M
3300012199|Ga0137383_10093838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42176Open in IMG/M
3300012202|Ga0137363_10395435All Organisms → Viruses → Predicted Viral1150Open in IMG/M
3300012210|Ga0137378_11063101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4724Open in IMG/M
3300012350|Ga0137372_10965025All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4598Open in IMG/M
3300012354|Ga0137366_11083690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4552Open in IMG/M
3300012362|Ga0137361_10312574All Organisms → cellular organisms → Bacteria1439Open in IMG/M
3300014161|Ga0181529_10051302All Organisms → cellular organisms → Bacteria2901Open in IMG/M
3300014167|Ga0181528_10245852All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4966Open in IMG/M
3300014167|Ga0181528_10284045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4895Open in IMG/M
3300014168|Ga0181534_10153924All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41180Open in IMG/M
3300014168|Ga0181534_10957602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4515Open in IMG/M
3300014169|Ga0181531_10035912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2867Open in IMG/M
3300014169|Ga0181531_10432765All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300014200|Ga0181526_10540814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4737Open in IMG/M
3300014200|Ga0181526_10667247All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4656Open in IMG/M
3300014201|Ga0181537_11093818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4539Open in IMG/M
3300014489|Ga0182018_10000414All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus55951Open in IMG/M
3300014489|Ga0182018_10038472All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2991Open in IMG/M
3300014491|Ga0182014_10001325All Organisms → cellular organisms → Bacteria → Acidobacteria33241Open in IMG/M
3300014492|Ga0182013_10145144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41506Open in IMG/M
3300014492|Ga0182013_10409042All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4726Open in IMG/M
3300014493|Ga0182016_10081984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42346Open in IMG/M
3300014493|Ga0182016_10592453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4631Open in IMG/M
3300014495|Ga0182015_10112540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41878Open in IMG/M
3300014499|Ga0182012_10025967All Organisms → cellular organisms → Bacteria5110Open in IMG/M
3300014501|Ga0182024_10249684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42380Open in IMG/M
3300014654|Ga0181525_10328789All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4836Open in IMG/M
3300014655|Ga0181516_10249818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3901Open in IMG/M
3300014657|Ga0181522_10392202All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4830Open in IMG/M
3300014658|Ga0181519_10327551All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4950Open in IMG/M
3300014838|Ga0182030_10206650All Organisms → cellular organisms → Bacteria2335Open in IMG/M
3300014838|Ga0182030_10949587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4763Open in IMG/M
3300014838|Ga0182030_11061972All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4706Open in IMG/M
3300014838|Ga0182030_11468701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4564Open in IMG/M
3300014839|Ga0182027_10188369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42401Open in IMG/M
3300017823|Ga0187818_10509041All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4541Open in IMG/M
3300017940|Ga0187853_10275578All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4766Open in IMG/M
3300017948|Ga0187847_10101728All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41585Open in IMG/M
3300017948|Ga0187847_10148437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41282Open in IMG/M
3300017988|Ga0181520_10130943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2077Open in IMG/M
3300018003|Ga0187876_1051100All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1705Open in IMG/M
3300018008|Ga0187888_1357905All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4554Open in IMG/M
3300018016|Ga0187880_1380374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4594Open in IMG/M
