Metagenome / Metatranscriptome Family F047018

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F047018
Family Type	Metagenome / Metatranscriptome
Number of Sequences	150
Average Sequence Length	37 residues
Representative Sequence	MLKLIGFVAVVYIGWATGLIQAVLLVTAGLLTTIAGA
Number of Associated Samples	91
Number of Associated Scaffolds	150

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	86.00 %
% of genes near scaffold ends (potentially truncated)	16.00 %
% of genes from short scaffolds (< 2000 bps)	66.00 %
Associated GOLD sequencing projects	86
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (45.333 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (20.667 % of family members)
Environment Ontology (ENVO)	Unclassified (81.333 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (81.333 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 150 Family Scaffolds
PF13203	DUF2201_N	2.00
PF14090	HTH_39	1.33
PF04434	SWIM	1.33
PF01555	N6_N4_Mtase	1.33
PF05292	MCD	1.33
PF09967	DUF2201	0.67
PF07733	DNA_pol3_alpha	0.67
PF00004	AAA	0.67
PF13442	Cytochrome_CBB3	0.67
PF07728	AAA_5	0.67
PF09722	Xre_MbcA_ParS_C	0.67
PF05164	ZapA	0.67
PF02086	MethyltransfD12	0.67
PF01569	PAP2	0.67
PF00924	MS_channel	0.67

COG ID	Name	Functional Category	% Frequency in 150 Family Scaffolds
COG0863	DNA modification methylase	Replication, recombination and repair [L]	1.33
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	1.33
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	1.33
COG4279	Uncharacterized protein, contains SWIM-type Zn finger domain	Function unknown [S]	1.33
COG4715	Uncharacterized protein, contains SWIM-type Zn finger domain	Function unknown [S]	1.33
COG5431	Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain	General function prediction only [R]	1.33
COG2176	DNA polymerase III, alpha subunit (gram-positive type)	Replication, recombination and repair [L]	0.67
COG3027	Cell division protein ZapA, inhibits GTPase activity of FtsZ	Cell cycle control, cell division, chromosome partitioning [D]	0.67
COG3264	Small-conductance mechanosensitive channel MscK	Cell wall/membrane/envelope biogenesis [M]	0.67
COG3392	Adenine-specific DNA methylase	Replication, recombination and repair [L]	0.67
COG0338	DNA-adenine methylase	Replication, recombination and repair [L]	0.67
COG0587	DNA polymerase III, alpha subunit	Replication, recombination and repair [L]	0.67
COG0668	Small-conductance mechanosensitive channel	Cell wall/membrane/envelope biogenesis [M]	0.67

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	54.67 %
Unclassified	root	N/A	45.33 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	53.33 %
Unclassified	root	N/A	45.33 %
cellular organisms	root	All Organisms → cellular organisms	1.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.33 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	37.33 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.00 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	1.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.33 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	37.33 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.00 %
Euryarchaeota	phylum	All Organisms → cellular organisms → Archaea → Euryarchaeota	1.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.33 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	37.33 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.00 %
unclassified Euryarchaeota	no rank	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota	1.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.33 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	37.33 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.00 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	1.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.33 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	32.00 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.00 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	1.33 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.33 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	32.00 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.00 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	1.33 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.67 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2222084011\|2225756836	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3553	Open in IMG/M
