Basic Information | |
---|---|
Family ID | F046933 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 150 |
Average Sequence Length | 45 residues |
Representative Sequence | MTFPMWQVQLERMRGLFAQRGLPWLDAREERALLDYLAAHAGTS |
Number of Associated Samples | 123 |
Number of Associated Scaffolds | 150 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 12.33 % |
% of genes near scaffold ends (potentially truncated) | 58.67 % |
% of genes from short scaffolds (< 2000 bps) | 83.33 % |
Associated GOLD sequencing projects | 112 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.70 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.667 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (26.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 150 Family Scaffolds |
---|---|---|
PF13417 | GST_N_3 | 21.33 |
PF01242 | PTPS | 16.67 |
PF12172 | DUF35_N | 10.00 |
PF07690 | MFS_1 | 4.67 |
PF02036 | SCP2 | 3.33 |
PF01593 | Amino_oxidase | 2.67 |
PF02798 | GST_N | 2.00 |
PF12681 | Glyoxalase_2 | 1.33 |
PF00106 | adh_short | 0.67 |
PF01796 | OB_aCoA_assoc | 0.67 |
PF02604 | PhdYeFM_antitox | 0.67 |
PF08223 | PaaX_C | 0.67 |
PF04248 | NTP_transf_9 | 0.67 |
PF03795 | YCII | 0.67 |
PF13410 | GST_C_2 | 0.67 |
PF00903 | Glyoxalase | 0.67 |
PF00561 | Abhydrolase_1 | 0.67 |
PF03473 | MOSC | 0.67 |
PF05992 | SbmA_BacA | 0.67 |
PF01323 | DSBA | 0.67 |
PF07110 | EthD | 0.67 |
PF00067 | p450 | 0.67 |
PF01467 | CTP_transf_like | 0.67 |
PF08659 | KR | 0.67 |
PF03352 | Adenine_glyco | 0.67 |
PF13249 | SQHop_cyclase_N | 0.67 |
PF02913 | FAD-oxidase_C | 0.67 |
PF00884 | Sulfatase | 0.67 |
PF00494 | SQS_PSY | 0.67 |
PF02515 | CoA_transf_3 | 0.67 |
PF10041 | DUF2277 | 0.67 |
COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
---|---|---|---|
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 16.67 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.67 |
COG1545 | Uncharacterized OB-fold protein, contains Zn-ribbon domain | General function prediction only [R] | 0.67 |
COG1562 | Phytoene/squalene synthetase | Lipid transport and metabolism [I] | 0.67 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.67 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.67 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.67 |
COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.67 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.67 |
COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.67 |
COG3327 | DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation) | Transcription [K] | 0.67 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.67 % |
Unclassified | root | N/A | 7.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002560|JGI25383J37093_10145834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
3300002908|JGI25382J43887_10392609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
3300003994|Ga0055435_10257947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
3300004157|Ga0062590_100847136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 848 | Open in IMG/M |
3300004480|Ga0062592_100432487 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300005166|Ga0066674_10009191 | All Organisms → cellular organisms → Bacteria | 4035 | Open in IMG/M |
3300005167|Ga0066672_10391608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 909 | Open in IMG/M |
3300005171|Ga0066677_10004382 | All Organisms → cellular organisms → Bacteria | 5600 | Open in IMG/M |
3300005171|Ga0066677_10299725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 918 | Open in IMG/M |
3300005177|Ga0066690_10096147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1896 | Open in IMG/M |
3300005186|Ga0066676_11180805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
3300005187|Ga0066675_11201123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 563 | Open in IMG/M |
3300005332|Ga0066388_100767750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1561 | Open in IMG/M |
3300005332|Ga0066388_103704839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 780 | Open in IMG/M |
3300005332|Ga0066388_106927055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