3300018022|Ga0187864_10120828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1333Open in IMG/M
3300018030|Ga0187869_10395977All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4659Open in IMG/M
3300018034|Ga0187863_10233218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41023Open in IMG/M
3300018034|Ga0187863_10306411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4883Open in IMG/M
3300018034|Ga0187863_10629963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4604Open in IMG/M
3300018035|Ga0187875_10080826All Organisms → cellular organisms → Bacteria1864Open in IMG/M
3300018035|Ga0187875_10344452All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4802Open in IMG/M
3300018042|Ga0187871_10258045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4967Open in IMG/M
3300018043|Ga0187887_10349107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4873Open in IMG/M
3300018046|Ga0187851_10887803All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4501Open in IMG/M
3300019270|Ga0181512_1262452All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4643Open in IMG/M
3300019786|Ga0182025_1316931All Organisms → cellular organisms → Bacteria → Acidobacteria1332Open in IMG/M
3300021170|Ga0210400_10772442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4788Open in IMG/M
3300021181|Ga0210388_11282780All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4619Open in IMG/M
3300021401|Ga0210393_10917800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4710Open in IMG/M
3300021406|Ga0210386_11040645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4697Open in IMG/M
3300025434|Ga0208690_1046640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4682Open in IMG/M
3300025463|Ga0208193_1001070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia12513Open in IMG/M
3300025679|Ga0207933_1000245All Organisms → cellular organisms → Bacteria56509Open in IMG/M
3300025912|Ga0207707_10568171All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4962Open in IMG/M
3300025914|Ga0207671_10547363All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4923Open in IMG/M
3300027570|Ga0208043_1146803All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4616Open in IMG/M
3300027641|Ga0208827_1058937All Organisms → cellular organisms → Bacteria1254Open in IMG/M
3300027812|Ga0209656_10018427All Organisms → cellular organisms → Bacteria → Acidobacteria4295Open in IMG/M
3300027812|Ga0209656_10141534All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300027854|Ga0209517_10030497All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales4542Open in IMG/M
3300027911|Ga0209698_10118237All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2200Open in IMG/M
3300027911|Ga0209698_10166602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41798Open in IMG/M
3300027911|Ga0209698_10888065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4669Open in IMG/M
3300027986|Ga0209168_10113148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41394Open in IMG/M
3300028552|Ga0302149_1017671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41875Open in IMG/M
3300029922|Ga0311363_10104292All Organisms → cellular organisms → Bacteria → Acidobacteria3880Open in IMG/M
3300029939|Ga0311328_10041238All Organisms → cellular organisms → Bacteria4195Open in IMG/M
3300029943|Ga0311340_10059200All Organisms → cellular organisms → Bacteria → Acidobacteria4461Open in IMG/M
3300029943|Ga0311340_11018678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4679Open in IMG/M
3300029999|Ga0311339_10387967All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41461Open in IMG/M
3300029999|Ga0311339_10815342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus897Open in IMG/M
3300029999|Ga0311339_10893798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4844Open in IMG/M
3300030007|Ga0311338_10249764All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41995Open in IMG/M
3300030007|Ga0311338_10285446All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41833Open in IMG/M
3300030007|Ga0311338_11826373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4546Open in IMG/M
3300030053|Ga0302177_10498550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4629Open in IMG/M
3300030503|Ga0311370_10428373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41651Open in IMG/M