3300002408\|B570J29032_109461874	Not Available	782	Open in IMG/M
3300003277\|JGI25908J49247_10002892	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5484	Open in IMG/M
3300005517\|Ga0070374_10077235	All Organisms → Viruses → Predicted Viral	1735	Open in IMG/M
3300005517\|Ga0070374_10369287	Not Available	723	Open in IMG/M
3300005517\|Ga0070374_10393235	Not Available	697	Open in IMG/M
3300005517\|Ga0070374_10459469	Not Available	637	Open in IMG/M
3300005517\|Ga0070374_10607192	Not Available	543	Open in IMG/M
3300005517\|Ga0070374_10625429	Not Available	533	Open in IMG/M
3300005525\|Ga0068877_10163122	Not Available	1355	Open in IMG/M
3300005527\|Ga0068876_10004774	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9474	Open in IMG/M
3300005527\|Ga0068876_10035592	All Organisms → Viruses → Predicted Viral	3085	Open in IMG/M
3300005527\|Ga0068876_10409253	Not Available	755	Open in IMG/M
3300005580\|Ga0049083_10148057	Not Available	805	Open in IMG/M
3300005580\|Ga0049083_10311894	Not Available	525	Open in IMG/M
3300005662\|Ga0078894_10029348	Not Available	4523	Open in IMG/M
3300005662\|Ga0078894_10063248	Not Available	3174	Open in IMG/M
3300005662\|Ga0078894_10094584	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2628	Open in IMG/M
3300005662\|Ga0078894_10095757	All Organisms → Viruses → Predicted Viral	2612	Open in IMG/M
3300005662\|Ga0078894_10106105	Not Available	2485	Open in IMG/M
3300005662\|Ga0078894_10330398	Not Available	1382	Open in IMG/M
3300005662\|Ga0078894_11071024	Not Available	690	Open in IMG/M
3300005662\|Ga0078894_11132501	Not Available	666	Open in IMG/M
3300005739\|Ga0076948_1067318	Not Available	5254	Open in IMG/M
3300005805\|Ga0079957_1002892	Not Available	14839	Open in IMG/M
3300005805\|Ga0079957_1009567	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7413	Open in IMG/M
3300005805\|Ga0079957_1096163	All Organisms → Viruses → Predicted Viral	1628	Open in IMG/M
3300006639\|Ga0079301_1001833	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9621	Open in IMG/M
3300006639\|Ga0079301_1155466	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	674	Open in IMG/M
3300007216\|Ga0103961_1067219	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6556	Open in IMG/M
3300008055\|Ga0108970_11017129	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2583	Open in IMG/M
3300008108\|Ga0114341_10308148	Not Available	819	Open in IMG/M
3300008108\|Ga0114341_10404344	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	660	Open in IMG/M
3300008111\|Ga0114344_1002158	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	11596	Open in IMG/M
3300008259\|Ga0114841_1003432	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10905	Open in IMG/M
3300008259\|Ga0114841_1049267	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2058	Open in IMG/M
3300009068\|Ga0114973_10041301	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2751	Open in IMG/M
3300009152\|Ga0114980_10020894	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4090	Open in IMG/M
3300009152\|Ga0114980_10044233	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2718	Open in IMG/M
3300009152\|Ga0114980_10540729	Not Available	661	Open in IMG/M
3300009152\|Ga0114980_10741981	Not Available	548	Open in IMG/M
3300009155\|Ga0114968_10068555	All Organisms → Viruses → Predicted Viral	2231	Open in IMG/M
3300009159\|Ga0114978_10031170	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3809	Open in IMG/M
3300009159\|Ga0114978_10071674	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2333	Open in IMG/M
3300009159\|Ga0114978_10235677	Not Available	1142	Open in IMG/M
3300009159\|Ga0114978_10662352	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	598	Open in IMG/M
3300009180\|Ga0114979_10103528	Not Available	1759	Open in IMG/M
3300009180\|Ga0114979_10146783	All Organisms → Viruses → Predicted Viral	1445	Open in IMG/M
3300009180\|Ga0114979_10176961	All Organisms → Viruses → Predicted Viral	1300	Open in IMG/M
3300009184\|Ga0114976_10098789	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1668	Open in IMG/M
3300009184\|Ga0114976_10165791	All Organisms → Viruses → Predicted Viral	1231	Open in IMG/M
3300009184\|Ga0114976_10418522	Not Available	699	Open in IMG/M
3300009419\|Ga0114982_1278101	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	523	Open in IMG/M
3300010160\|Ga0114967_10046745	All Organisms → Viruses → Predicted Viral	2762	Open in IMG/M