3300005332|Ga0066388_107810438 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300005345|Ga0070692_10743380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
3300005445|Ga0070708_100512021 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300005450|Ga0066682_10099041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1829 | Open in IMG/M |
3300005467|Ga0070706_100399751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1279 | Open in IMG/M |
3300005467|Ga0070706_100785307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 882 | Open in IMG/M |
3300005468|Ga0070707_100065613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3487 | Open in IMG/M |
3300005518|Ga0070699_100077497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2894 | Open in IMG/M |
3300005518|Ga0070699_101781503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
3300005529|Ga0070741_10009392 | All Organisms → cellular organisms → Bacteria | 19031 | Open in IMG/M |
3300005533|Ga0070734_10000366 | All Organisms → cellular organisms → Bacteria | 102187 | Open in IMG/M |
3300005536|Ga0070697_100765880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 853 | Open in IMG/M |
3300005540|Ga0066697_10763886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
3300005549|Ga0070704_100320144 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300005553|Ga0066695_10138038 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
3300005555|Ga0066692_10128424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1536 | Open in IMG/M |
3300005557|Ga0066704_10304066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1077 | Open in IMG/M |
3300005557|Ga0066704_10527695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 773 | Open in IMG/M |
3300005560|Ga0066670_10153399 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
3300005561|Ga0066699_10356894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
3300005566|Ga0066693_10051912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1372 | Open in IMG/M |
3300005568|Ga0066703_10773656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
3300005569|Ga0066705_10157192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1400 | Open in IMG/M |
3300005569|Ga0066705_10938873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
3300005586|Ga0066691_10141807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1377 | Open in IMG/M |
3300005598|Ga0066706_10168637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1661 | Open in IMG/M |
3300005713|Ga0066905_100213827 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
3300005713|Ga0066905_102033303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
3300005764|Ga0066903_103651210 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300005764|Ga0066903_105455124 | Not Available | 671 | Open in IMG/M |
3300006031|Ga0066651_10073279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1664 | Open in IMG/M |
3300006032|Ga0066696_10059434 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
3300006796|Ga0066665_10023660 | All Organisms → cellular organisms → Bacteria | 3907 | Open in IMG/M |
3300006871|Ga0075434_100483842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1259 | Open in IMG/M |
3300009012|Ga0066710_100550447 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
3300009012|Ga0066710_100969105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1311 | Open in IMG/M |
3300009090|Ga0099827_10386457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1195 | Open in IMG/M |
3300009137|Ga0066709_102440436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
3300009137|Ga0066709_103733379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 553 | Open in IMG/M |
3300009137|Ga0066709_103910548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300009792|Ga0126374_11826229 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300010047|Ga0126382_11952573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
3300010047|Ga0126382_12520789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
