NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F047137

Metagenome Family F047137

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047137
Family Type Metagenome
Number of Sequences 150
Average Sequence Length 46 residues
Representative Sequence LYIAYLGIRHTVKRVTLEEPDDILFTEIAQPEGAPPIAADEATAARLT
Number of Associated Samples 119
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.67 %
% of genes near scaffold ends (potentially truncated) 97.33 %
% of genes from short scaffolds (< 2000 bps) 93.33 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.000 % of family members)
Environment Ontology (ENVO) Unclassified
(27.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.333 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 7.89%    Coil/Unstructured: 92.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF13751DDE_Tnp_1_6 39.33
PF01145Band_7 3.33
PF01814Hemerythrin 2.67
PF08240ADH_N 0.67
PF05193Peptidase_M16_C 0.67
PF13277YmdB 0.67
PF00196GerE 0.67
PF04151PPC 0.67
PF01494FAD_binding_3 0.67
PF00230MIP 0.67
PF04545Sigma70_r4 0.67
PF13336AcetylCoA_hyd_C 0.67
PF00115COX1 0.67
PF03466LysR_substrate 0.67
PF13185GAF_2 0.67
PF04892VanZ 0.67
PF06737Transglycosylas 0.67
PF01738DLH 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.33
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.67
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.67
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.67
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725004|GPKC_F5V46DG03FS7OSAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363513Open in IMG/M
2140918007|ConsensusfromContig112888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363630Open in IMG/M
2170459019|G14TP7Y01CKGY7All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300000953|JGI11615J12901_10952683All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300000956|JGI10216J12902_115595061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300002076|JGI24749J21850_1067540All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300002568|C688J35102_118512172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales567Open in IMG/M
3300002568|C688J35102_119089458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300003996|Ga0055467_10037491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1196Open in IMG/M
3300004156|Ga0062589_101031472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia771Open in IMG/M
3300004157|Ga0062590_102543388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300004479|Ga0062595_101618799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300004643|Ga0062591_100936103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia817Open in IMG/M
3300005093|Ga0062594_102373027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300005093|Ga0062594_102585736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M
3300005172|Ga0066683_10394980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria855Open in IMG/M
3300005331|Ga0070670_102167319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300005332|Ga0066388_104893636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300005336|Ga0070680_100530788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1008Open in IMG/M
3300005337|Ga0070682_101211163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia638Open in IMG/M
3300005339|Ga0070660_101536066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300005339|Ga0070660_101666943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300005535|Ga0070684_101385258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300005543|Ga0070672_101023902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia732Open in IMG/M
3300005547|Ga0070693_100419552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363932Open in IMG/M