3300010160\|Ga0114967_10228696	Not Available	985	Open in IMG/M
3300010354\|Ga0129333_10111124	All Organisms → Viruses → Predicted Viral	2528	Open in IMG/M
3300010885\|Ga0133913_10883381	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2322	Open in IMG/M
3300011010\|Ga0139557_1001424	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5522	Open in IMG/M
3300012665\|Ga0157210_1004972	All Organisms → Viruses → Predicted Viral	2754	Open in IMG/M
3300013004\|Ga0164293_10400533	Not Available	924	Open in IMG/M
3300013004\|Ga0164293_10485930	Not Available	817	Open in IMG/M
3300013004\|Ga0164293_10502031	Not Available	801	Open in IMG/M
3300013004\|Ga0164293_10974655	Not Available	531	Open in IMG/M
3300013005\|Ga0164292_10623073	Not Available	695	Open in IMG/M
3300013005\|Ga0164292_10650210	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	677	Open in IMG/M
3300013005\|Ga0164292_10678710	Not Available	659	Open in IMG/M
3300013005\|Ga0164292_10929845	Not Available	545	Open in IMG/M
3300013006\|Ga0164294_10064170	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2803	Open in IMG/M
(restricted) 3300013129\|Ga0172364_10923411	Not Available	535	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10000031	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	195371	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10001476	Not Available	38029	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10200533	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	1359	Open in IMG/M
3300017723\|Ga0181362_1045274	Not Available	921	Open in IMG/M
3300017766\|Ga0181343_1221573	Not Available	515	Open in IMG/M
3300017774\|Ga0181358_1072075	Not Available	1273	Open in IMG/M
3300017778\|Ga0181349_1018584	Not Available	2848	Open in IMG/M
3300017785\|Ga0181355_1170583	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	869	Open in IMG/M
3300017788\|Ga0169931_10007052	Not Available	16779	Open in IMG/M
3300017788\|Ga0169931_10183528	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1814	Open in IMG/M
3300019784\|Ga0181359_1015970	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	2785	Open in IMG/M
3300019784\|Ga0181359_1120806	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	937	Open in IMG/M
3300020074\|Ga0194113_10477326	Not Available	900	Open in IMG/M
3300020151\|Ga0211736_10317005	All Organisms → Viruses → Predicted Viral	1812	Open in IMG/M
3300020151\|Ga0211736_10593687	Not Available	858	Open in IMG/M
3300020151\|Ga0211736_10801090	All Organisms → Viruses → Predicted Viral	3083	Open in IMG/M
3300020151\|Ga0211736_10955326	Not Available	698	Open in IMG/M
3300020159\|Ga0211734_10880018	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6017	Open in IMG/M
3300020159\|Ga0211734_11280513	Not Available	987	Open in IMG/M
3300020160\|Ga0211733_10570755	Not Available	993	Open in IMG/M
3300020160\|Ga0211733_11168080	Not Available	511	Open in IMG/M
3300020161\|Ga0211726_10321286	Not Available	1072	Open in IMG/M
3300020162\|Ga0211735_10328559	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1567	Open in IMG/M
3300020162\|Ga0211735_10357072	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1558	Open in IMG/M
3300020162\|Ga0211735_10397121	All Organisms → Viruses → Predicted Viral	1339	Open in IMG/M
3300020162\|Ga0211735_10916372	Not Available	937	Open in IMG/M
3300020172\|Ga0211729_10079197	All Organisms → Viruses → Predicted Viral	1031	Open in IMG/M
3300020205\|Ga0211731_10476878	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	956	Open in IMG/M
3300020205\|Ga0211731_10957549	All Organisms → Viruses → Predicted Viral	1120	Open in IMG/M
3300020527\|Ga0208232_1003047	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2904	Open in IMG/M
3300020527\|Ga0208232_1020806	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	939	Open in IMG/M
3300020527\|Ga0208232_1037843	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	639	Open in IMG/M
3300020560\|Ga0208852_1043436	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	766	Open in IMG/M
3300020572\|Ga0207909_1057887	Not Available	590	Open in IMG/M
3300020574\|Ga0208221_1068405	Not Available	643	Open in IMG/M
3300021376\|Ga0194130_10009156	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	10294	Open in IMG/M
3300021963\|Ga0222712_10099710	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2036	Open in IMG/M
3300022190\|Ga0181354_1102254	Not Available	933	Open in IMG/M