3300010048|Ga0126373_11070750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 872 | Open in IMG/M |
3300010303|Ga0134082_10133960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 996 | Open in IMG/M |
3300010304|Ga0134088_10132223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1183 | Open in IMG/M |
3300010321|Ga0134067_10285417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
3300010323|Ga0134086_10168751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 806 | Open in IMG/M |
3300010360|Ga0126372_12246454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 595 | Open in IMG/M |
3300010361|Ga0126378_12683871 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300010376|Ga0126381_103624422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 605 | Open in IMG/M |
3300010397|Ga0134124_10875202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 903 | Open in IMG/M |
3300010398|Ga0126383_11124581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 875 | Open in IMG/M |
3300010398|Ga0126383_11272728 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300010398|Ga0126383_13200714 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300010400|Ga0134122_13415435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
3300011271|Ga0137393_11037652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
3300012189|Ga0137388_11390192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
3300012203|Ga0137399_10742071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 827 | Open in IMG/M |
3300012211|Ga0137377_10144635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2275 | Open in IMG/M |
3300012285|Ga0137370_11051071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
3300012359|Ga0137385_10312729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1350 | Open in IMG/M |
3300012390|Ga0134054_1077731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 656 | Open in IMG/M |
3300012398|Ga0134051_1243938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 613 | Open in IMG/M |
3300012582|Ga0137358_11060272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
3300012929|Ga0137404_10457748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1133 | Open in IMG/M |
3300012976|Ga0134076_10396035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
3300014154|Ga0134075_10263607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
3300014157|Ga0134078_10312672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 679 | Open in IMG/M |
3300015241|Ga0137418_10275300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1417 | Open in IMG/M |
3300015245|Ga0137409_11374431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
3300015357|Ga0134072_10395033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
3300015358|Ga0134089_10517366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
3300015371|Ga0132258_10186242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 5022 | Open in IMG/M |
3300015374|Ga0132255_103266222 | Not Available | 691 | Open in IMG/M |
3300016445|Ga0182038_10131880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1876 | Open in IMG/M |
3300017659|Ga0134083_10046483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1624 | Open in IMG/M |
3300017659|Ga0134083_10059271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1455 | Open in IMG/M |
3300017659|Ga0134083_10259747 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300018058|Ga0187766_10047176 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
3300018060|Ga0187765_10160926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1273 | Open in IMG/M |
3300018431|Ga0066655_10017820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3250 | Open in IMG/M |
3300018431|Ga0066655_11282742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
3300018468|Ga0066662_10806558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 911 | Open in IMG/M |
3300018482|Ga0066669_10371323 | Not Available | 1198 | Open in IMG/M |
3300018482|Ga0066669_10413035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1147 | Open in IMG/M |