3300005713|Ga0066905_101098875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia706Open in IMG/M
3300005718|Ga0068866_10558212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia767Open in IMG/M
3300005718|Ga0068866_11214594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300005718|Ga0068866_11447973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300005841|Ga0068863_100943618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363864Open in IMG/M
3300005844|Ga0068862_101223089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300006237|Ga0097621_100751942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria900Open in IMG/M
3300009094|Ga0111539_12210522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300009098|Ga0105245_12959492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae526Open in IMG/M
3300009147|Ga0114129_12522498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria614Open in IMG/M
3300009174|Ga0105241_12346841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300009176|Ga0105242_11420846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria722Open in IMG/M
3300009176|Ga0105242_13005652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300009551|Ga0105238_10394404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU3631377Open in IMG/M
3300009789|Ga0126307_11104736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363641Open in IMG/M
3300009789|Ga0126307_11620243All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300009840|Ga0126313_10075577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2432Open in IMG/M
3300009840|Ga0126313_10153158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1743Open in IMG/M
3300009840|Ga0126313_10546475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria930Open in IMG/M
3300010038|Ga0126315_10011273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4247Open in IMG/M
3300010038|Ga0126315_10652249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363683Open in IMG/M
3300010038|Ga0126315_10910198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300010039|Ga0126309_11007648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300010040|Ga0126308_10353053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria974Open in IMG/M
3300010040|Ga0126308_10435139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria879Open in IMG/M
3300010040|Ga0126308_10468407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia848Open in IMG/M
3300010042|Ga0126314_10630943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria783Open in IMG/M
3300010044|Ga0126310_11473123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300010045|Ga0126311_10416039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1037Open in IMG/M
3300010166|Ga0126306_10636164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria852Open in IMG/M
3300010166|Ga0126306_10951495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300010403|Ga0134123_11880412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300011003|Ga0138514_100066197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria751Open in IMG/M
3300011119|Ga0105246_11944987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300012188|Ga0136618_10272558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria730Open in IMG/M
3300012206|Ga0137380_11055157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300012355|Ga0137369_10634338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria740Open in IMG/M
3300012487|Ga0157321_1026260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300012490|Ga0157322_1021767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363623Open in IMG/M
3300012531|Ga0136640_10271383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia724Open in IMG/M