3300022407\|Ga0181351_1037634	All Organisms → Viruses → Predicted Viral	2048	Open in IMG/M
3300024289\|Ga0255147_1011866	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1893	Open in IMG/M
3300024298\|Ga0255178_1051212	Not Available	801	Open in IMG/M
3300024346\|Ga0244775_10649019	Not Available	854	Open in IMG/M
3300024496\|Ga0255151_1036838	Not Available	824	Open in IMG/M
3300024857\|Ga0256339_1096144	Not Available	610	Open in IMG/M
3300027114\|Ga0208009_1003258	Not Available	4463	Open in IMG/M
3300027143\|Ga0255105_1029548	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	986	Open in IMG/M
3300027593\|Ga0255118_1020742	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1222	Open in IMG/M
3300027600\|Ga0255117_1010272	All Organisms → Viruses → Predicted Viral	2276	Open in IMG/M
3300027608\|Ga0208974_1001636	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8748	Open in IMG/M
3300027621\|Ga0208951_1136166	Not Available	648	Open in IMG/M
3300027642\|Ga0209135_1089547	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1043	Open in IMG/M
3300027710\|Ga0209599_10011864	All Organisms → Viruses → Predicted Viral	2631	Open in IMG/M
3300027710\|Ga0209599_10034743	All Organisms → Viruses → Predicted Viral	1360	Open in IMG/M
(restricted) 3300027728\|Ga0247836_1248466	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	668	Open in IMG/M
(restricted) 3300027730\|Ga0247833_1109593	All Organisms → Viruses → Predicted Viral	1198	Open in IMG/M
3300027734\|Ga0209087_1187518	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	802	Open in IMG/M
3300027734\|Ga0209087_1356333	Not Available	504	Open in IMG/M
3300027759\|Ga0209296_1012760	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4975	Open in IMG/M
3300027759\|Ga0209296_1106576	Not Available	1328	Open in IMG/M
3300027763\|Ga0209088_10032827	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2608	Open in IMG/M
3300027769\|Ga0209770_10105070	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1161	Open in IMG/M
3300027785\|Ga0209246_10203747	Not Available	772	Open in IMG/M
3300027797\|Ga0209107_10303038	Not Available	752	Open in IMG/M
3300027797\|Ga0209107_10421310	Not Available	605	Open in IMG/M
3300028394\|Ga0304730_1009382	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5820	Open in IMG/M
3300031787\|Ga0315900_10067905	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3644	Open in IMG/M
3300031963\|Ga0315901_10352614	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1197	Open in IMG/M
3300033994\|Ga0334996_0066193	All Organisms → Viruses → Predicted Viral	2193	Open in IMG/M
3300033996\|Ga0334979_0106594	Not Available	1738	Open in IMG/M
3300034018\|Ga0334985_0642102	Not Available	584	Open in IMG/M
3300034061\|Ga0334987_0503718	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	738	Open in IMG/M
3300034061\|Ga0334987_0639413	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	621	Open in IMG/M
3300034066\|Ga0335019_0657790	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	607	Open in IMG/M
3300034071\|Ga0335028_0544823	Not Available	634	Open in IMG/M
3300034101\|Ga0335027_0328114	Not Available	1021	Open in IMG/M
3300034101\|Ga0335027_0684942	Not Available	611	Open in IMG/M
3300034102\|Ga0335029_0053949	All Organisms → Viruses → Predicted Viral	2941	Open in IMG/M
3300034102\|Ga0335029_0161761	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1522	Open in IMG/M
3300034122\|Ga0335060_0101699	All Organisms → Viruses → Predicted Viral	1731	Open in IMG/M
3300034200\|Ga0335065_0339385	Not Available	938	Open in IMG/M
3300034283\|Ga0335007_0397075	Not Available	864	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.33%
Host-Associated	Host-Associated	0.67%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	95.33%
Terrestrial	Environmental → Terrestrial	4.00%
Plants	Host-Associated → Plants	0.67%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	93.33%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	4.00%
Marine	Environmental → Aquatic → Marine	2.00%
Leaf	Host-Associated → Plants → Leaf	0.67%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	56.00%
Lentic	Environmental → Aquatic → Freshwater → Lentic	29.33%
River	Environmental → Aquatic → Freshwater → River	4.67%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	4.00%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	1.33%