3300030618|Ga0311354_11591000All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4575Open in IMG/M
3300031028|Ga0302180_10492747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4601Open in IMG/M
3300031234|Ga0302325_10349504All Organisms → cellular organisms → Bacteria2350Open in IMG/M
3300031234|Ga0302325_10443633All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41995Open in IMG/M
3300031234|Ga0302325_11363762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter926Open in IMG/M
3300031234|Ga0302325_11457008All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4886Open in IMG/M
3300031234|Ga0302325_11627443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4822Open in IMG/M
3300031234|Ga0302325_12509225All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4615Open in IMG/M
3300031236|Ga0302324_100043486All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8225Open in IMG/M
3300031236|Ga0302324_100198574All Organisms → cellular organisms → Bacteria3205Open in IMG/M
3300031236|Ga0302324_100699902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41430Open in IMG/M
3300031236|Ga0302324_100891756All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300031236|Ga0302324_101597904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4841Open in IMG/M
3300031236|Ga0302324_102862569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4578Open in IMG/M
3300031524|Ga0302320_10133189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3826Open in IMG/M
3300031525|Ga0302326_10303194All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42551Open in IMG/M
3300031525|Ga0302326_10903699All Organisms → cellular organisms → Bacteria → Acidobacteria1255Open in IMG/M
3300031525|Ga0302326_11870310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4782Open in IMG/M
3300031525|Ga0302326_12523585All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium644Open in IMG/M
3300031708|Ga0310686_114336620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42564Open in IMG/M
3300031788|Ga0302319_11847423All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4520Open in IMG/M
3300032205|Ga0307472_101041542All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4770Open in IMG/M
3300032515|Ga0348332_12479643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4618Open in IMG/M
3300032515|Ga0348332_13158276All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4665Open in IMG/M
3300033824|Ga0334840_029043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41745Open in IMG/M
3300033887|Ga0334790_015582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA43650Open in IMG/M
3300034163|Ga0370515_0064371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41601Open in IMG/M
3300034282|Ga0370492_0038114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1976Open in IMG/M
3300034282|Ga0370492_0095319All Organisms → cellular organisms → Bacteria1218Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa18.67%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland11.33%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog10.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds8.00%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog6.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.33%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.67%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.67%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil2.00%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa2.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.33%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.33%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.33%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.33%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.33%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.67%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.67%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.67%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.67%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004474Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004614Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300011090Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025463Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025679Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1032335523300001356Peatlands SoilMNVAANVGGPARQGCYAESEMYLPIAVQKQPQINAAVAEVVNEFSPWVKYMRFDIGQDWSGGWAIFFRVMLSDDAVRNRLGDVATRVMWRTTDRLDLPNLGLFPYFDFRSESERQAA*
JGI26341J46601_1005438023300003219Bog Forest SoilMYLPVAVAKQQQISDAINAVVAELAPAVQRINYEIAPDWDGRWAIFFRVLLSDEASSQSQLRDIAPNIVRRMSDKLDLPNLGLFPYFDFRSQSEQMAINEPAWA*
Ga0062385_1013091233300004080Bog Forest SoilMYLPVAVAKQQQISDAINAVVAELAPAVQRINYEIAPDWDGRWAIFLRVLLSDEAASQTQLRDIAPNVVRRMSDKLDLPNLGLFPYFDFRSQSEQMARNEPAWA*
Ga0062385_1076967913300004080Bog Forest SoilVVVATDLTKQLQINELSPSVRRIRYDTDQDWSGQPAIFFPVLLSDDASEPKNLREIAPRVVWRMSDRLELPGLGPVYSF*
Ga0062389_10472532513300004092Bog Forest SoilMREGRVSRYPAVYGAETIVATDPTKQPQINAAVTEVVNELSPSVRRIRYDIDQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVWRMSERLDLLELGLFPYFNFRSEAEQALINEPAWT
Ga0062386_10016683833300004152Bog Forest SoilVAAVMRDLSPLGVRHIRYDIAEDWSGQWAIFFRVLLSDAASTERLRDVTTQVIWRMSEKLDLPNLGLFPYFDFRSESEQSVLNEPEWAAAS*
Ga0068968_142924823300004474Peatlands SoilLPIAVQKQPQINAAVAEVVNEFSPWVKYMRFDIGQDWSGGWAIFFRVMLSDDAVRNRLGDVATRVMWRTTDRLDLPNLGLFPYFDFRSESEQAKLREPAWEPSLN*
Ga0068956_125008313300004614Peatlands SoilPIAVQKQPQINAAVAEVVNEFSPWVKYMRFDIGQDWSGGWAIFFRVMLSDDAVRNRLGDVATRVMWRTTDRLDLPNLGLFPYFDFRSESEQAKLREPAWEPSLN*
Ga0070681_1007653743300005458Corn RhizosphereVRELSPAVQRINYEIAQDWSGEWAVFFRVLLSDEASNRNHLRDVATKVVWRMSDGLDLPSLGLFPYFDFRSQSEQAKLNEPAWA*
Ga0070735_1062355723300005534Surface SoilMYLPSAVQKQPQINAAVSDVVRELSPWVRHIRYDIAQDWSGEWAIFFRVLLSDEAAQKRLKDVATRVVWRTSDRLDLPNLGLFPYFDFRSESEQARMHEASWE*
Ga0075029_10006451613300006052WatershedsMYLPVAVAKQPQINAAINAAMLELAPAVQRINYEIAQDWTGEWAVFFRVLLSDEAASQNRLRDVATNVVWRVSEKLDLPSLGLFP
Ga0075029_10011053213300006052WatershedsMPSAITKQPEINAAVAAAERLPGVRYVRYSIAPDWNDQWAIFFRVVLADDASTGEKLRDVTTQVIWRMSEWLNLPELGLFPHFDFRTESEQAALNEPSWAKAS*
Ga0075029_10029812913300006052WatershedsVFLPSAITKQPEISAAVAAVERLPGVRYIRYSVAPDWNGQWAIFFRVVLADEASTGEKLRDITTQVVWRMSEWLNLPELGLFPYFDFRSEAEQAALNEPSWAEAS*
Ga0075017_10005089123300006059WatershedsMYLPVAVAKQPQINAAINAAMLELAPAVQRINYEIAQDWTGEWAVFFRVLLSDEAASQNRLRDVATNVVWRVSEKLDLPSLGLFPYFDFRSQSEQAVLNEPAWA*
Ga0075017_10144742623300006059WatershedsMPSAITKQPEINAAVAAAERLPGVRYVRYSIAPDWNDQWAIFFRVVLADDASTGEKLRDVTTQVIWRMSEWLNLPELGLFPHFDFRTESEQAALN
Ga0075019_1093667313300006086WatershedsYGVNEPMYLPVAVAKQPQINAAINAAMLELAPAVQRINYEIAQDWTGEWAVFFRVLLSDEAASQNRLRDVATNVVWRVSEKLDLPSLGLFPYFDFRSQSEQAVLNEPAWA*
Ga0075030_10011333253300006162WatershedsMPSAITRQPEINAAVAAVERLPGVRYIRYSIAPDWAGQWAIFFRVVLADDASTGERLRDVTTQVVWRMSERLNLPELGLFPHFDFRSESEQAALNEPSWAKAS*
Ga0075030_10067227013300006162WatershedsKQPQINAAIHAVVAELSPAVQRINYEIAQDWSGQWAIFFRVLLSDEAASRNRLRAVATDVVWRMSERLDLPGLELFPYFDFRSQAEQAVLNEPAWA*
Ga0070765_10162876413300006176SoilMIPLGVVKQPQINATITEVVNELSPSVRYIRYNIAHDWSGQWAIFFRVVLSDDASRNRLREITTQVVWRMSEGLDLPNLGLFPYFDFRSESEQAALNEAEWARTA*
Ga0075021_1089093423300006354WatershedsMPSAITKQPEINAAVAAVEKLPGVRYIRYSIAPDWTDQQWAIFFRVVLADDASTGERLRDVTTQVVWRMSEWLNLPELGLFPYFDFRSESEQAALNDPGWAKAS*
Ga0075522_1021934123300006638Arctic Peat SoilMAVTAELSRQPQINAAVTDVVNELSPSVRKIRFDIGQDWSGQWAIFFRVLLSDDASKPKNLREIAPRVVWRMSERLDIGGLGLFPYFNFRSETEQALVNEPAWT*
Ga0099830_1163474223300009088Vadose Zone SoilMYLPLAVQKQPQINAAVTEVVSELSPSVRKIRYEIGEDWTGQEAIFFRVLLSDDASKPGNLRKIAPRVVWRMSDRLDLPSLGLFPYFDFRSEAEQAVLKETAWT*
Ga0116229_1071172623300009500Host-AssociatedRYAECEGKMAIAADLSKQPQINAAVTDVVRELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDHASEPKNLREIAPRVVWRMSESLDLPGLGLFPYFNFRSEAEQALVKDLAWT*
Ga0116214_113091613300009520Peatlands SoilMYLPIAVQKQPQINAAVAEVVNEFSPWVKYMRFDIGQDWSGGWAIFFRVMLSDDAVRNRLGDVATRVMWRTTDRLDLPNLGLFPYFDFRSESERQAA*
Ga0116221_102376463300009523Peatlands SoilMYLPIAVQKQPQINAAVAEVVNEFSPWVKYMRFDIGQDWSGGWAIFFRVMLSDDAVRNRLGDVATRVMWRTTDRLDLPNLGLFPYFDFRSESEQAKLREPAWEPSLN*
Ga0105237_10002116183300009545Corn RhizosphereMYLPMAVTKRPQINAAIADVVRELSPAVQRINYEIAQDWSGEWEVFFRVLLSDEASNRNHLRDVATKVVWRMSDGLDLPSLGLFPYFDFRSQSEQAKLNEPAWA*
Ga0116111_1001045123300009616PeatlandMQQQINAAVAEVVRELAPAVQRINYEIARDWSGQWAIFFRVLLSDEASNRTHLRDVATKVVWRMSERLDLPGIGVFPYFDFRSQSEQAKLNEPAWA*
Ga0116125_100781233300009628PeatlandMVVAADTSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVRRMSDRLDLAGLGLFPYFNFRSEAEQALDKDLAWA*
Ga0116125_104116523300009628PeatlandMPTAIAKQPEINAAVRAAERLPGVKYIRYSIAPDSNGRWAIFFRVVLADEVSTGERLRDVTTQVIWRMSEGLDLPNLDLIPYFDFRSQSEQNALNEPHWQQAS*
Ga0116129_1000502243300009633PeatlandMFLPIAAAAQPQINAAVSAVVQELTPAVQHIDYKIARDWDGQWAIFFRVLLSDEASHRDRLQDVATQVVWRISDRIDIPGLGLFPHFDFESQSEWAKRNELARA*
Ga0116117_102802033300009635PeatlandMVVAADTSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVRRMSDQLDLAGLGLFPYFNFRSEAEQALDKDLAWA*
Ga0116126_122153713300009640PeatlandKRGITMLMPTAATKQQQIDAAVAEVLRELSPDVQRIRYEIAQDWSGDPAVFFRVLLSDEASQDRNLREIVPRVVWSMSDRVYLAELGLFPYFDFRSQSEQAKHPEPTWA*
Ga0074045_1001496433300010341Bog Forest SoilMYPIVIAKQPQINAAVAAVMRDLSPLGVRHIRYDIAEDWSGQWAIFFRVLLSDAASTERLRDVTTQVIWRMSEKLDLPNLGLFPYFDFRSESEQSVLNEPEWAAAS*
Ga0138579_117651613300011090Peatlands SoilKQPQINAAVAEVVNEFSPWVKYMRFDIGQDWSGGWAIFFRVMLSDDAVRNRLGDVATRVMWRTTDRLDLPNLGLFPYFDFRSESEQAKLREPAWEPSLN*
Ga0137388_1063710023300012189Vadose Zone SoilMYLPLAVQKQPQINAAVAEVVNDLSPSVRYIRYDIGQDWSGQWAVFFRVMLSHDAVRNRLREVATRVVWRTSDRLDLPSLGLFPYFDFRSETEQAKLHEPAWEPSLS*
Ga0137383_1009383833300012199Vadose Zone SoilMDPPDADTTQPQINAAVSDVIKELSPSVRHISYDIDQDWNGQWAIFFRVLLSDEASNPTNLREIGPRVVWRMSERLDVPGLGLFPHFNFRSESEQAQLKEPAWA*
Ga0137363_1039543523300012202Vadose Zone SoilMNMPTGAVKQQQINAAIATVQREMTPWVRHIGYDIGQDWSGQWAIFFRVLLSDEAAQSMLKDVATRVVWRTSERLDLPSLGLFPYFDFRSESEQARIHEPSQD*
Ga0137378_1106310113300012210Vadose Zone SoilMYPPDADTTQPQINAAVSDVIKELSPSVRHISYDIDQDWNGQWAIFFRVLLSDEASNPTNLREIGPRVVWRMSERLDVPGLGLFPHFNFRSESEQAQLKEPAWA*
Ga0137372_1096502513300012350Vadose Zone SoilHVVTDLSPWVKYIRYDIGQDWSGEWAIFFRVLLSDDAVRNRLGDVATRVVWRTSELLDLPSLGMFPYFDFRSESEQARMHEPAWEPSRVQ*
Ga0137366_1108369013300012354Vadose Zone SoilMYLPVAAQKQPEINAVVAHVVTDLSPWVKYIRYDIGQDWSGEWAIFFRVLLSDDAVRNRLGDVATRVVWRTSELLDLPSLGMFPYFDFRSESEQARMHEPAWEPS
Ga0137361_1031257433300012362Vadose Zone SoilMNMPTGAVKQQQINAAIATVQREMTPWVRHIGYDIGQDWGGQWAIFFRVLLSDEAAQSMLKDVATRVVWRTSERLDLPSLGLFPYFDFRSESEQARIHEPSQD*
Ga0181529_1005130233300014161BogVPVAVTKQSQILAAIDAVESQLAPYVVHIRYEMGQDWSGEWAIFFKVLLSDEASADGNLREIAPKVVWRMMERLDLPKLGLIPYFDFRSQSEQTELNEPAWA*
Ga0181528_1024585223300014167BogMVAPLEALKQPQINSAIAEVVAQLSPWVRYIRYDIAHDWSGQWAIFFRVVLSERADKERLREITTQVVWRMSERLDLPNLGLFPYFDFRSEAEQAALNEAEWART*
Ga0181528_1028404523300014167BogMIVAADTSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVWRMSERLDLPGLGLFPYFNFRSEAEQALDKDLAWA*
Ga0181534_1015392423300014168BogVLTTDLPRQPEINAAVTDVVNELSPSVRKIRFDIDQDWSGQWAIFFRVLLSDDASQPKNLREIAPRVVWRMSERLDLGEFGLFPYFNFRSEAEQALVNEPAWA*
Ga0181534_1095760213300014168BogMVVAADTSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVRRMSDRLDLAGLGL
Ga0181531_1003591223300014169BogMRSPTATTKQPQIHAAIAEVVREMTPAVQRIDYEIAQDWTGEWAIFFKVLLSNEASKRTRLRSVAPRVVRRMSDNLDLPTLGLIPYFDFRSQAEEDKLKEPARA*
Ga0181531_1043276523300014169BogMRYVGSKMIVPRSFTGYPQINAAVADVVRELSPWVLHIRYEIALDWSEERAVFFRVVLSDEAVTRPNLRNVTTQVVSMMTEKLDLPNLGMFPYFDFRSESEQAALNQPEWAATM*
Ga0181526_1054081423300014200BogMVVAADLSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFHVLLSDDASEPKNLREIAPRVVWRMSARLDLPGLGLFPYFNFRSEAEQALVEDLAGA*
Ga0181526_1066724723300014200BogMVVAADTSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVRRMSDRLDLAGLGLFPYFNFRSEAEQALDK
Ga0181537_1109381813300014201BogMAIAADLSKQPQINAAVTDVVRELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDHASEPKNLREIAPRVVWRMSESLDLPGLGLFPYFNFRSEAEQALVKDLAWT*
Ga0182018_1000041423300014489PalsaMQVPIAITKQAQIKAAIDAVDRQLRPDVVHIRYEIGQDWSGQWAIFFKVLLSDEASIDRNLREMAPKFVWSVSDRLDLPELGLFPHFDFRSQSEQIERNEPAWA*
Ga0182018_1003847233300014489PalsaMYLPIAVQKQPQINAAVAEVVNEFSPSVRYIRYDIGQDWSGEWAVFFRVLLSDDAVRNRLKDVATRVVWRTSERLDLPSLGLFPYFDFRSESEQAHLHEAAWEPALS*
Ga0182014_10001325303300014491BogMYLPVAVQKQPQINAAIAEVVSELSPSVKYIRYDIGQDWSGQWAIFFRVLLSDDAARNRLRDVATRVVWRTSDRLDIPSLGLFPYFDFRSESEQAKVPEPAWELN*
Ga0182013_1014514413300014492BogMCPPTATQKQPRINAAVAEVVDEFSPSVKYIRYDIGQDWSGEWAVFFRVMLSDDVLRDKLGDVATRVMWRTTDRLDLPNLGLFPYFDFRSESEQASMREPAWEPLL
Ga0182013_1040904223300014492BogMVAADLSKQPQINAAVTDVVRELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLRDIAPRVVWRMSERLDLPGLGLFPYFNFRSEAEQALVKDLAWA*
Ga0182016_1008198423300014493BogMIAPLGALKQPQINAAITEVVEELSPWVRYIRYSIAHDWSGQWAIFFRVILSDDASKNRLREITTQVVWRMSERLDLPDLELFPHFDFRSESEQATLNEAEWARTA*
Ga0182016_1059245313300014493BogMYLPIAVQKQPQINSAVSQVIAQLSPSVQSISYRIAQDWSGQWAIFFRVLLSDEASARRLRDITDQVVWRMSERLNLPELGLFPYFDFRSVSEQAMLNEPG
Ga0182015_1011254043300014495PalsaMFMPSAITKQPEINAAVVAAERLPGVRYIRYSVAPDWNGQSAIFFRVVLADEASTGERLRDITTQVIWRMSEWLNLPELELFPYFDFRSESEQATLNEPSWAKAS*
Ga0182012_1002596753300014499BogMVAADLSKQPQINAAVTDVVRELSPSVKEIRFDIGQDWSGQWAIFFRVLLSDDACEPKNLRDIAPRVVWRMSERLDLPGLGLFPYFNFRSEAEQALVKDLAWA*