3300020583|Ga0210401_11537897 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300021478|Ga0210402_11009826 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300025823|Ga0210123_1206903 | Not Available | 565 | Open in IMG/M |
3300025922|Ga0207646_11102950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 698 | Open in IMG/M |
3300025922|Ga0207646_11422261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
3300026075|Ga0207708_11107550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
3300026307|Ga0209469_1074840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1023 | Open in IMG/M |
3300026307|Ga0209469_1153006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
3300026315|Ga0209686_1002953 | All Organisms → cellular organisms → Bacteria | 7876 | Open in IMG/M |
3300026324|Ga0209470_1026131 | All Organisms → cellular organisms → Bacteria | 3063 | Open in IMG/M |
3300026324|Ga0209470_1264094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 679 | Open in IMG/M |
3300026326|Ga0209801_1117981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1139 | Open in IMG/M |
3300026326|Ga0209801_1336178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300026327|Ga0209266_1263410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
3300026331|Ga0209267_1003515 | All Organisms → cellular organisms → Bacteria | 9743 | Open in IMG/M |
3300026332|Ga0209803_1175399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 810 | Open in IMG/M |
3300026334|Ga0209377_1138094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 947 | Open in IMG/M |
3300026523|Ga0209808_1168559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 805 | Open in IMG/M |
3300026529|Ga0209806_1176120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
3300026540|Ga0209376_1375897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300026547|Ga0209156_10221633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 893 | Open in IMG/M |
3300026548|Ga0209161_10050201 | All Organisms → cellular organisms → Bacteria | 2732 | Open in IMG/M |
3300026550|Ga0209474_10406834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 707 | Open in IMG/M |
3300027748|Ga0209689_1200324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 875 | Open in IMG/M |
3300027826|Ga0209060_10000361 | All Organisms → cellular organisms → Bacteria | 90938 | Open in IMG/M |
(restricted) 3300028043|Ga0233417_10305562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 719 | Open in IMG/M |
3300031563|Ga0307436_1130106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 703 | Open in IMG/M |
3300031713|Ga0318496_10406162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 753 | Open in IMG/M |
3300031720|Ga0307469_10356234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1231 | Open in IMG/M |
3300031748|Ga0318492_10032795 | All Organisms → cellular organisms → Bacteria | 2343 | Open in IMG/M |
3300031770|Ga0318521_10971223 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300031823|Ga0307478_10917540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
3300031890|Ga0306925_10091159 | All Organisms → cellular organisms → Bacteria | 3236 | Open in IMG/M |
3300031947|Ga0310909_10527105 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300032041|Ga0318549_10376612 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300032144|Ga0315910_10062828 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
3300032144|Ga0315910_10814817 | Not Available | 726 | Open in IMG/M |
3300032174|Ga0307470_11758474 | Not Available | 524 | Open in IMG/M |
3300032180|Ga0307471_100080579 | All Organisms → cellular organisms → Bacteria | 2862 | Open in IMG/M |
3300032180|Ga0307471_101067286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 974 | Open in IMG/M |
3300032180|Ga0307471_104076730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
3300032205|Ga0307472_101883267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 596 | Open in IMG/M |
3300033289|Ga0310914_10196754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1799 | Open in IMG/M |
3300033481|Ga0316600_11355623 | Not Available | 506 | Open in IMG/M |
3300033502|Ga0326731_1056610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 916 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.33% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.33% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.67% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.00% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.33% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.33% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.33% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.33% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.67% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.67% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.67% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.67% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300025823 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
3300031563 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25383J37093_101458341 | 3300002560 | Grasslands Soil | AMWKVQMGRMREEFVRRGMPWLAPDEERALLDYLAAHAGSS* |
JGI25382J43887_103926092 | 3300002908 | Grasslands Soil | GCHGLNAPGSMTFPMWQVQLERMRGLFAQRGLPWLDAREERALLDYLAAHAGTS* |
Ga0055435_102579471 | 3300003994 | Natural And Restored Wetlands | CHRLYAPGAMTSAMWDLQLGRMRGLYAQRGIPWLPPAEEQALRDYLARHAGTQ* |
Ga0062590_1008471362 | 3300004157 | Soil | GGCHRLYAPSSMTIAMWDLQLGRMRGLFAQRGIPWLSPAEEQALRDYLAAHAGTQ* |
Ga0062592_1004324873 | 3300004480 | Soil | HRLYAPSSMTIAMWDLQLGRMRGLFAQRGIPWLSPAEEQALRDYLAAHAGTQ* |
Ga0066674_100091912 | 3300005166 | Soil | MTWPMWQVQVDRMRALFAQRGLPWLSADEERELRAYLAAHAGTS* |
Ga0066672_103916082 | 3300005167 | Soil | MTWPMWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAGTS* |
Ga0066677_100043825 | 3300005171 | Soil | MTFPMWQAQIERMHGLFAQRGLPWLSAHEERELLDYLAAHAGTS* |
Ga0066677_102997252 | 3300005171 | Soil | MTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS* |
Ga0066690_100961472 | 3300005177 | Soil | VVFRARCAGCHRLSAPASMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS* |
Ga0066676_111808052 | 3300005186 | Soil | MTSEMWQVQIARMRSLFAQRSVRWLTPAEERVVLDYLVAHAGTS* |
Ga0066675_112011231 | 3300005187 | Soil | MWKVQTGRMREEFARRGMPWLTPDEEHALLDYLAAHAGRS* |
Ga0066388_1007677502 | 3300005332 | Tropical Forest Soil | MTADMWRYQVDRMRALFAQRGLSWLPPGDERALLDYLTAHAGTS* |
Ga0066388_1037048391 | 3300005332 | Tropical Forest Soil | MTLEMWKVQIARMHLEFNRRGVPWLTSAEEQALMTYLAAHAGTS* |
Ga0066388_1069270551 | 3300005332 | Tropical Forest Soil | MTIAMWKMQLERMKALFADRGIPWLSPGDERALLDYLAAHAGTS* |
Ga0066388_1078104381 | 3300005332 | Tropical Forest Soil | MTAEMWRFQVGRMRGLFAERGIPWLAPGDERALLDYLTAHAGSS* |
Ga0070692_107433802 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLEMWRFQVDRMREQFARRGLPWLTAEEQSALMDYLAAHAGKS* |
Ga0070708_1005120211 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAEMWTLQVARMRGEFARRGLPWLGTAEEQALLDYLAAHAGTS* |
Ga0066682_100990413 | 3300005450 | Soil | LNAPGSMTFPMWQVQIERMHGLFAQRGLPWLSAHEERELLDYLAAHAGTS* |
Ga0070706_1003997513 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MWEVQIARMRDLFAQRGVPWLTPAEERALRDYLAAHAGSS* |
Ga0070706_1007853072 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GSMTLAMWQVQLGRMREEFARRGMPWLAPDEERALLEYLASHAGTS* |
Ga0070707_1000656131 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LYAPGSMTLAMWQVQLGRMHEEFARRGVPWLAPDEERALLDYLGVHAGTS* |
Ga0070699_1000774974 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAEMWTLQVARMRGEFARRGLPWLGTDEERALLDYLAAHAGTT* |
Ga0070699_1017815031 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SMTLAMWQVQLGRMREEFARRGMPWLAPDEERALLEYLASHAGTS* |
Ga0070741_100093928 | 3300005529 | Surface Soil | MTLEMWKVQIARMHEEFARRGVPWLAADEEAALLDYLTAHAGTS* |
Ga0070734_10000366107 | 3300005533 | Surface Soil | MTAAMWRLQVARMRAPFAQRGLPWLTPAEEQALLDYLTAHAGTR* |
Ga0070697_1007658801 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VLQQRCASCHRIPAPGSMTYEMWRVQLERMRGLYAQRGLPWLTATEEDALRAYLQVHAGES* |
Ga0066697_107638862 | 3300005540 | Soil | MTSEMWQVQIARMRSLFAQRSVPWLTPAEERVVLDYLVAHAGTS* |
Ga0070704_1003201441 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLEMWKVQVDRMHAEFVRRGVPWLAPDEERALLDYLGAHAGTG* |