Unclassified	Environmental → Aquatic → Marine → Unclassified	1.33%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.67%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.67%
Ice	Environmental → Aquatic → Freshwater → Ice	0.67%
Coastal	Environmental → Aquatic → Marine → Coastal	0.67%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.67%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	55.33%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	24.00%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	4.67%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	4.00%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	4.00%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	1.33%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	1.33%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	1.33%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.67%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.67%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.67%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.67%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	0.67%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.67%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	20.67%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	20.00%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	16.67%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	10.67%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	4.67%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	4.00%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	4.00%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	3.33%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.67%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.00%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	2.00%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	1.33%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	1.33%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.67%
Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water	0.67%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.67%
Coastal Lagoon	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Coastal Lagoon	0.67%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.67%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.67%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.67%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	0.67%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	0.67%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.67%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2222084011	Coastal lagoon microbial communities from Albufera, Spain - Sample 1	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005525	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005739	Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300007216	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008111	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA	Environmental	Open in IMG/M
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013129 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm	Environmental	Open in IMG/M
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017788	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020527	Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020560	Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300020572	Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020574	Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021376	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300024289	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h	Environmental	Open in IMG/M
3300024298	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024496	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h	Environmental	Open in IMG/M
3300024857	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300027114	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)	Environmental	Open in IMG/M
3300027143	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h	Environmental	Open in IMG/M
3300027593	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h	Environmental	Open in IMG/M
3300027600	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027621	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)	Environmental	Open in IMG/M
3300027642	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027728 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m	Environmental	Open in IMG/M