3300012680|Ga0136612_10434784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300012898|Ga0157293_10007121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1672Open in IMG/M
3300012906|Ga0157295_10289501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300012941|Ga0162652_100034728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300012985|Ga0164308_10924554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia770Open in IMG/M
3300013297|Ga0157378_12714803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300013307|Ga0157372_12801977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300014969|Ga0157376_11794540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300015372|Ga0132256_100564748All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300015373|Ga0132257_101838429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria779Open in IMG/M
3300015373|Ga0132257_104423894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363511Open in IMG/M
3300015374|Ga0132255_101712588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria954Open in IMG/M
3300017695|Ga0180121_10159452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363828Open in IMG/M
3300017965|Ga0190266_10231090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria911Open in IMG/M
3300018054|Ga0184621_10363547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300018422|Ga0190265_10498445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1330Open in IMG/M
3300018422|Ga0190265_13831762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300018432|Ga0190275_10159834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2087Open in IMG/M
3300018432|Ga0190275_11568445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria736Open in IMG/M
3300018432|Ga0190275_11860949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300018432|Ga0190275_12168584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300018466|Ga0190268_10790573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300018469|Ga0190270_12905770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300018476|Ga0190274_12758551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300018481|Ga0190271_10050075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3550Open in IMG/M
3300018920|Ga0190273_11206143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300019356|Ga0173481_10852901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300019767|Ga0190267_10011924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2380Open in IMG/M
3300019767|Ga0190267_11133092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300019767|Ga0190267_11196204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300021078|Ga0210381_10066180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU3631117Open in IMG/M
3300022756|Ga0222622_10400639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria966Open in IMG/M
3300022756|Ga0222622_11131470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300025721|Ga0209587_1084316All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300025934|Ga0207686_11719203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300025944|Ga0207661_11591833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300025945|Ga0207679_10480531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1106Open in IMG/M
3300026067|Ga0207678_10537156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU3631022Open in IMG/M
3300026078|Ga0207702_10613223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU3631068Open in IMG/M
3300026088|Ga0207641_11011225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363828Open in IMG/M