Ga0066695_101380384 | 3300005553 | Soil | VERMRALFAQRGLPWLSADEERELRAYLAAHAGTS* |
Ga0066692_101284242 | 3300005555 | Soil | VVFRARCAGCHRLSAPASMTWPMWQVQVDRMRALFAQRGLPWLSADEERELRAYLAAHAGTS* |
Ga0066704_103040662 | 3300005557 | Soil | GRMREEFARRGMPWLAPDEERALLDYLAAHAGRS* |
Ga0066704_105276952 | 3300005557 | Soil | MWKVQTGRMREEFARRGMPWLVPDEERALLDYLAAHAGRS* |
Ga0066670_101533991 | 3300005560 | Soil | MTWPMWQVQVDRMRALFAQRGLSWLSADEERETRAYLAAHAGTS* |
Ga0066699_103568942 | 3300005561 | Soil | MTFPMWQVQLERMRGLFAQRGLPWLDAREERALLDYLAAHAGRS* |
Ga0066693_100519123 | 3300005566 | Soil | TLAMWKVQIGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS* |
Ga0066703_107736561 | 3300005568 | Soil | TLAMWKVQIGRMREEFARRGMPWLAPDEERALLDYLAAHAGGS* |
Ga0066705_101571924 | 3300005569 | Soil | MWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS* |
Ga0066705_109388731 | 3300005569 | Soil | YAPGSMTFPMWQAQIERMHGLFAQRRLPWLSAHEERELLDYLAAHAGTS* |
Ga0066691_101418072 | 3300005586 | Soil | VVFRARCAGCHRLSAPASMTWPMWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAGTS* |
Ga0066706_101686373 | 3300005598 | Soil | GSMTLAMWKVQTGRMREEFARRGMPWLTPDEEHALLDYLAAHAGRS* |
Ga0066905_1002138272 | 3300005713 | Tropical Forest Soil | MTIAMWKMQLERMKALFAERGIPWLSPGDERALLDYLAAHAGTS* |
Ga0066905_1020333032 | 3300005713 | Tropical Forest Soil | MTAEMWNVQIERMRALFASRGIPWLTRDDEAALRAY |
Ga0066903_1036512102 | 3300005764 | Tropical Forest Soil | MTIAMWKMQLERMKALFAERGIPWLSPGDERALLDYLTAHAGTS* |
Ga0066903_1054551241 | 3300005764 | Tropical Forest Soil | QVERMRALFAQRGIPWLAPGDERVLLDYLTAHAGGS* |
Ga0066651_100732793 | 3300006031 | Soil | MWQVQVERMRALIAQRGLPWLSADEERELRAYLAAHAGTS* |
Ga0066696_100594342 | 3300006032 | Soil | VVFRARCAGCHRLSAPASMTWPMWQVQVERMRALFAQRGLPWLSADEERELREYLAAHAGTS* |
Ga0066665_100236601 | 3300006796 | Soil | PMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS* |
Ga0075433_102157471 | 3300006852 | Populus Rhizosphere | MTADMWKFQVARMQGLFAQRGIPPLTTDEERLLMEYLTAHAGTS |
Ga0075425_1001561403 | 3300006854 | Populus Rhizosphere | MTADMWKFQVARMQGLFAQRGIPPLTADEERMLMEYLTAHAGTS* |
Ga0075434_1004838423 | 3300006871 | Populus Rhizosphere | MTADMWKVQVARMQGLFAQRGIPRLTADEERELMEYLAAHAGT |
Ga0075424_1001082415 | 3300006904 | Populus Rhizosphere | MTADMWKFQVARMQGLFAQRGIPPLTTDEERLLMEYLTAHAGTS* |
Ga0066710_1005504471 | 3300009012 | Grasslands Soil | RLYAPGSMTLAMWKVQTGRMREEFARRGMPWLTPDEERALLDYLAAHAGRS |
Ga0066710_1009691053 | 3300009012 | Grasslands Soil | MTLAMWKLQLDRMRALFARRGMPWLTPEEERALQDYLAAHAGTT |
Ga0099827_103864572 | 3300009090 | Vadose Zone Soil | MTWPMWQVQVDRMRALFAQRALPWLSADEERDLRAYLAAHAGTS* |
Ga0066709_1024404362 | 3300009137 | Grasslands Soil | EMWNLQVARMRALFARRGIPWLTPEEERALQDYLVAHAGTA* |
Ga0066709_1037333792 | 3300009137 | Grasslands Soil | MTLAMWKLQLDRMRALFARRGIPWITPEEERALQDYLAAHA |
Ga0066709_1039105481 | 3300009137 | Grasslands Soil | DRMRALFARRGMPWLTPEEERALQDYLAAHAGTT* |
Ga0126374_118262291 | 3300009792 | Tropical Forest Soil | HRVYAPGSMTAEMWRFQVGRMRGLFAERGIPWLAPGDERALLDYLVAHAGSS* |
Ga0131092_105559732 | 3300009870 | Activated Sludge | MTAEMWAFQVPRMQERFRQRGMPWLTADEQRQLLEYLTAHAGSG* |
Ga0126382_119525731 | 3300010047 | Tropical Forest Soil | EQVARMQALFAQRGIPALPPDEERVLLEYLTAHAGTS* |
Ga0126382_125207892 | 3300010047 | Tropical Forest Soil | MTAEMWNVQIERMRALFASRGIPWLTPDDEAALRAYVRDHAGTV* |
Ga0126373_110707502 | 3300010048 | Tropical Forest Soil | MTAEMWRFQVGRMRGLFAERGIPWLAPGDERALLDYLVAHAGSS* |
Ga0134082_101339602 | 3300010303 | Grasslands Soil | MWQVQVERMRALFAQRGLPWLSADEERDLRAYLAAHAGTS* |
Ga0134088_101322231 | 3300010304 | Grasslands Soil | GCHRLYAPGSMTFPMWQVQIERMHGLFAQRRLPWLSAHEERELLDYLAAHAGTS* |
Ga0134067_102854172 | 3300010321 | Grasslands Soil | MTFPMWQAQIERMHGLFAQRRLPWLSAHEERELLDYLAAHAGTS* |
Ga0134086_101687511 | 3300010323 | Grasslands Soil | APGSMTLAMWKVQIGRMREEFARRGMPWLVPDEERALLDYLAAHAGRS* |
Ga0126372_122464541 | 3300010360 | Tropical Forest Soil | MTIAMWQFQVERMRGEFAKRGMPWLTTREESALLEYLAAHAGKG* |
Ga0126378_126838712 | 3300010361 | Tropical Forest Soil | KVQLDRMRGLFAKRGIPWLSPDDEHALLDYLQAHAGTS* |
Ga0126381_1036244222 | 3300010376 | Tropical Forest Soil | MTVATWRFQVGRMRELFAQRGLPWLTAEEERQLLDYLAAHAGTS* |
Ga0134124_108752022 | 3300010397 | Terrestrial Soil | DRMHAEFVRRGVPWLAPDEERALLDYLGAHAGTG* |
Ga0126383_111245812 | 3300010398 | Tropical Forest Soil | MTAEMWNVQLERMRALFASRGLPWLAPDDEAALRAYLREHAGTV* |
Ga0126383_112727281 | 3300010398 | Tropical Forest Soil | MTAEMWRFQVGRMRALFADRGLPWLAAGDERALLEYLTAHAGTS* |
Ga0126383_132007142 | 3300010398 | Tropical Forest Soil | QLERMKALFAERGIPWLSPGDERALLEYLAAHAGTS* |
Ga0134122_134154351 | 3300010400 | Terrestrial Soil | PATMTLEMWRFQVDRMREQFARRGLPWLTAEEQSALMDYLAAHAGTS* |
Ga0137393_110376521 | 3300011271 | Vadose Zone Soil | LYAPGSMTLAMWQVQLGRMHEEFARRGMPWLAPDEERALLDYLGAHAGTS* |
Ga0137388_113901922 | 3300012189 | Vadose Zone Soil | MTWPMWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAG |
Ga0137399_107420711 | 3300012203 | Vadose Zone Soil | MWELQLGRMRELFARRGIPWLTSEEERALLDYLRAHAGTS* |
Ga0137377_101446354 | 3300012211 | Vadose Zone Soil | PDSMTLAMWKVQIGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS* |
Ga0137370_110510711 | 3300012285 | Vadose Zone Soil | IGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS* |
Ga0137385_103127293 | 3300012359 | Vadose Zone Soil | HQLYAPGSMTLAMWKVQIGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS* |
Ga0134054_10777311 | 3300012390 | Grasslands Soil | GSMTAEMWNVQVAKMHEEFARRGMPWLEKDEEQALLQYLHDHAGQS* |
Ga0134051_12439382 | 3300012398 | Grasslands Soil | KVQTGRMREEFARRGMPWLVPDEERALLDYLVAHAGRS* |
Ga0137358_110602722 | 3300012582 | Vadose Zone Soil | EMWKVQTGRMREEFTRRGMPWLVPDEERALLDYLAAHAGRS* |
Ga0137404_104577482 | 3300012929 | Vadose Zone Soil | MTAEMWQVQIARMRGLFAQRGIPWLTPAEERILLDYLAAHAGTS* |
Ga0134076_103960351 | 3300012976 | Grasslands Soil | EMWKVQTGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS* |
Ga0134075_102636072 | 3300014154 | Grasslands Soil | MTWPMWQVQVERMRALFAQRGLPWLSADEERDLRAYLAAHAGTS* |
Ga0134078_103126722 | 3300014157 | Grasslands Soil | MTFPMWQVQLERMRGLFAQRGLPWLDAREERALLDYLAAHAGTS* |
Ga0137418_102753001 | 3300015241 | Vadose Zone Soil | MWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAGTS* |
Ga0137409_113744312 | 3300015245 | Vadose Zone Soil | WKVQIGRMREEFARRGMPWLVPDEERALLDYLAAHAGRS* |
Ga0134072_103950332 | 3300015357 | Grasslands Soil | PASMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS* |
Ga0134089_105173662 | 3300015358 | Grasslands Soil | LYAPGSMTLAMWKVQIGRMREEFARRGMPWLVPDEERALLDYLAAHAGRS* |
Ga0132258_101862425 | 3300015371 | Arabidopsis Rhizosphere | MTPDMWRYQVDRMRTLFAQRGIPWLAPDEERALLDYVTSHAGAS* |
Ga0132255_1032662222 | 3300015374 | Arabidopsis Rhizosphere | YQVDRMRGLFAQRGIPWLAPGDERALLDYVTSHAGSS* |
Ga0182038_101318801 | 3300016445 | Soil | QLGRMRGLYAQRGIPWLSSDDEHALLDYLQAHAGTS |
Ga0134083_100464831 | 3300017659 | Grasslands Soil | KVQIGRMREEFARRGMPWLAADEERALLDYLAAHAGRS |
Ga0134083_100592711 | 3300017659 | Grasslands Soil | APGSMTFPMWQAQIERMHGLFAQRRLPWLSAHEERELLDYLAAHAGTS |
Ga0134083_102597472 | 3300017659 | Grasslands Soil | MTFPMWQVQVERMHGLFAQRGLPWLSAHEERELLDYLASHALAS |
Ga0187766_100471763 | 3300018058 | Tropical Peatland | MTFEMWKLQVARMQGEFSRRGLPWLTPAEEHALLDYLAAHAGTS |
Ga0187765_101609262 | 3300018060 | Tropical Peatland | MTIAMWEVQLERMRDVFARRGIPWLMPAEEQALREYLAAHAGGS |
Ga0066655_100178203 | 3300018431 | Grasslands Soil | MTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS |
Ga0066655_112827422 | 3300018431 | Grasslands Soil | MWKVQIGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS |
Ga0066662_108065581 | 3300018468 | Grasslands Soil | MKWPMWKVQVERMRALCAQRGIPWLSADEERELRAYLAAHAGTS |
Ga0066669_103713234 | 3300018482 | Grasslands Soil | GCHRLYAPASMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS |
Ga0066669_104130352 | 3300018482 | Grasslands Soil | MTSEMWKVQVGRMRELFARRGVPWLAPDEERALLEYLATHAGAS |
Ga0210401_115378972 | 3300020583 | Soil | GGCHRVDAPGSMTFEMWKVQLAQMRVLFAKRGIPWLSSDDEQALLDYLQAHAGTS |
Ga0210402_110098261 | 3300021478 | Soil | GGCHRVDAPGSMTFEMWKVQLAQMRVLFAKRGIPWLSSDDEHALLDYLQAHAGTS |
Ga0210123_12069031 | 3300025823 | Natural And Restored Wetlands | VHAPGTMTFEMWKMQLTRMRVLFAQRGIPWLTDVEEQALLRYLERHAGTQ |
Ga0207646_111029502 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLEMWRLQIGRMHELFARREIPWLAPDEERALLDYLGAHAGTG |
Ga0207646_114222612 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAEMWTLQVARMRGEFARRGLPWLGTAEEQALLDYLAAHAGTS |
Ga0207708_111075502 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | SMTLETWRFQVDRMREQFARRGLPWLTAEEQSALMDYLAAHAGKS |
Ga0209469_10748402 | 3300026307 | Soil | MTWPMWQVQVDRMRALFAQRGLPWLSADEERELRAYLAAHAGTS |
Ga0209469_11530061 | 3300026307 | Soil | PGSMTLAMWKVQIGRMREEFARRGMPWLVPDEERALLDYLAAHAGRS |
Ga0209686_10029535 | 3300026315 | Soil | MTFPMWQAQIERMHGLFAQRGLPWLSAHEERELLDYLAAHAGTS |
Ga0209470_10261315 | 3300026324 | Soil | SMTLEMWKVQTGRMREEFARRGMPWLVPDEERALLDYLVAHAGRS |
Ga0209470_12640941 | 3300026324 | Soil | VFRARCAGCHRLSAPASMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGT |
Ga0209801_11179813 | 3300026326 | Soil | MWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS |
Ga0209801_13361782 | 3300026326 | Soil | HRLYAPDSMTLAMWKVQIGRMREEFTRRGMPWLAPDEERTLLDYLAAHAGRS |
Ga0209266_12634102 | 3300026327 | Soil | SMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS |
Ga0209267_10035158 | 3300026331 | Soil | MTFPMWQAQIERMHGLFAQRRLPWLSAHEERELLDYLAAHAGTS |
Ga0209803_11753992 | 3300026332 | Soil | PMWQVQIERMHGLFAQRGLPWLSAHEERELLDYLAAHAGTS |
Ga0209377_11380942 | 3300026334 | Soil | RLYAPGSMTLAMWKVQIGRMREEFARRGMPWLAPDEERALLDYLGAHAGRS |
Ga0209808_11685592 | 3300026523 | Soil | TLEMWKVQTGRMREEFARRGMPWLVPDEERALLDYLVAHAGRS |
Ga0209806_11761203 | 3300026529 | Soil | SMTLAMWKVQIGRMREEFTRRGMPWLAPDEERTLLDYLAAHAGRS |
Ga0209376_13758971 | 3300026540 | Soil | APASMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS |
Ga0209156_102216332 | 3300026547 | Soil | MTWPMWQVQVERMRALFAQRGLPWLSADEERELREYLAAHAGTS |
Ga0209161_100502011 | 3300026548 | Soil | GSMTLAMWKVQTGRMREEFARRGMPWLTPDEEHALLDYLAAHAGRS |
Ga0209474_104068341 | 3300026550 | Soil | VFRARCAGCRRLYAPASMTWPMWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAGT |
Ga0209689_12003242 | 3300027748 | Soil | MTWPMWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAGTS |
Ga0209060_100003612 | 3300027826 | Surface Soil | MTAAMWRLQVARMRAPFAQRGLPWLTPAEEQALLDYLTAHAGTR |
(restricted) Ga0233417_103055621 | 3300028043 | Sediment | TMTLAMWDVQLGRMRGLYAQRGIPWLSPDEEQALRDYLAKHAGTQ |
Ga0307436_11301061 | 3300031563 | Salt Marsh | APGSMTFAMWQVQLDRMRRLYAQRGIPWLRPDEERALLAYLRAHAGTQ |
Ga0318496_104061621 | 3300031713 | Soil | MTFEMWKAQLARMRGLYARRGIPWLSSDDERALLDYLQ |
Ga0307469_103562342 | 3300031720 | Hardwood Forest Soil | MWKFQVSRMHDLFAHRGLPWLTPDEERALLDYLAAHAGTS |
Ga0318492_100327953 | 3300031748 | Soil | APESMTFEMWKAQLGRMRGLYAQRGIPWLSSDDEHALLDYLQAHAGTS |
Ga0318521_109712231 | 3300031770 | Soil | MWKAQLVNMRVLFAKRGIPWLSSDDEHALLDYLQAHAGTS |
Ga0307478_109175401 | 3300031823 | Hardwood Forest Soil | MTIETWRFQLGRMRELFAQRGIPWLTPEEEHALTDYLAAHAG |
Ga0306925_100911593 | 3300031890 | Soil | PGSMTFEMWKAQLGRMRGLYAQRGIPWLSSDDERALLDYLQAHAGTS |
Ga0310909_105271052 | 3300031947 | Soil | EMWKAQLVNMRVLFAKRGIPWLSSDDEHALLDYLQAHAGTS |
Ga0318549_103766122 | 3300032041 | Soil | YAPGSMTFEMWKVQLVNMRVLFAKRGIPWLSSDDEHALLDYLQAHASTS |
Ga0315910_100628281 | 3300032144 | Soil | MTLAMWDVQLARMHALFQQRGIPWLSPPEEQALRDYLA |
Ga0315910_108148172 | 3300032144 | Soil | HRLYTPSSMTLAMWDVQLARMHALFQQRGIPWLSPPEEQALRDYLAKYAGTQ |
Ga0307470_117584742 | 3300032174 | Hardwood Forest Soil | MWKVQIARMHVEFTRRGMPWLTSAEEQALMTYLVAHAGTS |
Ga0307471_1000805794 | 3300032180 | Hardwood Forest Soil | MTLAMWKVQIERMRPLFAQRGMPWLAPDEERALLDYLAAHAGAS |
Ga0307471_1010672862 | 3300032180 | Hardwood Forest Soil | MWQVQVDRMRAMFGQRGLPWLSADEDRELREYLASHAGTS |
Ga0307471_1040767301 | 3300032180 | Hardwood Forest Soil | DAPGAVVLRTRCAGCHGLNAPGSMTFPMWQVQLERMRGLFAQRGLPWLDAREERALLDYLAAHAGRS |
Ga0307472_1018832672 | 3300032205 | Hardwood Forest Soil | MTFPMWQVQLERMRGLFARRGLPWLDARDERALLDYLAAHAGTS |
Ga0310914_101967541 | 3300033289 | Soil | RVYGPGSMTFEMWKAQLGRMRGLYAQRGIPWLSSDDEHALLDYLQAHAGTS |
Ga0316600_113556231 | 3300033481 | Soil | AMWEMQLGRMRSLFAQRGIPWLPPAEERTLRDYLAKHAGTQ |
Ga0326731_10566102 | 3300033502 | Peat Soil | MTLEMWKMQLGRMQALFAERGIPWLSPGDERALLDYLTAHAGTS |
⦗Top⦘ |