3300027730 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027769	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027797	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034018	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034122	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181	Environmental	Open in IMG/M
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
2225165613	2222084011	Coastal Lagoon	MLKMIGIAAVAYVGWITGLIQATLIILAAALTTVASL
B570J29032_1094618743	3300002408	Freshwater	MLKLIGIAVVVYLGWITGLIQATLMITAGVLIAIAGA*
JGI25908J49247_100028921	3300003277	Freshwater Lake	KEPSMLKLIGFVAVVYIGWAIGLIQAVLLVTAGLLTTIAGV*
Ga0070374_100772356	3300005517	Freshwater Lake	MLKLIGFVAVVYIGWAIGLIQAVLLVTAGLLTTIAGV*
Ga0070374_103692872	3300005517	Freshwater Lake	MLKLIGIAAVVYVGWITGLIQATLMITAGVLIAVAGA*
Ga0070374_103932351	3300005517	Freshwater Lake	MLKLIGFVAVVYIGWAIGLIQAVLLVTAGLLTTIAGA*
Ga0070374_104594691	3300005517	Freshwater Lake	MLKLIGIIVVVYIGWAIGLIQAVLLVTAGLLTTIAGA*
Ga0070374_106071922	3300005517	Freshwater Lake	MLKLIGFCFVIYLGWITGLIQTVLLVVAGVLTTIAGA*
Ga0070374_106254291	3300005517	Freshwater Lake	MLKLIGIVAVVYIGWITGLIQATLMITAGVLMAVA
Ga0068877_101631225	3300005525	Freshwater Lake	MLKLIGISAVVYIGWITGIIQAVLLVTAGLLTTVAGA*
Ga0068876_1000477422	3300005527	Freshwater Lake	MLKLIGIAAVAYIGWITGLIQATLMVTAGLLIAIAGA*
Ga0068876_100355929	3300005527	Freshwater Lake	MLKLIGIVAVVYIGWAIGLIQTILLVTAGLLTTIAGV*
Ga0068876_104092533	3300005527	Freshwater Lake	MLKLIGIAAVVYIGWITGIIQAVLLVTAGLLTTVAGA*
Ga0049083_101480573	3300005580	Freshwater Lentic	TKERTMLKLIGIVAVVYIGWITGLIQATLMITAGVLMAVAGA*
Ga0049083_103118942	3300005580	Freshwater Lentic	MLKLIGFVAVVYIGWAIGLIQAVMLVTAGLLTTIAGA*
Ga0078894_100293487	3300005662	Freshwater Lake	MLKLIGIVAVVYIGWAIGLIQAMLLITAGVLTTIAGI*
Ga0078894_100632483	3300005662	Freshwater Lake	MLKLIGIAAVVYIGWITGLIQATLMITAGVLIAVAGA*
Ga0078894_100945848	3300005662	Freshwater Lake	MLKLIGIIAVVYIGWAIGLIQAMLLVTAGLLTTIAGA*
Ga0078894_100957571	3300005662	Freshwater Lake	MLKLIGFCFVVYLGWITGLIQTVLLVIAGVLTMIAGA*
Ga0078894_101061055	3300005662	Freshwater Lake	MLKLIGICFVVYLGWITGLIQATLLVTAGLLTMIAGA*
Ga0078894_103303983	3300005662	Freshwater Lake	MLKLIGITAVVYLGWITGLIQAIMLVTAGVLTTVAGA*
Ga0078894_110710242	3300005662	Freshwater Lake	MLKLIGFCFVIYLGWITGIIQTVLLVTAGVLTMIAGA*
Ga0078894_111325012	3300005662	Freshwater Lake	MLKLIGIVAVIYVGWAIGLIQTMLLVTAGLLTTIAGI*
Ga0076948_10673185	3300005739	Lake Water	MFQLIGIAAVVYVGWITGIIQATLILMAAGLVTVAGL*
Ga0079957_100289221	3300005805	Lake	MLKLIGFVAVVYIGWITGIIQTILLVTAGLLTTVAGA*
Ga0079957_100956722	3300005805	Lake	MLKLIGIAAVAYIGWVTGLIQATLMITAGVLIAIAGV*
Ga0079957_10961635	3300005805	Lake	MFRLIGIAAVVYVGWITGIIQATLILMAAGLTTVAGLG*
Ga0079301_100183317	3300006639	Deep Subsurface	MLKLIGIAVVVYLGWITGVIQATLMITAGVLIAVAGA*
Ga0079301_11554662	3300006639	Deep Subsurface	MLKLIGIAVVVYLGWITGIIQATLLITAALLTTIAGV*
Ga0103961_10672195	3300007216	Freshwater Lake	MFRLIGIAAVVYVGWITGIIQATLILMAAGLTTIAGL*
Ga0108970_110171291	3300008055	Estuary	MLKLIGIVAVVYIGWITGLIQATLMITAGVLIAVAGA*
Ga0114341_103081481	3300008108	Freshwater, Plankton	MLKLIGISAVVYIGWAIGLIQTVLLVTAGLLTTVAGA*
Ga0114341_104043441	3300008108	Freshwater, Plankton	MLKLIGIAAVAYIGWITGLIQATLMVTAGVLIAIAGA*
Ga0114344_100215826	3300008111	Freshwater, Plankton	MLKLIGIAAVAYIGWITGLIQATLMVTAGVLITIAGA*
Ga0114841_100343227	3300008259	Freshwater, Plankton	MLKLIGIAAVAYIGWISGLIQATLMVTAGLLIAIAGA*
Ga0114841_10492671	3300008259	Freshwater, Plankton	MLKLIGIVAVVYIGWAIGLIQAVMLVTAGLLTTIAGA*
Ga0114973_100413016	3300009068	Freshwater Lake	MLKLIGFCFVIYLGWITGLIQTVLLVVAGVLTMIAGA*
Ga0114980_100208947	3300009152	Freshwater Lake	MLQLIGFCAVVYLGWVSGIIQAMLLITAGFLTTIAGV*
Ga0114980_100442336	3300009152	Freshwater Lake	MLKLIGIAAVVYIGWAIGLIQAVLLVTAGLLTTIAGV*
Ga0114980_105407293	3300009152	Freshwater Lake	MLKMIGIAAVVYVGWVTGLIQSALLITAGLLTVIAGA*
Ga0114980_107419812	3300009152	Freshwater Lake	MLKLIGIVAVVYIGWITGLIQATLMITAGVLMAVAGA*
Ga0114968_100685556	3300009155	Freshwater Lake	MQVLITKERTMLKLIGIVVVVYIGWAIGLIQAVMLVTAGLLTTIAGV*
Ga0114978_100311701	3300009159	Freshwater Lake	MLKFIGIVVVVYIGWVSGFIQTVLLVTAGLLTVIAGA*
Ga0114978_100716744	3300009159	Freshwater Lake	MLKLIGIVAAVYIGWAIGLIQAMLLVTAGLLTTIAGV*
Ga0114978_102356775	3300009159	Freshwater Lake	MLKLIGIVVVVYIGWAIGLIQAVLLVTAGLLTTIAGV*
Ga0114978_106623522	3300009159	Freshwater Lake	MLKLIGIVAVVYIGWAIGLIQTMLLVTAGVLTTIAGA*