3300027866|Ga0209813_10303223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300027876|Ga0209974_10400163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300028281|Ga0247689_1039157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300028379|Ga0268266_10636631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU3631026Open in IMG/M
3300028380|Ga0268265_11045134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria809Open in IMG/M
3300028589|Ga0247818_10350007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363989Open in IMG/M
3300028589|Ga0247818_11176389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300028589|Ga0247818_11283911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300028597|Ga0247820_11359167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300028718|Ga0307307_10126903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363789Open in IMG/M
3300028720|Ga0307317_10059485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1234Open in IMG/M
3300028720|Ga0307317_10284444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300028744|Ga0307318_10042738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1493Open in IMG/M
3300028754|Ga0307297_10335304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300028755|Ga0307316_10009340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3030Open in IMG/M
3300028771|Ga0307320_10361846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363580Open in IMG/M
3300028778|Ga0307288_10170833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300028810|Ga0307294_10084206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363983Open in IMG/M
3300028810|Ga0307294_10421346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300028824|Ga0307310_10440905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300028872|Ga0307314_10007575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2304Open in IMG/M
3300028875|Ga0307289_10004195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5674Open in IMG/M
3300028876|Ga0307286_10030573All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300028880|Ga0307300_10365056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300028881|Ga0307277_10486951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300028885|Ga0307304_10443843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363590Open in IMG/M
3300030010|Ga0302299_10659403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363515Open in IMG/M
3300030336|Ga0247826_11433050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300031547|Ga0310887_11047569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300031562|Ga0310886_10507284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GMKU363729Open in IMG/M
3300031731|Ga0307405_10894927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia750Open in IMG/M
3300031852|Ga0307410_10466926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1032Open in IMG/M
3300031852|Ga0307410_11182544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia666Open in IMG/M
3300031858|Ga0310892_11412768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300031901|Ga0307406_10525677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acaciae964Open in IMG/M
3300031995|Ga0307409_100369655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1359Open in IMG/M
3300031995|Ga0307409_102276205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300031996|Ga0308176_10080426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2794Open in IMG/M
3300031996|Ga0308176_11197918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300032004|Ga0307414_10110096All Organisms → cellular organisms → Bacteria2094Open in IMG/M
3300032013|Ga0310906_10375428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria932Open in IMG/M