Ga0182024_1024968423300014501PermafrostMIVPRGFTGTPQINAAVAAVEGELSPWVRYIRYDVALDWSQQWAIFFRVVLSDEAGKQRLREITTQVVWKLSARLDLPNLGLLPYFDFRSESEQAALNQPEWAATM*
Ga0181525_1032878923300014654BogGQSGTEAGRKQSVILRYAVGEDKMVVAADTSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDHASEPKNLREIAPRVVWRMSESLDLPGLGLFPYFNFRSEAEQALVKDLAWT*
Ga0181516_1024981813300014655BogYAVGEDKMVVAADTSKQPQINAAVTDVVKELSTSVKKIRFDIGQDWSGQWAIFFRIVLKDDAARRRLREVATAVVWGLAQQLDFPAMGVFPYHNFRSESEQALLREPAWA*
Ga0181522_1039220213300014657BogDREWAMRYVGSKMIVPRSFTGYPQINAAVADVVRELSPWVLHIRYEIALDWSEERAVFFRVVLSDEAVTRPNLRNVTTQVVSMMTEKLDLPNLGMFPYFDFRSESEQAALNQPEWAATM*
Ga0181519_1032755123300014658BogMPLPVTAGQSGTEAGRKQSVILRYAVGEDKMVVAADTSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLRDIAPRVVRRMSDRLDLAGLGLFPYFNFRSEAEQALDKDLAWA*
Ga0182030_1020665013300014838BogMVAADLSKQPQINAAVTDVVNELSPSVKKIRFDIGQDWSGEWAIFFRVLLSDDACEPKNLRDIAPRVVWRMSERLDLPGLGLFPYFNFRSEAEQALVKDLAWA*
Ga0182030_1094958713300014838BogTADLSKQPQIDAAVTEVVKELSPSVKKIRFDIDQDWSGQRAIFFRVLLSDDASEPINLREIAPRVVWRMSERLDLPRLGLFPYFNFRSEAEQALVKDLAWA*
Ga0182030_1106197223300014838BogMIAPLGALKQPQINAAITEVVEELSPWVRYIRYSIAHDWSGQWAIFFRVILSDDASKNRLREITTQVVWRMSERLDLPDLELFPHFDFRSESEQATLNEAEWARSACRHLQMTC*
Ga0182030_1146870113300014838BogMMMPGAITKQPQINAAVEQIIKEMSPGVQRIRYEIAPDWSGQWAIFFRVLLSDEVVQQRLKEIATRVVWRTSERLDLPNLGLFPYFDFRS
Ga0182027_1018836923300014839FenMYLPMAVQKQPQINAAVADVMHGLSPSVRYIRYDIGQDWSGQWAVFFRVLLSDDAARNRLRDIATSVVSLTSERLDLPSLGLFPYFDFRSESEQVNRPEPGWEPSLN*
Ga0187818_1050904113300017823Freshwater SedimentEMSPPTSLQNKPQINAAVAEVLKEFSPSVKYIRFDVGQDWTGEWALFFRVMLSDDVSRDSLGDIATRVMWRTTDRLDLPNLGMFPYFDFRSESEQAKLREPAWDPLPN
Ga0187853_1027557823300017940PeatlandMRGDWPAGCYAKGKMYLPVAVQKQPQINAAIAEVVSELSPSVKYIRYDIGQDWSGQWAIFFRVLLSDDAARNRLRDVATRVVWRTSDRLDIPSLGLFPYFDFRSESEQAKVPEPAWELN
Ga0187847_1010172833300017948PeatlandMYPIATAKQPQINAAVAAVMRDLSPLGVRHIRFDIAEDWSGQLAIFFRVVLSDAASTERLRDVTTQVIWRMSEKLDLPNLGLFPHFDFRSESEQAALNEPEWAAAS
Ga0187847_1014843713300017948PeatlandMIVAADTSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVRRMSDRLDLAGLGLFPYFNFRSEAEQALDKDLAWA
Ga0181520_1013094323300017988BogVTKQSQILAAIDAVESQLAPYVVHIRYEMGQDWSGEWAIFFKVLLSDEASADGNLREIAPKVVWRMMERLDLPKLGLIPYFDFRSQSEQTELNEPAWA
Ga0187876_105110033300018003PeatlandMYLPMAVTMQQQINAAVAEVVRELAPAVQRINYEIARDWSGQWAIFFRVLLSDEASNRTHLRDVATKVVWRMSERLDLPGIGVFPYFDFRSQSEQAKLNEPAWA
Ga0187888_135790523300018008PeatlandQINAAIAEVVSELSPSVKYIRYDIGQDWSGQWAIFFRVLLSDDAARNRLRDVATRVVWRTSDRLDIPSLGLFPYFDFRSESEQAKVPEPAWELN
Ga0187880_138037423300018016PeatlandMYLPVAVQKQPQINAAIAEVVSELSPSVKYIRYDIGQDWSGQWAIFFRVLLSDDAARNRLRDVATRVVWRTSDRLDIPSLGLFPYFDFRSESEQAKVPEPAWELN
Ga0187864_1012082823300018022PeatlandMLMPTAATKQQQIDAAVAEVLRELSPDVQRIRYEIAQDWSGDPAVFFRVLLSDEASQDRNLREIVPRVVWSMSDRVYLAELGLFPYFDFRSQSEQAKHPEPTWA
Ga0187869_1039597713300018030PeatlandMYLPMAVTMQQQINAAVAEVVRELAPAVQRINYEIARDWSGQWAIFFRVLLSDEASNRTHLRDVATKVVWRMSERLDLPGIGVFPY
Ga0187863_1023321813300018034PeatlandMVVAADLSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFHVLLSDDASEPKNLREIAPRVVWRMSARLDLPGLGLFPYFNFRSKAEQALVEDLAWA
Ga0187863_1030641113300018034PeatlandPPTSLQKKPQINAAVAEVLKEFSPSVKYIRFDVGQDWTGEWALFFRVMLSDDVSRNGQLGDIANRVMWRTTDRLDLPNLGMFPYFNFRSESEQAKLRDPDWDPQS
Ga0187863_1062996323300018034PeatlandMPTAIAKQPEINAAVRAAERLPGVKYIRYSIAPDSNGRWAIFFRVVLADEVSTGERLRDVTTQVIWRMSEGLDLPNLDLIPYFDFRSQSEQNALNEP
Ga0187875_1008082613300018035PeatlandMRYAENEMIVPRGFTEHPQINAAIAAVLEQLSPWVRHIRYDIALDWSGQWAIFFRVLLSDEAGSRRLREITTQAVWRMSERLDLPNLGLFPYF
Ga0187875_1034445213300018035PeatlandMSPPTSLQKKPQINAAVAEVLKEFSPSVKYIRFDVGQDWTGEWALFFRVMLSDDVSRNGQLGDIANRVMWRTTDRLDLPNLGMFPYFNFRSESEQAKLRDPDWDPQS
Ga0187871_1025804513300018042PeatlandASLQKKPQINAAVAEVLKEFSPSVKYIRFDVGQDWTGEWALFFRVMLSDDVSRSGQLGDVANRVMWRTTDRLDLPNLGMFPYFNFRSESEQAKLRDPDWDPQR
Ga0187887_1034910713300018043PeatlandMIVPREFTGYPQINAAVEAVMQELSPWVSYIRYEIALDWSEQWAVFFRVVLSDEASTHHLREVTSRVIWRMTEKLDLPNLGMFPHFDFRSESEQAALNEPAWAAAM
Ga0187851_1088780323300018046PeatlandMYPIATAKQPQINAAVAAVMRDLSPLGVRHIRFDIAEDWSRQLAIFFRVVLSDAASTERLRDVTTQVIWRMSEKLDLPNLGLFPHFDFRSESEQAALNEPEWAAAS
Ga0181512_126245213300019270PeatlandAEIDAAIQRVQQSIGSDVVRIRYEIGQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVWRMSERLDLPGLGLFPYFNFRSEAEQALDKDLAWA
Ga0182025_131693123300019786PermafrostMYIPIAATVQPQINAAVAGVVRELAPAVQRINYEIAQDWSGQWAVFFRVLLSDEAASRSRLRDVATNVVWRMSEKLDLPSLGLFPHFDFRSCSDKPNK
Ga0210400_1077244213300021170SoilRGILKVQAMIMPGAITKQPQINAAVSAVVQELSPWVRHIRYDVAQDWSGQWAIFFRVLLSDEASRGKNLRDITNRVVWRMSERLDLPELGLFPYFDFRSESEQATLREPEWAAAS
Ga0210388_1128278013300021181SoilMIAATDPTRQPQINAAVTEVVNELSPSVRRIRFDIDQDWSGQSAIFFRVLLSDDASEPKNLRQIAPRVVSRMSDELDLLGLGLFPYFNFRSEAEQALINEPAWT
Ga0210393_1091780023300021401SoilMIPLGVVKQPQINATITEVVNELSPSVRYIRYNIAHDWSGQWAIFFRVVLSDDASRNRLREITTQVVWRMSEGLDLPNLGLFPYFDFRSESEQAALNEAEWARTA
Ga0210386_1104064523300021406SoilMIVATDPTRQPQINAAVTEVVNELSPSVRRIRFDIDQDWSGQSAIFFRVLLSDDASEPKNLRQIAPRVVSRMSDELDLLGLGLFPYFNFRSEAE
Ga0208690_104664013300025434PeatlandMVVAADTSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVRRMSDRLDLAGLGLFPYFNFRSEAEQALDKDLAWA
Ga0208193_100107053300025463PeatlandMFLPIAAAAQPQINAAVSAVVQELTPAVQHIDYKIARDWDGQWAIFFRVLLSDEASHRDRLQDVATQVVWRISDRIDIPGLGLFPHFDFESQSEWAKRNELARA
Ga0207933_1000245303300025679Arctic Peat SoilMAVTAELSRQPQINAAVTDVVNELSPSVRKIRFDIGQDWSGQWAIFFRVLLSDDASKPKNLREIAPRVVWRMSERLDIGGLGLFPYFNFRSETEQALVNEPAWT
Ga0207707_1056817123300025912Corn RhizosphereVRELSPAVQRINYEIAQDWSGEWAVFFRVLLSDEASNRNHLRDVATKVVWRMSDGLDLPSLGLFPYFDFRSQSEQAKLNEPAWA
Ga0207671_1054736313300025914Corn RhizosphereSDAAHETINAAIADVVRELSPAVQRINYEIAQDWSGEWAVFFRVLLSDEASNRNHLRDVATKVVWRMSDGLDLPSLGLFPYFDFRSQSEQAKLNEPAWA
Ga0208043_114680313300027570Peatlands SoilMYLPIAVQKQPQINAAVAEVVNEFSPWVKYMRFDIGQDWSGGWAIFFRVMLSDDAVRNRLGDVATRVMWRTTDRLDLPNLGLFPYFDFRSESERQAA
Ga0208827_105893723300027641Peatlands SoilMQDIAGREIRQRCYPKSEMYLPIAVQKQPQINAAVAEVVNEFSPWVKYMRFDIGQDWSGGWAIFFRVMLSDDAVRNRLGDVATRVMWRTTDRLDLPNLGLFPYFDFRSESEQAKLREPAWEPSLN
Ga0209656_1001842763300027812Bog Forest SoilMYLPVAVAKQQQISDAINAVVAELAPAVQRINYEIAPDWDGRWAIFFRVLLSDEASSQSQLRDIAPNIVRRMSDKLDLPNLGLFPYFDFRSQSEQMAINEPAWA
Ga0209656_1014153433300027812Bog Forest SoilMYPIVIAKQPQINAVVAAVMRDLSPLGVRHIRYDIAEDWSGQWAIFFRVLLSDAASTERLRDVTTQVIWRMSEKLDLPNLGLFPYFDFRSESEQSVLNEPEWAAAS
Ga0209517_1003049743300027854Peatlands SoilMNVAANVGGPARQGCYAESEMYLPIAVQKQPQINAAVAEVVNEFSPWVKYMRFDIGQDWSGGWAIFFRVMLSDDAVRNRLGDVATRVMWRTTDRLDLPNLGLFPYFDFRSESERQAA
Ga0209698_1011823723300027911WatershedsMPSAITKQPEINAAVAAAERLPGVRYVRYSIAPDWNDQWAIFFRVVLADDASTGEKLRDVTTQVIWRMSEWLNLPELGLFPHFDFRTESEQAALNEPSWAKAS
Ga0209698_1016660233300027911WatershedsMPSAITRQPEINAAVAAVERLPGVRYIRYSIAPDWAGQWAIFFRVVLADDASTGERLRDVTTQVVWRMSERLNLPELGLFPHFDFRSESEQAALNEPSWAKAS
Ga0209698_1088806513300027911WatershedsYLPMAVQKQPQINAAIHAVVAELSPAVQRINYEIAQDWSGQWAIFFRVLLSDEAASRNRLRAVATDVVWRMSERLDLPGLELFPYFDFRSQAEQAVLNEPAWA
Ga0209168_1011314823300027986Surface SoilMYLPSAVQKQPQINAAVSDVVRELSPWVRHIRYDIAQDWSGEWAIFFRVLLSDEAAQKRLKDVATRVVWRTSDRLDLPNLGLFPYFDFRSESEQARMHEASWE
Ga0302149_101767123300028552BogMVVDSELTKHPQINAAVTDVMNELSPSVRMIRYNIDQDWSGQWAVFFRVLLSDDASLPTNLREIAPRVVRRISDRLDLPGLGLFPYFNFRSEAEQALVPEPSWN
Ga0311363_1010429213300029922FenMIAPLGAPKQPQINAAITEVVEELSPWVRYIRYSIAHDWSGQWAIFFRVILSDDASKNRLREITTQVVWRMSERLDLPDLELFPHFDFRSESEQATLNEAEWARTA
Ga0311328_1004123823300029939BogMVVDSELTKHPQINSAVTDVMNELSPSVRMIRYNIDQDWSGQWAVFFRVLLSDDASLPTNLREIAPRVVRRISDRLDLPGLGLFPYFNFRSEAEQALVPEPSWN
Ga0311340_1005920023300029943PalsaMDEKHGCYASGEMYLPIAVQKQPQINAAVAEVVNEFSPSVRYIRYDIGQDWSGEWAVFFRVLLSDDAVRNRLKDVATRVVWRTSERLDLPSLGLFPYFDFRSESEQAHLHEAAWEPALS
Ga0311340_1101867823300029943PalsaMHFAWDRIGGCYAESEMFPPAAIEKKPRINAAVAEVIDEFSPSVKYIRYDIGQDWSGEWAVFFRVMLSDDVFRDRLGDIVTRVMWRTTDRLDLPNLGLFPYFNFRSESEQAKLREPAWDPLLN
Ga0311339_1038796713300029999PalsaFAWDRIGGCYAESEMFPPAAIEKKPRINAAVAEVIDEFSPSVKYIRYDIGQDWSGEWAVFFRVMLSDDVSRDRLGDIVTRVMWRTTDRLDLPNLGLFPYFNFRSESEQAKLREPAWDPLL
Ga0311339_1081534223300029999PalsaMVQPVALTKQSQVNAAVTEVIAELSPAVRRIRYEIGQDWEGEWAIYFRVLLSDDASRPANLREIAPRIIRGMSDRLDLPDLGMFPHFNFRSEAEQALFNEPAWA
Ga0311339_1089379813300029999PalsaMYPPTSLEKKPQINAAVAEVLKEFAPSVKYIRFNVGQDWTGEWALFFRVMLSDDVSRNGQLGNIANRVMWRTTDRLDLPNLGMFPYFNFRSESEQAKLRDPDWDPQS
Ga0311338_1024976423300030007PalsaMHFAWDRIGGCYAESEMFPPAAIEKKPRINAAVAEVIDEFSPSVKYIRYDIGQDWSGEWAVFFRVMLSDDVSRDRLGDIVTRVMWRTTDRLDLPNLGLFPYFNFRSESEQAKLREPAWDPLLN
Ga0311338_1028544623300030007PalsaMSPPTSLQNKPQINAAVAEVLKEFAPSVKYIRFNVGQDWTGEWAIFFRVMLSDDVSRNGQLGNIANRVMWRTTDRLDLPNLGMFPYFNFRSESEQAKLRDPDWDPQS
Ga0311338_1182637313300030007PalsaPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVRRMSDRLDLPGLGLFPYFNFRSEAEQALDKDLAWA
Ga0302177_1049855013300030053PalsaGRRRPRKDRRMDEKHGCYASGEMYLPIAVQKQPQINAAVAEVVNEFSPSVRYIRYDIGQDWSGEWAVFFRVLLSDDAVRNRLKDVATRVVWRTSERLDLPSLGLFPYFDFRSESEQAHLHEAAWEPALS
Ga0311370_1042837313300030503PalsaMHFALDRMGGCYAESEMFPPAVIEKKPRINAAVAEVIDEFSPSVKYIRYDIGQDWSGEWAVFFRVMLSDDVSRDRLGDIVTRVMWRTTDRLDLPNLGLFPYFNFRSESEQAKLREPAWDPLLN
Ga0311354_1159100023300030618PalsaIVLFRARRQECTSRWIELGGCYAESEMFPPAAIEKKPRINAAVAEVIDEFSPSVKYIRYDIGQDWSGEWAVFFRVMLSDDVSRDRLGDIVTRVMWRTTDRLDLPNLGLFPYFNFRSESEQAKLREPAWDPLLN
Ga0302180_1049274723300031028PalsaRIGGCYAESEMFPPAAIEKKPRINAAVAEVIDEFSPSVKYIRYDIGQDWSGEWAVFFRVMLSDDVFRDRLGDIVTRVMWRTTDRLDLPNLGLFPYFNFRSESEQAKLREPAWDPLLN
Ga0302325_1034950443300031234PalsaMTEEEHQGHTTWCGILKVKVMMMPGAITKQPQINAAVEQIIKEMSPGVQRIRYEIAPDWSGQWAIFFRVLLSDEVVQQRLKEIATRVVWRTSERLDLPNLGLFPYFDFRSESEQARLHEASWE
Ga0302325_1044363333300031234PalsaMIVPTELAKEPQIDAAVTEVVSQLSPSVRRIRYDIEQDWTGQWAIFFRVLLSDDASKPGNLRQIVPRIIWTMSERLNLPDLGMFPYFNFRSETEQALLRDPAWT
Ga0302325_1136376223300031234PalsaMVRPVALTKQSQVNAAVTEVIAELSPAVRRIRYEIGQDWEGEWAIYFRVLLSDDASRPANLREIAPRIIRGMSDRLDLPDLGMFPHFNFRSEAEQALFNEPAWA
Ga0302325_1145700813300031234PalsaMYPPTSLQKKPQINAAVAEVLKEFSPSVKYIRFDVGQDWTGEWAIFFRVMLSDEAAHNRLGEMATRVMWRTTDRLDYPNLGMFPYFDFRSESEQAKLREPAWDPLPS
Ga0302325_1162744313300031234PalsaGHAGCYPKITMSPPTSLQNKPQINAAVAEVLKEFSPSVKYIRFAVGQDWAGEWALFFRVMLSDDVSRNGQLGDIATRVMWRTTDHLDLPNLGMFPYFDFRSESEQAKLRDPDWDPQS
Ga0302325_1250922513300031234PalsaMYLPIAVQKQPQINAAVAEVVSELSPSVRYMRYDIGQDWSGQWAIFFRVLLSDDAVRTRLRDVATRVMWRTSDRLDLPSLGLFPYFDFRSESEQASLHEPAWEPSLN
Ga0302324_10004348663300031236PalsaMHFAWDRIGGCYAESEMFPPAAIEKKPRINAAVAEVIDEFSPSVKYIRYDIGQDWSGEWAVFFRVMLSDDVFRDRLGDIVTRVMWRTTDRLDLPNLGLFPYFNFRSESEQAKLREPA
Ga0302324_10019857433300031236PalsaMIVPTELAKQPQINAAVTEVVSQLSPSVRRIRYDIEQDWTGQWAIFFRVLLSDDASKPGNLRQIVPRIIWTMSERLNLPDLGMFPYFNFRSETEQALLRDPAWT
Ga0302324_10069990253300031236PalsaEMFPPAAIEKKPRINAAVAEVIDEFSPSVKYIRYDIGQDWSGEWAVFFRVMLSDDVSRDRLGDIVTRVMWRTTDRLDLPNLGLFPYFNFRSESEQAKLREPAWDPLLN
Ga0302324_10089175633300031236PalsaQCYPEIKMSPPTSLQNKPQINAAVAEVLKEFAPSVKYIRFNVGQDWTGEWALFFRVMLSDDVSRNGQLGNIANRVMWRTTDRLDLPNLGMFPYFNFRSESEQAKLRDPDWDPQS
Ga0302324_10159790423300031236PalsaMSPPTSLQNKPQINAAVAEVLKEFAPSVKYIRYSIGQDWTGEWAIFFRVMLSDEAARNRLGDMATRVMWRTTDHLDLPNLGMFPYFDFRSESEQAKLRDPDWDPQS
Ga0302324_10286256923300031236PalsaAVLRYAIGEGKMVIAADSSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVRRMSDRLDLPGLGLFPYFNFRSEAEQALDKDLAWA
Ga0302320_1013318953300031524BogMIAPLGALKQPQINAAITEVVEELSPWVRYIRYSIAHDWSGQWAIFFRVILSDDASKNRLREITTQVVWRMSERLDLPDLELFPHFDFRSESEQATLNEAEWARTA
Ga0302326_1030319423300031525PalsaMSPPTSLQNKPQINAAVAEVLKEFAPSVKYIRFNVGQDWTGEWALFFRVMLSDDVSRNGQLGNIANRVMWRTTDRLDLPNLGMFPYFNFRSESEQAKLRDPDWDPQS
Ga0302326_1090369933300031525PalsaMVIASDSSKQPQINAAVTDVVKELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLREIAPRVVRRMSDRLDLPGLGLFPYFNFRSEAEQALDKDLAWA
Ga0302326_1187031023300031525PalsaMKQPQINAALNEVVTELSPAVRRIRYEIAPDWNGQWAIFFPVLLSDDASKPTNLLEIGPRVVWRMSERLDLPGLGLFPYFDFRSETEQALVQEPAWA
Ga0302326_1252358513300031525PalsaMVVAADLSKQTQIDAAVTDVVEELSPSVRKIRFDIGQEWSGQWAIFFRVLLSDDASEPNLREIAPRVVWRMSERLDLPGLGLFPY
Ga0310686_11433662023300031708SoilMQPQINAAVADLVRELSPAVQRINYEIAQDWSGEWAIFFRVLLSDEASNRSHLRDVATKVVWRMSEKLDLPGLGLFPYFDFRSQSEQAKLSEPAWA
Ga0302319_1184742313300031788BogADLSKQTQIDAAVTDVVEELSPSVRKIRFDIGQEWSGQWAIFFRVLLSDDASEPKSLREIAPRVVRRMSDRLDLAGLGLFPYFKLP
Ga0307472_10104154223300032205Hardwood Forest SoilMAVTKQPQINAAVADVVRELAPAVQHINYEIAQDWSGQWAIFFRVLLSDEASNRNHLRDVATRVVWRMSERLDLPGLGLFPYFDFRSQSEQAKLNEPAWA
Ga0348332_1247964323300032515Plant LitterMVVGADLSTQPQINAAVTDVVKELSPSVKKIRFDIGQDWTGQWAIFFRVLLSDDASEPKNLREIAPRVVWRMSERLDLPGLGLFPYFNFRSEAEQALVKDLAWA
Ga0348332_1315827623300032515Plant LitterMQPQINAAVADLVRELSPAVQRINYEIAQDWSGQWAIFFRVLLSDEASNRDHLRDVATRVVWRMSEKLDLPGLGLFPYFDFRSQSEQAKLSEPAWA
Ga0334840_029043_578_8893300033824SoilMVAADLSKQPQINAAVTDVVRELSPSVKKIRFDIGQDWSGQWAIFFRVLLSDDASEPKNLRDIAPRVVWRMSERLDLPGLGLFPYFNFRSEAEQALVKDLAWA
Ga0334790_015582_2935_32583300033887SoilMCPPADLQKRPQINAAVAEVIKELSPSVRYIRYDIGQDWSGQWAVFFRVLLSDDAARNRLREIVTRVMWRTSDQLDIPALGLFPYFDFRSESEQANLRESAWEPSLS
Ga0370515_0064371_661_9843300034163Untreated Peat SoilMSPHSSLKNKPQINPAVAEVLKEFSPSVKYIRYSIGQDWTGEWAIFFRVMLSDEAARNRLGEMATRVMWRTTDHLDLPNLGMFPHFNFRSESEQAKLREPSWDPLPS
Ga0370492_0038114_1706_19753300034282Untreated Peat SoilMPTAITKQPEINAAVRAAERLPGVKYIRYSIASDSNGRWAIFFRVVLADEVSTGERLRDITTQVIWRMSEELDLPNLGLNPYFDFRSESE
Ga0370492_0095319_2_2923300034282Untreated Peat SoilMYPIATAKQPQINAAVAAVMRDLSPLGVRHIRYDIAEDWSGQLAIFFRVVLSDAASTERLRDVTTQVIWRMSEKLDLPNLGLFPHFDFRSESEQAAL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.