Ga0114979_101035286	3300009180	Freshwater Lake	MLKLIGFVAVVYIGWAIGFIQAVLLVTAGLLTTIAGV*
Ga0114979_101467834	3300009180	Freshwater Lake	MLKFIGIVVVVYIGWVSGFIQTMLLVTAGLLTVIAGA*
Ga0114979_101769615	3300009180	Freshwater Lake	MLKLIGIVAVVYIGWITGLIQATLMSTAGGLMAVAGA*
Ga0114976_100987895	3300009184	Freshwater Lake	LKLIGFVAVVYIGWAIGLIQAVLLVTAGLLTTIAGV*
Ga0114976_101657911	3300009184	Freshwater Lake	LIGFVAVVYIGWAIGLIQAVLLVTAGLLTTIAGV*
Ga0114976_104185222	3300009184	Freshwater Lake	PSMLKLIGIAAVVYIGWITGLIQATLMITAGVLIAVAGA*
Ga0114982_12781012	3300009419	Deep Subsurface	MLKLIGIAVVVYLGWITGLIQATLLITAALLTTIAGV*
Ga0114967_100467455	3300010160	Freshwater Lake	MLKLIGFCFVVYLGWITGLIQTVLLVVAGVLTTIAGA*
Ga0114967_102286961	3300010160	Freshwater Lake	QVLITKERTMLKLIGIVVVVYIGWAIGLIQAVMLVTAGLLTTIAGV*
Ga0129333_101111243	3300010354	Freshwater To Marine Saline Gradient	MLKMIGLAAVVYVGWITGLIQATMMVTAFILTSIAVI*
Ga0133913_108833811	3300010885	Freshwater Lake	NMLKLIGFCFVIYLGWITGLIQTVLLVVAGVLTTIAGA*
Ga0139557_10014247	3300011010	Freshwater	MLKLIGIVAVVYIGWAIGLIQAMLLVTAGLLTTIAGV*
Ga0157210_10049724	3300012665	Freshwater	MLKLIGIVAVVYIGWITGLIQAALLVTAGLLTMIAGA*
Ga0164293_104005331	3300013004	Freshwater	MLKLIGIAVVVYVGWITGLIQATLLVTAALLTTIAGA*
Ga0164293_104859302	3300013004	Freshwater	MLQLIGFGTVIYLGWVSGIIQAMLLITAGVLTTVAGA*
Ga0164293_105020312	3300013004	Freshwater	MLKLIGIAAVVYIGWITGLIQATLMITAGVLIAIAGA*
Ga0164293_109746553	3300013004	Freshwater	MLQLIGFCAVVYLGWVSGIIQAMLLITAGVLTTVAGV*
Ga0164292_106230732	3300013005	Freshwater	MLKLIGFVAVVYVGWISGIIQAMLLVTAGLLSTVAGL*
Ga0164292_106502104	3300013005	Freshwater	MLKLIGIVAVVYIGWAIGLIQTILLVTAGVLTTIAGV*
Ga0164292_106787103	3300013005	Freshwater	MLKLIGIVAVVYVGWITGLIQATLLITAALLTTIAGV*
Ga0164292_109298452	3300013005	Freshwater	MLQLIGFCAVVYLGWISGIIQAMLLITAGLLTTIAGV*
Ga0164294_100641705	3300013006	Freshwater	MLKLIGIAAVVYVGWALGLIQAVMLVTAGLLTTIAGV*
(restricted) Ga0172364_109234112	3300013129	Sediment	MFRFIGIAVVLYVGWITGIIQATLILMAAGLTTIAGL*
(restricted) Ga0172373_10000031212	3300013131	Freshwater	MFKLIGMATVAYVAWITGLIQATMLITAGVLTTIAGV*
(restricted) Ga0172373_1000147615	3300013131	Freshwater	MFRLIGIAAVLYVGWITGIIQATLILMAAGLTTVAGLG*
(restricted) Ga0172373_102005333	3300013131	Freshwater	VFRLIGIAAVLYVGWITGIIQATLILMAAGLTTIAGL*
Ga0181362_10452741	3300017723	Freshwater Lake	MLKLIGIIVVVYIGWAIGLIQAVLLVTAGLLTTIAGV
Ga0181343_12215732	3300017766	Freshwater Lake	MLKLIGIVAVVYIGWAIGLIQAMLLITAGVLTTIAGI
Ga0181358_10720752	3300017774	Freshwater Lake	MLKLIGFVAVVYIGWITGLIQATLMITAGVLMAVAGA
Ga0181349_10185848	3300017778	Freshwater Lake	MLKLIGIAAVVYIGWITGLIQATLMITAGVLIAVA
Ga0181355_11705832	3300017785	Freshwater Lake	MLKLIGFVAVVYIGWATGLIQAVLLVTAGLLTTIAGA
Ga0169931_1000705215	3300017788	Freshwater	MFRFIGIAVVLYVGWITGIIQATLILMAAGLTTVAGLG
Ga0169931_101835285	3300017788	Freshwater	MLKLIGIAAVLYVGWITGIIQATLILMAAGLTMIAGL
Ga0181359_10159702	3300019784	Freshwater Lake	MLKLIGIAAVVYIGWITGLIQATLMITAGVLIAVAGA
Ga0181359_11208063	3300019784	Freshwater Lake	MLKLIGFVAVVYIGWAIGLIQAVMLVTAGLLTTIAGA
Ga0194113_104773264	3300020074	Freshwater Lake	MFRLIGIAAVLYVGWITGIIQATLILMAAGLTTIAGL
Ga0211736_103170056	3300020151	Freshwater	MLQLIGFCAVVYLGWISGIIQAMLLITAGVLTTIAGV
Ga0211736_105936871	3300020151	Freshwater	MLKLIGIAFVVYVGWITGIIQATLLITAGLLTTIAGI
Ga0211736_108010906	3300020151	Freshwater	MLKLIGIVAVVYIGWITGLIQATMMITAGVLIAIAGA
Ga0211736_109553262	3300020151	Freshwater	MLKLIGIAVVVYLGWVTGVIQATLMITAGVLIAIAGV
Ga0211734_1088001814	3300020159	Freshwater	MLQLIGFCAVVYLGWVSGIIQAMLLITAGLLTTIAGV
Ga0211734_112805132	3300020159	Freshwater	MLKLIGIVVVAYLGWATGVIQATLMITAGVLIAIAGA
Ga0211733_105707551	3300020160	Freshwater	MLKLIGITAVVYLGWITGIIQAILLITAGVLTTVAGA
Ga0211733_111680801	3300020160	Freshwater	MLKLIGIVAVVYIGWTIGLIQTILLVTAGLLATIAGA
Ga0211726_103212864	3300020161	Freshwater	MLKLIGIVVVAYLGWVTGVIQATLMITAGVLIAIAGA
Ga0211735_103285594	3300020162	Freshwater	MLKLIGICFVVYLGWITGLIQTVLLVTAGLLTMIAGA
Ga0211735_103570724	3300020162	Freshwater	MLKLIGIAVVVYLGWITGVIQATLMITAGVLIAIAGA
Ga0211735_103971212	3300020162	Freshwater	MLKLIGIVAVVYFGWASGLIQSALLITAGLLTMIAGIHIG
Ga0211735_109163722	3300020162	Freshwater	MLKLIGIVVVAYLGWVTGVIQATLMITAGVLIAIAGV
Ga0211729_100791972	3300020172	Freshwater	MLKLIGFVAVVYIGWAIGLIQTVLLVTAGLLTTIAGV
Ga0211731_104768782	3300020205	Freshwater	MLKLIGIVAVVYIGWAIGLIQTMLLVTAGVLTTIAGV
Ga0211731_109575491	3300020205	Freshwater	ERTMLKLIGIVVVAYLGWATGVIQATLMITAGVLIAIAGA
Ga0208232_10030475	3300020527	Freshwater	MLKLIGIAVVVYVGWITGLIQATLLVTAALLTTIAGA