3300032126|Ga0307415_101051804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300032126|Ga0307415_101809528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300033550|Ga0247829_10761879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300033550|Ga0247829_11797866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.00%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil11.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.33%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.33%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.33%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.67%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.67%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.67%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.67%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.67%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.67%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.67%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.67%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.67%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725004Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002076Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012188Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012487Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510Host-AssociatedOpen in IMG/M
3300012490Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610Host-AssociatedOpen in IMG/M
3300012531Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06)EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025721Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028281Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKC_056270702067725004SoilYIAYLGIRHTVKRVTLEEPDDILFTELDQPEGTPMVGREEATAARLR
A_all_C_030953402140918007SoilRVTLEEPEDILFTEVSAPPGVDALSGDEATAARLT
4MG_008314402170459019Switchgrass, Maize And Mischanthus LitterHRVKQVTLEEPEDILFTEITEPPGVAGPSPEEASAARTVA
JGI11615J12901_1095268313300000953SoilALYIAYLGIRHTVKHVTLDEPDNLFTEVHEPEGVASATDAEAAAARLT*
JGI10216J12902_11559506123300000956SoilYIAYLGIRHTVKRVTLEEPDDILFTEIAQPEGAAPIAAEEATAARLR*
JGI24749J21850_106754023300002076Corn, Switchgrass And Miscanthus RhizosphereGCAVPTLYIAYTGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT*
C688J35102_11851217223300002568SoilLPTLYIAYLGVRHTVKRVTLDEPEDILFTELRQADDAPLVGADEASAARLT*
C688J35102_11908945813300002568SoilPALYIAYIGIRHTVTAVTLDEPDDILFTELSGATLDDDEATAARIG*
Ga0055467_1003749113300003996Natural And Restored WetlandsGVRHTVKRVTLDEPEDILFTEIEVPEGAPDVSSDEATAARVT*
Ga0062589_10103147213300004156SoilGVRYTVKRVTLEEPEDILFTEIDVPEGAPAVSGEEASAARVT*
Ga0062590_10254338813300004157SoilLGGAVPALYIALLGIRHTVKQVTYEEPEDILFTEIAQPAGIDAVAGDEAAAARLV*
Ga0062595_10161879913300004479SoilPALYIAYLGIRHTVKHVTLEEPDDILFTEIAQPAGAAPIAAEEATAARLR*
Ga0062591_10093610323300004643SoilLIAGCALPVLYIGYLGVRYTVKRVTLEEPEDILFTEIDVPEGAPAVSGEEASAARVT*
Ga0062594_10237302713300005093SoilRHTVKRVTLEEPDDILFTEITAPEGVVAATGDEATAARLT*
Ga0062594_10258573613300005093SoilAGGALPALYIAYLGIRHTVTRVTLEEPEDILFTTVEQPEGVPSMAHDEASAAKLT*
Ga0066683_1039498033300005172SoilLYIAYLGIRHTVKQVTLEQPDILFTDVYQPEGISAAGDEEAAAARLA*
Ga0070670_10216731923300005331Switchgrass RhizosphereAVPTLYIAYLGIRHTVTRVTLDEPEDILFTEISAPEGVAVAGDEATAAKLA*
Ga0066388_10489363613300005332Tropical Forest SoilALYIAYLGIRHTVKQVTIEEPDSLLFTEISQPAGVDAAAGDEAAAARLT*
Ga0070680_10053078813300005336Corn RhizosphereDVVFITGGAVPALYIAWLGIRYTVDRVTLDEPDDILFTVVREPEGVPRAGADEAAAARLV
Ga0070682_10121116313300005337Corn RhizospherePALYIAYLGIRYTVKRVTLEEPEDILFTDLDLPDGAATVSDDEATAARIT*
Ga0070660_10153606613300005339Corn RhizosphereVFITGGAVPALYIAWLGIRYTVDRVTLDEPDDILFTVVREPEGVPRAGADEAAAARLV*
Ga0070660_10166694313300005339Corn RhizospherePALYIAYLGVRHTVEHVTTEEPEDILFTDIAGADADSAEASAAGVRV*
Ga0070684_10138525823300005535Corn RhizosphereIRHTVKRVTLSEPEDILFTELSTPEGVPAPSGSEASAADTR*
Ga0070672_10102390223300005543Miscanthus RhizospherePGDIVLIAGCAVPTLYIAYTGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT*
Ga0070693_10041955223300005547Corn, Switchgrass And Miscanthus RhizosphereGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT*
Ga0066905_10109887513300005713Tropical Forest SoilPALYIAYLGIRHTVRQMTLEEPDDILFTEIHEPAGVAEISPEEAAAARIT*
Ga0068866_1055821213300005718Miscanthus RhizosphereCALPALYIAYLGIRYTVKRVTLEEPEDILFTDLDLPDGAATVSDDEATAARIT*
Ga0068866_1121459423300005718Miscanthus RhizosphereLGVRHTVKRVTLDEPDDILFTEITAPEGVVAATGDEATAARLT*
Ga0068866_1144797323300005718Miscanthus RhizosphereRHTVKRVTLEEPEDILFTEIGQPEGAEMIAADEATAARLT*
Ga0068863_10094361823300005841Switchgrass RhizosphereYLGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT*
Ga0068862_10122308913300005844Switchgrass RhizosphereVKRVTLDEPDDILFTEISGITDAGADEATAARIG*
Ga0097621_10075194223300006237Miscanthus RhizosphereALYIAYIGIRHTVKRVTLLEPEDILFTELTTPAGVPAPTDAEASAAETR*
Ga0111539_1221052213300009094Populus RhizosphereIPALYIAYLGVRHTVKRVTLEEPDDILFTEIAQPAGAAPITAEEATAARLR*
Ga0105245_1295949223300009098Miscanthus RhizosphereVTLDEPDDILFTEISGPPGVATAGSDEATAARLT*
Ga0114129_1252249823300009147Populus RhizosphereVTLEEPEDILFTELAHPEGLPPADEEEAAAARLT*
Ga0105241_1234684123300009174Corn RhizosphereGGAIPALYIAYLGIRHTVKQVTLDEPEDILFTEVHEPEGVAAMGDAEAAAARLT*
Ga0105242_1142084613300009176Miscanthus RhizosphereIPALYIAYIGIRHTVKRVTLEEPEDILFTEILVSRDAGAAEEASAAKIT*
Ga0105242_1300565223300009176Miscanthus RhizosphereYLGIRHTVKRVTLEEPEDILFTEVSAPPGVDSLSGDEATAARLT*
Ga0105238_1039440413300009551Corn RhizosphereTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT*
Ga0126307_1110473613300009789Serpentine SoilRHTVKRVTLEEPEDILFTEVLEPAGVPTMGDEEASAARLK*
Ga0126307_1162024313300009789Serpentine SoilVTLEEPEDILFTELIEPEGVEADGGVEASAAKVT*
Ga0126313_1007557753300009840Serpentine SoilRVTLEEPDDILFTEISAPEGVAAVSGEEATAARLT*
Ga0126313_1015315823300009840Serpentine SoilVKHVTLEEPDDILFTEVHEPEGVAPASGDEAAAARLT*
Ga0126313_1054647513300009840Serpentine SoilKRVTLEEPEDILFTEVDQPEGTPAMREDEATAARLT*
Ga0126315_1001127313300010038Serpentine SoilIAWVGIRHTVKRVTLEEPEDILFTEVKEPAGLTSVSADEATAARVT*
Ga0126315_1065224913300010038Serpentine SoilTVKRVTLEEPEDILFTEVVEPEGVPSMGQDEAAAARLT*
Ga0126315_1091019813300010038Serpentine SoilGDIVFMVGGALPALYIAYLGIRHTVKRVTLEEPEDILFTDLDQPDGVPQLSDEEATAARIT*
Ga0126309_1100764813300010039Serpentine SoilAVPTLYIAYLGIRHTVKRVTLDEPEDILFTELAQPAGVPAMGGDEATAARLT*
Ga0126308_1035305313300010040Serpentine SoilLYIAYLGIRHTVKRVTLEEPDDILFTEIAQPEGAPPIAADEATAARLT*
Ga0126308_1043513933300010040Serpentine SoilPALYIAWLGIRYTVKQVTLEEPEDILFTDVHEPEGVAAMGVAEAAAARLT*
Ga0126308_1046840713300010040Serpentine SoilYIAYLGIRHTVKRVTLDEPEDILFTQLEQPAGTPAVTGEEASAARVT*
Ga0126314_1063094323300010042Serpentine SoilRVTLDEPEDILFTELAHPAGLPSADDEEAAAARLT*
Ga0126310_1147312323300010044Serpentine SoilVERVTLDEPDDILFTELDEAEGTPQVTGEEATAARVT*
Ga0126311_1041603913300010045Serpentine SoilALYIAYLGIRHTVKRVTLEEPEDILFTELDQPEGFPAISADEATAAKLT*
Ga0126306_1063616413300010166Serpentine SoilKRVTLEEPEDILFTEVKEPEGTPAVSKDEAAAARLT*
Ga0126306_1095149513300010166Serpentine SoilRHTVKRVTLEEPEDILFTDVREPEGAASVSVEEAAAASVT*
Ga0134123_1188041213300010403Terrestrial SoilAIPTLYIAYLGIRYTVERVTLEEPDDILFTEISAPEGAPVSGEEATAARLT*
Ga0138514_10006619723300011003SoilGGPGVGIRHAVKQVTLEEPDDILFTDVYQPEGISAAGDEEAAAARLA*
Ga0105246_1194498713300011119Miscanthus RhizospherePVPTLYIAYLGIRHTVTRVTLDEPEDILFTEISAPEGVAVAGDEATAAKLA*
Ga0136618_1027255813300012188Polar Desert SandLYIAYLGVRHTVKRVTLEEPEDILFTEVAEPEGLEKVGDREAAAARTT*
Ga0137380_1105515723300012206Vadose Zone SoilHTVKQVTLEEPDDILFADVYQPEGVSAAGDEEAAAARLV*
Ga0137369_1063433813300012355Vadose Zone SoilPVLYIAWVGIRHTVKRVTLEEPEDILFTDVTQPEGAAAVSELEAAAAKVT*
Ga0157321_102626013300012487Arabidopsis RhizosphereLYIAYLGIRHTVKRVTLEEPDDILFTEIDQPEDGPMVGPDEATAARLT*
Ga0157322_102176723300012490Arabidopsis RhizosphereHTVKRVTLDEPDDILFTELSGPPGVETPGGDEATAARLT*
Ga0136640_1027138323300012531Polar Desert SandVKRVTLEEPEDILFTEVEEPEHIPSMKDEEAAAARLT*
Ga0136612_1043478423300012680Polar Desert SandVKRSTLDEPEDILFTELSHPEGALPGSEEATAARLT*
Ga0157293_1000712143300012898SoilFPGDTLFIMGGAVPALYIAYLGIRHTVKHVTLGEADTLFTEVSQPQEVSAFDEQEAAAARLT*
Ga0157295_1028950113300012906SoilGDTLFIMGGAVPALYIAYLGIRHTVKHVTLGEADTLFTEVSQPQEVSAFDEQEAAAARLT
Ga0162652_10003472823300012941SoilRHTVKRVTLEAPDGILFTEVAQPEGAEPIAAEEATAARLR*
Ga0164308_1092455423300012985SoilDVLFIAGGAVPALYIAYLGIRHAVKGVTLHEPDDILFTEIVVPAGAEVDGSGASAADLK*
Ga0157378_1271480313300013297Miscanthus RhizosphereIIFIAGGAIPTLYIAYLGVRHTVKRVTLDEPDDILFTALAHPDGLPPADEEEAAAARLT*
Ga0157372_1280197723300013307Corn RhizosphereVRHTVKRVTLDEPDDILFTEISGITDAGADEATAARIG*
Ga0157376_1179454023300014969Miscanthus RhizosphereGIRHTVKRVTLLEPEDILFTELTTPAGVPAPTDAEASAAETR*
Ga0132256_10056474813300015372Arabidopsis RhizosphereGVRYTVKRVTLDEPDDILFTELSGPPGAEALGGDEATAARLT*
Ga0132257_10183842923300015373Arabidopsis RhizosphereAYLGIRHTVKRVTLDEPDDILFTELSGPPGVETLGGDEATAARLT*
Ga0132257_10442389423300015373Arabidopsis RhizosphereYLGVRHTVKRVTFDEPDDILFTELSGPPGVETLGGDEATAARLT*
Ga0132255_10171258823300015374Arabidopsis RhizosphereVTLEEPDDILFTDVHEPSGVAAMGDSEAAAARLT*
Ga0180121_1015945213300017695Polar Desert SandYLGIRHTVKRTTLEEPEDILFTEIAQPDHVPSMDREEATAARLT
Ga0190266_1023109033300017965SoilGGALPVLYITYVGIRPTVQRTTLEEPEDILFTEIHEPAGVATIGDEAAAAKTTS
Ga0184621_1036354723300018054Groundwater SedimentYIAYLGIRHTVKRVTLDEPEDILFTELSGVTETGEQEATAARLR
Ga0190265_1049844513300018422SoilCIAYVGIRHTVKRMTLEEPEDILFTEIIEPAGVARTGDEEAAAARTT
Ga0190265_1383176223300018422SoilGALPVLYICYIGIRHTVKRVTLEEPEDILFTEIDDPGGVTGVSSDEAAAARVT
Ga0190275_1015983453300018432SoilRHTVKRITLEEPEDILFTELAEPDGVAAIGPDEASAAKLT
Ga0190275_1156844523300018432SoilGGGALPVLYISYVGIRHTVKRSTLSEPDDILFTEIHEPAGVARIGEDEAAAAKTTS
Ga0190275_1186094913300018432SoilIRHTVKRITLEEPEDILFTELSEPEGVAAVGPDEASAAKLT
Ga0190275_1216858423300018432SoilVLYITYVGIRHTVKRTTLEEPEDILFTEIHEPAGVGTVGAEAGAAKTTP
Ga0190268_1079057313300018466SoilAYLGIRHTVNRITLEEPEDILFTEIDFPHGADGAEEASAARVT
Ga0190270_1290577023300018469SoilLYIAYVGIRHTVKRVTLEEPKDILFTDITEPAGVGAAGDAEAAAPRTTT
Ga0190274_1275855123300018476SoilLPALYIAYLGIRHTVNRVTLDEPDDILFTEISGITEPAADEATAARIA
Ga0190271_1005007513300018481SoilVKRVTLDEPEDILFTVIEQPAGVDAPGEAEATAAKVT
Ga0190273_1120614313300018920SoilHTVRRITLEEPEDILFTEVAHPEGVPVEGGEEATAARLT
Ga0173481_1085290123300019356SoilPALYIAYLGVRYTVKRVTLDEPDDILFTELSGPPGVETPGGDEATAARLT
Ga0190267_1001192413300019767SoilLYIAYIGIRHTVKRVTLEEPEDILFTTVAVPAGADAVAEEASAASVT
Ga0190267_1113309213300019767SoilIAYLGVRHTVKRVTLEEPEDILFTELAHPEGLAAADAEEAAAARLT
Ga0190267_1119620423300019767SoilYLGIRHTVKRVTLEEPQDILFTEISEPAGVAGVVHDEASAAKLT
Ga0210381_1006618013300021078Groundwater SedimentAVPALYIAYLGIRHTVKRVTLDEPDDILFTELSVPGDVAAAGGDEATAARLT
Ga0222622_1040063933300022756Groundwater SedimentTLYIAYLGIRHTVKRVTLEEPDDILFTEISAPEGIAAVSGEEATAARLR
Ga0222622_1113147023300022756Groundwater SedimentYLGIRHTVKRVTLEEPDEILFTEIGQPEGAEMIAAEEATAARLR
Ga0209587_108431613300025721Arctic Peat SoilLYIAYLGIRHTVDRVTLDEPDDILFTEIHEPAGVPNMGDEEAAAARRIQA
Ga0207686_1171920323300025934Miscanthus RhizosphereLGIRHTVTRVTLEEPEDILFTEVSAPPGVDSLSGDEATAARLT
Ga0207661_1159183313300025944Corn RhizospherePTLYIAYLGVRHTVKRVTLEEPDDILFTEITAPEGVAAASGDEATAARLT
Ga0207679_1048053133300025945Corn RhizosphereRVTLREPEDILFTELSTPEGVPAPSGSEASAADTR
Ga0207678_1053715633300026067Corn RhizosphereGCAVPTLYIAYTGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT
Ga0207702_1061322323300026078Corn RhizosphereIAYLGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT
Ga0207641_1101122523300026088Switchgrass RhizosphereHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT
Ga0209813_1030322323300027866Populus EndosphereALYIAYLGIRHTVQRVTLEEPEDILFSDIAFADGAAAPEEAGAR
Ga0209974_1040016333300027876Arabidopsis Thaliana RhizosphereRHTVKHVTFEEPDDILFTEIAQPEGVEMIAAQEATAARLR
Ga0247689_103915723300028281SoilLYIAYLGIRYTVRQVTYEGPETLFTEVEQPEGVGAFGEDEAAAARLT
Ga0268266_1063663113300028379Switchgrass RhizosphereYLGIRHTVKRVTLDEPDDILFTELDAPEGIEAEVSGEATAAKVT
Ga0268265_1104513413300028380Switchgrass RhizosphereYLGVRHTVKRVTLDEPDDILFTEISGITDAGADEATAARIG
Ga0247818_1035000733300028589SoilAYLGIRHTVKHVTLEEPDDILFTEIAQPEGAVPIAAEEATAARLR
Ga0247818_1117638913300028589SoilLYIAYVGIRHTVKRVTLEEPEDILFTDITEPAGVGVAGDSGATAAGRTTS
Ga0247818_1128391113300028589SoilAYLGIRHTVKRVTLEEPEDILFTELVQPEGVETAGESEATAARLT
Ga0247820_1135916723300028597SoilLPALYIAYLGIRHTVKRVTLEEPEDILFTEVDQPEGVPMVGPGEASAAKLS
Ga0307307_1012690323300028718SoilGGALPALYIAYLGIRHTVKRVTFDEPDDILFTELSEPGGVVAGGDEATAARLT
Ga0307317_1005948543300028720SoilLYIAYLGIRHTVKRVTLEEPDDILFTEISAPEGIAAVSGEEATAARLR
Ga0307317_1028444413300028720SoilIVGGAVPALYIAYLGIRHTVKRVTLDEPDDILFTELSVPGDVAAAGGDEATAARLT
Ga0307318_1004273823300028744SoilVGGALPALYIAYLGIRYTVKRVTLEQPDDILFTEIGQPEGYPGIAADEATAAKLT
Ga0307297_1033530423300028754SoilPVLYICFVGIRHTVKRVTLEEPDDILFSEIDDPGGVTGVSSDEAAAAKVT
Ga0307316_1000934053300028755SoilVGGALPALYIAYLGIRHTVKRVTLDEPDDILFTEIAQPAGAAPIAPEEATAARLR
Ga0307320_1036184613300028771SoilKRVTLDEPDDILFTELSEPGGVVVGGDEATAARLT
Ga0307288_1017083313300028778SoilVGGAIPALYIAYIGIRHTVKRVTLDEPEDILFTEIAVPEGAAGAEEASAARVT
Ga0307294_1008420633300028810SoilYIAYLGIRHTVKRVTLDEPDDILFTELSVPGDVAAAGGDEATAARLT
Ga0307294_1042134623300028810SoilAYLGIRHTVKRVTFDEPDDILFTELSEPGGVVAGGDEATAARLT
Ga0307310_1044090513300028824SoilIAYLGIRHTVTRITLDEPEDLLFTEISEPAGIAKVGVDEASAARLT
Ga0307314_1000757543300028872SoilLGIRHTVKRVTFDEPDDILFTELSEPGGVVAGGDEATAARLT
Ga0307289_1000419513300028875SoilPALYIAYLGIRHTVKRVTLDEPDDILFTELSVPGDVAAAGGDEATAARLT
Ga0307286_1003057343300028876SoilIRHTVKRVKLDEPDDILFTELSVPGGVAAPGGDEATAARLT
Ga0307300_1036505623300028880SoilHTVKRVTLEEPDDILFTEIAQPEGAALIAAEEATAARLR
Ga0307277_1048695113300028881SoilKRTTLEEPADILFTEITEPPGIAKLGDEEATAARLT
Ga0307304_1044384323300028885SoilLPALYISYLGIRHTVKRVTFDEPDDILFTELSEPGGVVVGGDEATAARLT
Ga0302299_1065940323300030010FenLYIAYLGIRHTVKRVTLDEPEDILFTELSQPAGAGDSGEEEATAARLT
Ga0247826_1143305023300030336SoilIRHTVKRVTLEEPEDILFTEIDAPAGVTDVSPDEAAAAKVT
Ga0310887_1104756913300031547SoilYIAYLGVRHTVKRVTLDEPDDILFTELTVPGDLAAAGGDEATAARLT
Ga0310886_1050728423300031562SoilYIAYLGIRHTVKRVTLEEPDDILFTEIAQPAGAAPIAAEEATAARLR
Ga0307405_1089492723300031731RhizosphereGGAIPALYIAYLGIRHTVKRVTLEEPDDILFTEIHQPVGAAPIASDEATAARLT
Ga0307410_1046692613300031852RhizosphereIPVLYIAYIGIRHTVKRVTLEEPEDILFTELTEPPGVGDPGDAEAASAAKTTT
Ga0307410_1118254413300031852RhizosphereRVTLEEPDDILFTEIHEPDGVAATGVQEAAAAKTTP
Ga0310892_1141276823300031858SoilYLGIRHTVKRVTLEEPEDILFTEIGQPEGAEMIAADEATAARLT
Ga0307406_1052567733300031901RhizosphereRVTLEEPEDILFTEIAEPEGVASPGDAEAASAARTVT
Ga0307409_10036965513300031995RhizosphereAGGAIPALYIAYLGIRHTVKRVTLEEPDDILFTEIHQPVGAAPIASDEATAARLT
Ga0307409_10227620513300031995RhizosphereHTVKRVTLEEPEDILFTELAHPDGLPPADEEEAAAARLT
Ga0308176_1008042613300031996SoilYIAYIGIRHTVKRVLLEEPEDILFTEVAAPADLRPDAAEAAAAKTT
Ga0308176_1119791813300031996SoilGLPGDLIFIGAGAVPVLYICYIGVRHTVKRVTLEEPEDILFTELTEPAGVGQAGDAEAASAARTTT
Ga0307414_1011009613300032004RhizosphereHTVKRVTLEEPEDILFTELTEPPGVGDPGDAEAASAAKTTT
Ga0310906_1037542833300032013SoilIPALYIAYLGVRYTVKQVTYEEPDLLFTELHQPGGLEAAGEDEALAARVT
Ga0307415_10105180413300032126RhizosphereRLPGDIILIGGGAVPVLYIAYIGIRHTVKRVTLEEPEDILFTSITEPEGVGATGDAEATAAQTTT
Ga0307415_10180952823300032126RhizosphereYIAYLGIRHTVKRVTLEEPDDILFTEIAQPEGAAPIAADEATAARLR
Ga0247829_1076187913300033550SoilYIAYLGIRHTVKRVTLDEPILFTEIHQPEGEQAEVEEAAAARLT
Ga0247829_1179786613300033550SoilVLYIAYIGIRHTVKRVTLDEPEDILFTDITEPEGVSKTKPEEAAAARTT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.