Ga0208232_10208061	3300020527	Freshwater	MLKLIGIVAVVYIGWITGLIQATLMITAGVLIAIAGA
Ga0208232_10378432	3300020527	Freshwater	MLKLIGIVAVVYIGWITGLIQATLMITAGVLIAVAGA
Ga0208852_10434363	3300020560	Freshwater	MLKLIGFCFVIYLGWITGLIQTVLLVVAGVLTMIAGA
Ga0207909_10578873	3300020572	Freshwater	MLKLIGIAVVVYLGWITGLIQATLMITAGVLIAIAGA
Ga0208221_10684052	3300020574	Freshwater	MLKLIGIVAVVYVGWITGLIQATLLITAALLTTIAGV
Ga0194130_1000915619	3300021376	Freshwater Lake	MFRLIGIAAVLYVGWITGIIQATLILMAAGLTTVAGLG
Ga0222712_100997105	3300021963	Estuarine Water	MLKLIGIAVVVYLGWITGIIQATLLITAALLTTIAGV
Ga0181354_11022541	3300022190	Freshwater Lake	KEPSMLKLIGFVAVVYIGWITGLIQATLMITAGVLMAVAGA
Ga0181351_10376342	3300022407	Freshwater Lake	MLKLIGIIVVVYIGWAIGLIQAVLLVTAGLLTTIAGA
Ga0255147_10118664	3300024289	Freshwater	MLKLIGMAAVVYVGWAIGLIQTMLLVTAGLLTTIAGI
Ga0255178_10512122	3300024298	Freshwater	MMLKLIGMAAVVYVGWAIGLIQTMLLVTAGLLTTIAGI
Ga0244775_106490192	3300024346	Estuarine	MLKLIGFVAVVYIGWALGLIQAVMLVTAGLLTTIAGA
Ga0255151_10368384	3300024496	Freshwater	RMMLKLIGMAAVVYVGWAIGLIQTMLLVTAGLLTTIAGI
Ga0256339_10961441	3300024857	Freshwater	KERTMLKLIGIVAVVYVGWAIGLIQTMLLVTAGLLITIAGI
Ga0208009_10032584	3300027114	Deep Subsurface	MLKLIGIAVVVYLGWITGVIQATLMITAGVLIAVAGA
Ga0255105_10295483	3300027143	Freshwater	MLKLIGIAAVAYIGWVTGLIQATLMITAGVLIAIAGV
Ga0255118_10207422	3300027593	Freshwater	MLKLIGFVAVVYIGWAIGLIQAVMLVTAGLLTTIAGV
Ga0255117_10102727	3300027600	Freshwater	MLKLIGIAVVVYLGWVTGVIQATLMITAGVLIAIAGA
Ga0208974_10016362	3300027608	Freshwater Lentic	MLKLIGISAVVYIGWITGIIQAVLLVTAGLLTTVAGA
Ga0208951_11361661	3300027621	Freshwater Lentic	LKLIGIAAVVYIGWITGLIQATLMITAGVLIAVAGA
Ga0209135_10895472	3300027642	Freshwater Lake	MLKLIGFVAVVYIGWAIGLIQAVLLVTAGLLTTIAGA
Ga0209599_100118647	3300027710	Deep Subsurface	MLKMIGIAAVVYVGWVTGLIQTTLLITAGFLTVIAGA
Ga0209599_100347433	3300027710	Deep Subsurface	MLKLIGIVAVVYIGWAIGLIQTILLVTAGLLTTIAGV
(restricted) Ga0247836_12484662	3300027728	Freshwater	MLKLIGIAAVAYIGWVTGLIQATLMITAGMLIAIAGA
(restricted) Ga0247833_11095933	3300027730	Freshwater	MLKLIGILAVAYIGWVTGLIQATLMITAGMLIAIAGA
Ga0209087_11875182	3300027734	Freshwater Lake	MLQLIGFCAVVYLGWVSGIIQAMLLITAGFLTTIAGV
Ga0209087_13563331	3300027734	Freshwater Lake	PSMLKLIGIAAVVYIGWITGLIQATLMITAGVLIAVAGA
Ga0209296_10127608	3300027759	Freshwater Lake	MLKLIGIAAVVYIGWAIGLIQAVLLVTAGLLTTIAGV
Ga0209296_11065763	3300027759	Freshwater Lake	MLKLIGIVAAVYIGWAIGLIQAMLLVTAGLLTTIAGV
Ga0209088_100328278	3300027763	Freshwater Lake	HNMLKLIGFCFVIYLGWITGLIQTVLLVVAGVLTTIAGA
Ga0209770_101050703	3300027769	Freshwater Lake	MLKLIGIIAVVYIGWAIGLIQAMLLVTAGLLTTIAGA
Ga0209246_102037471	3300027785	Freshwater Lake	MLKLIGFVAVVYIGWAIGLIQAVLLVTAGLLTTIAG
Ga0209107_103030381	3300027797	Freshwater And Sediment	MLKLIGIAAVVYIGWITGLIQATLMITAGVLIAVAG
Ga0209107_104213102	3300027797	Freshwater And Sediment	MLKLIGIAAVVYIGWITGLIQATLMITAGVLMAVAGA
Ga0304730_10093828	3300028394	Freshwater Lake	MLKLIGFCFVVYLGWITGLIQTVLLVVAGVLTTIAGA
Ga0315900_100679057	3300031787	Freshwater	MLKLIGIAAVAYIGWITGLIQATLMVTAGLLIAIAGA
Ga0315901_103526141	3300031963	Freshwater	MLKLIGIAAVAYIGWITGLIQATLMVTAGVLIAIAGA
Ga0334996_0066193_1837_1959	3300033994	Freshwater	MLKMIGIVAVVYFGWVTGLIQSALLITAGLLTVIAGIHIG
Ga0334979_0106594_885_998	3300033996	Freshwater	MLKLIGFVAVVYVGWISGIIQAMLLVTAGLLSTVAGL
Ga0334985_0642102_475_582	3300034018	Freshwater	KLIGIAAVVYIGWITGLIQATLMITAGVLIAIAGA
Ga0334987_0503718_2_124	3300034061	Freshwater	ERTMLQLIGFCAVVYLGWVSGIIQAMLLITAGVLTTVAGA
Ga0334987_0639413_4_117	3300034061	Freshwater	MLKLIGIAVIVYIGWITGLIQATLLVTAALLTTIAGA
Ga0335019_0657790_407_523	3300034066	Freshwater	MMLQLIGFGTVIYLGWISGLIQAMLLITAGVLTTVAGA
Ga0335028_0544823_415_528	3300034071	Freshwater	MLQLIGFCAVIYLGWVSGIIQAMLLITAGVLTTVAGA
Ga0335027_0328114_132_245	3300034101	Freshwater	MLKLIGIIAVVYIGWITGLIQATLMITAGVLIAIAGA
Ga0335027_0684942_209_322	3300034101	Freshwater	MLQLIGFGTVIYLGWVSGIIQAMLLITAGVLTTVAGV
Ga0335029_0053949_1661_1774	3300034102	Freshwater	MLQLIGFGTVIYLGWISGLIQAMLLITAGVLTTVAGA
Ga0335029_0161761_1105_1227	3300034102	Freshwater	MLKLIGIVAVVYFGWVSGLIQSALLITAGLLTVIAGIHIG
Ga0335060_0101699_1619_1729	3300034122	Freshwater	LQLIGFGTVIYLGWVSGIIQAMLLITAGVLTTVAGA
Ga0335065_0339385_361_474	3300034200	Freshwater	MLKLIGIAVVVYVGWITGLIQATLMITAGVLIAIAGA
Ga0335007_0397075_729_842	3300034283	Freshwater	MLKLIGIAVVVYLGWITGVIQATLLITAALLTTIAGV

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters