NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046933

Metagenome / Metatranscriptome Family F046933

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046933
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 45 residues
Representative Sequence MTFPMWQVQLERMRGLFAQRGLPWLDAREERALLDYLAAHAGTS
Number of Associated Samples 123
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 12.33 %
% of genes near scaffold ends (potentially truncated) 58.67 %
% of genes from short scaffolds (< 2000 bps) 83.33 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.70

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(26.000 % of family members)
Environment Ontology (ENVO) Unclassified
(43.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(66.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.44%    β-sheet: 0.00%    Coil/Unstructured: 55.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.70
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF13417GST_N_3 21.33
PF01242PTPS 16.67
PF12172DUF35_N 10.00
PF07690MFS_1 4.67
PF02036SCP2 3.33
PF01593Amino_oxidase 2.67
PF02798GST_N 2.00
PF12681Glyoxalase_2 1.33
PF00106adh_short 0.67
PF01796OB_aCoA_assoc 0.67
PF02604PhdYeFM_antitox 0.67
PF08223PaaX_C 0.67
PF04248NTP_transf_9 0.67
PF03795YCII 0.67
PF13410GST_C_2 0.67
PF00903Glyoxalase 0.67
PF00561Abhydrolase_1 0.67
PF03473MOSC 0.67
PF05992SbmA_BacA 0.67
PF01323DSBA 0.67
PF07110EthD 0.67
PF00067p450 0.67
PF01467CTP_transf_like 0.67
PF08659KR 0.67
PF03352Adenine_glyco 0.67
PF13249SQHop_cyclase_N 0.67
PF02913FAD-oxidase_C 0.67
PF00884Sulfatase 0.67
PF00494SQS_PSY 0.67
PF02515CoA_transf_3 0.67
PF10041DUF2277 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG07206-pyruvoyl-tetrahydropterin synthaseCoenzyme transport and metabolism [H] 16.67
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.67
COG1545Uncharacterized OB-fold protein, contains Zn-ribbon domainGeneral function prediction only [R] 0.67
COG1562Phytoene/squalene synthetaseLipid transport and metabolism [I] 0.67
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.67
COG2124Cytochrome P450Defense mechanisms [V] 0.67
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.67
COG2343Uncharacterized conserved protein, DUF427 familyFunction unknown [S] 0.67
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.67
COG28183-methyladenine DNA glycosylase TagReplication, recombination and repair [L] 0.67
COG3327DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation)Transcription [K] 0.67
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.67 %
UnclassifiedrootN/A7.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002560|JGI25383J37093_10145834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300002908|JGI25382J43887_10392609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300003994|Ga0055435_10257947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300004157|Ga0062590_100847136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium848Open in IMG/M
3300004480|Ga0062592_100432487All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300005166|Ga0066674_10009191All Organisms → cellular organisms → Bacteria4035Open in IMG/M
3300005167|Ga0066672_10391608All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium909Open in IMG/M
3300005171|Ga0066677_10004382All Organisms → cellular organisms → Bacteria5600Open in IMG/M
3300005171|Ga0066677_10299725All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium918Open in IMG/M
3300005177|Ga0066690_10096147All Organisms → cellular organisms → Bacteria → Proteobacteria1896Open in IMG/M
3300005186|Ga0066676_11180805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300005187|Ga0066675_11201123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300005332|Ga0066388_100767750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1561Open in IMG/M
3300005332|Ga0066388_103704839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium780Open in IMG/M
3300005332|Ga0066388_106927055All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300005332|Ga0066388_107810438All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005345|Ga0070692_10743380All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium664Open in IMG/M
3300005445|Ga0070708_100512021All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300005450|Ga0066682_10099041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1829Open in IMG/M
3300005467|Ga0070706_100399751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1279Open in IMG/M
3300005467|Ga0070706_100785307All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium882Open in IMG/M
3300005468|Ga0070707_100065613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3487Open in IMG/M
3300005518|Ga0070699_100077497All Organisms → cellular organisms → Bacteria → Proteobacteria2894Open in IMG/M
3300005518|Ga0070699_101781503All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300005529|Ga0070741_10009392All Organisms → cellular organisms → Bacteria19031Open in IMG/M
3300005533|Ga0070734_10000366All Organisms → cellular organisms → Bacteria102187Open in IMG/M
3300005536|Ga0070697_100765880All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium853Open in IMG/M
3300005540|Ga0066697_10763886All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300005549|Ga0070704_100320144All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300005553|Ga0066695_10138038All Organisms → cellular organisms → Bacteria1513Open in IMG/M
3300005555|Ga0066692_10128424All Organisms → cellular organisms → Bacteria → Proteobacteria1536Open in IMG/M
3300005557|Ga0066704_10304066All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1077Open in IMG/M
3300005557|Ga0066704_10527695All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium773Open in IMG/M
3300005560|Ga0066670_10153399All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300005561|Ga0066699_10356894All Organisms → cellular organisms → Bacteria → Proteobacteria1045Open in IMG/M
3300005566|Ga0066693_10051912All Organisms → cellular organisms → Bacteria → Proteobacteria1372Open in IMG/M
3300005568|Ga0066703_10773656All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300005569|Ga0066705_10157192All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1400Open in IMG/M
3300005569|Ga0066705_10938873All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300005586|Ga0066691_10141807All Organisms → cellular organisms → Bacteria → Proteobacteria1377Open in IMG/M
3300005598|Ga0066706_10168637All Organisms → cellular organisms → Bacteria → Proteobacteria1661Open in IMG/M
3300005713|Ga0066905_100213827All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300005713|Ga0066905_102033303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300005764|Ga0066903_103651210All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300005764|Ga0066903_105455124Not Available671Open in IMG/M
3300006031|Ga0066651_10073279All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1664Open in IMG/M
3300006032|Ga0066696_10059434All Organisms → cellular organisms → Bacteria2177Open in IMG/M
3300006796|Ga0066665_10023660All Organisms → cellular organisms → Bacteria3907Open in IMG/M
3300006871|Ga0075434_100483842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1259Open in IMG/M
3300009012|Ga0066710_100550447All Organisms → cellular organisms → Bacteria1745Open in IMG/M
3300009012|Ga0066710_100969105All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1311Open in IMG/M
3300009090|Ga0099827_10386457All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1195Open in IMG/M
3300009137|Ga0066709_102440436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300009137|Ga0066709_103733379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300009137|Ga0066709_103910548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300009792|Ga0126374_11826229All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300010047|Ga0126382_11952573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300010047|Ga0126382_12520789All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300010048|Ga0126373_11070750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium872Open in IMG/M
3300010303|Ga0134082_10133960All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium996Open in IMG/M
3300010304|Ga0134088_10132223All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1183Open in IMG/M
3300010321|Ga0134067_10285417All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300010323|Ga0134086_10168751All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium806Open in IMG/M
3300010360|Ga0126372_12246454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium595Open in IMG/M
3300010361|Ga0126378_12683871All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300010376|Ga0126381_103624422All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium605Open in IMG/M
3300010397|Ga0134124_10875202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium903Open in IMG/M
3300010398|Ga0126383_11124581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium875Open in IMG/M
3300010398|Ga0126383_11272728All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300010398|Ga0126383_13200714All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300010400|Ga0134122_13415435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300011271|Ga0137393_11037652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium697Open in IMG/M
3300012189|Ga0137388_11390192All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300012203|Ga0137399_10742071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium827Open in IMG/M
3300012211|Ga0137377_10144635All Organisms → cellular organisms → Bacteria → Proteobacteria2275Open in IMG/M
3300012285|Ga0137370_11051071All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300012359|Ga0137385_10312729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1350Open in IMG/M
3300012390|Ga0134054_1077731All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium656Open in IMG/M
3300012398|Ga0134051_1243938All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium613Open in IMG/M
3300012582|Ga0137358_11060272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300012929|Ga0137404_10457748All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1133Open in IMG/M
3300012976|Ga0134076_10396035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300014154|Ga0134075_10263607All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium746Open in IMG/M
3300014157|Ga0134078_10312672All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium679Open in IMG/M
3300015241|Ga0137418_10275300All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1417Open in IMG/M
3300015245|Ga0137409_11374431All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300015357|Ga0134072_10395033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300015358|Ga0134089_10517366All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300015371|Ga0132258_10186242All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium5022Open in IMG/M
3300015374|Ga0132255_103266222Not Available691Open in IMG/M
3300016445|Ga0182038_10131880All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1876Open in IMG/M
3300017659|Ga0134083_10046483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1624Open in IMG/M
3300017659|Ga0134083_10059271All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1455Open in IMG/M
3300017659|Ga0134083_10259747All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300018058|Ga0187766_10047176All Organisms → cellular organisms → Bacteria2525Open in IMG/M
3300018060|Ga0187765_10160926All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1273Open in IMG/M
3300018431|Ga0066655_10017820All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3250Open in IMG/M
3300018431|Ga0066655_11282742All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300018468|Ga0066662_10806558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium911Open in IMG/M
3300018482|Ga0066669_10371323Not Available1198Open in IMG/M
3300018482|Ga0066669_10413035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1147Open in IMG/M
3300020583|Ga0210401_11537897All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300021478|Ga0210402_11009826All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300025823|Ga0210123_1206903Not Available565Open in IMG/M
3300025922|Ga0207646_11102950All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium698Open in IMG/M
3300025922|Ga0207646_11422261All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300026075|Ga0207708_11107550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium690Open in IMG/M
3300026307|Ga0209469_1074840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1023Open in IMG/M
3300026307|Ga0209469_1153006All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300026315|Ga0209686_1002953All Organisms → cellular organisms → Bacteria7876Open in IMG/M
3300026324|Ga0209470_1026131All Organisms → cellular organisms → Bacteria3063Open in IMG/M
3300026324|Ga0209470_1264094All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium679Open in IMG/M
3300026326|Ga0209801_1117981All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1139Open in IMG/M
3300026326|Ga0209801_1336178All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300026327|Ga0209266_1263410All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300026331|Ga0209267_1003515All Organisms → cellular organisms → Bacteria9743Open in IMG/M
3300026332|Ga0209803_1175399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium810Open in IMG/M
3300026334|Ga0209377_1138094All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium947Open in IMG/M
3300026523|Ga0209808_1168559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium805Open in IMG/M
3300026529|Ga0209806_1176120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium784Open in IMG/M
3300026540|Ga0209376_1375897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300026547|Ga0209156_10221633All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium893Open in IMG/M
3300026548|Ga0209161_10050201All Organisms → cellular organisms → Bacteria2732Open in IMG/M
3300026550|Ga0209474_10406834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium707Open in IMG/M
3300027748|Ga0209689_1200324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium875Open in IMG/M
3300027826|Ga0209060_10000361All Organisms → cellular organisms → Bacteria90938Open in IMG/M
(restricted) 3300028043|Ga0233417_10305562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium719Open in IMG/M
3300031563|Ga0307436_1130106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria703Open in IMG/M
3300031713|Ga0318496_10406162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium753Open in IMG/M
3300031720|Ga0307469_10356234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1231Open in IMG/M
3300031748|Ga0318492_10032795All Organisms → cellular organisms → Bacteria2343Open in IMG/M
3300031770|Ga0318521_10971223All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300031823|Ga0307478_10917540All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium733Open in IMG/M
3300031890|Ga0306925_10091159All Organisms → cellular organisms → Bacteria3236Open in IMG/M
3300031947|Ga0310909_10527105All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300032041|Ga0318549_10376612All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300032144|Ga0315910_10062828All Organisms → cellular organisms → Bacteria2701Open in IMG/M
3300032144|Ga0315910_10814817Not Available726Open in IMG/M
3300032174|Ga0307470_11758474Not Available524Open in IMG/M
3300032180|Ga0307471_100080579All Organisms → cellular organisms → Bacteria2862Open in IMG/M
3300032180|Ga0307471_101067286All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium974Open in IMG/M
3300032180|Ga0307471_104076730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300032205|Ga0307472_101883267All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300033289|Ga0310914_10196754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1799Open in IMG/M
3300033481|Ga0316600_11355623Not Available506Open in IMG/M
3300033502|Ga0326731_1056610All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium916Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil26.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil9.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil8.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.33%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.67%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.33%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.67%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.67%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.67%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.67%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025823Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300031563Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033502Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI25383J37093_1014583413300002560Grasslands SoilAMWKVQMGRMREEFVRRGMPWLAPDEERALLDYLAAHAGSS*
JGI25382J43887_1039260923300002908Grasslands SoilGCHGLNAPGSMTFPMWQVQLERMRGLFAQRGLPWLDAREERALLDYLAAHAGTS*
Ga0055435_1025794713300003994Natural And Restored WetlandsCHRLYAPGAMTSAMWDLQLGRMRGLYAQRGIPWLPPAEEQALRDYLARHAGTQ*
Ga0062590_10084713623300004157SoilGGCHRLYAPSSMTIAMWDLQLGRMRGLFAQRGIPWLSPAEEQALRDYLAAHAGTQ*
Ga0062592_10043248733300004480SoilHRLYAPSSMTIAMWDLQLGRMRGLFAQRGIPWLSPAEEQALRDYLAAHAGTQ*
Ga0066674_1000919123300005166SoilMTWPMWQVQVDRMRALFAQRGLPWLSADEERELRAYLAAHAGTS*
Ga0066672_1039160823300005167SoilMTWPMWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAGTS*
Ga0066677_1000438253300005171SoilMTFPMWQAQIERMHGLFAQRGLPWLSAHEERELLDYLAAHAGTS*
Ga0066677_1029972523300005171SoilMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS*
Ga0066690_1009614723300005177SoilVVFRARCAGCHRLSAPASMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS*
Ga0066676_1118080523300005186SoilMTSEMWQVQIARMRSLFAQRSVRWLTPAEERVVLDYLVAHAGTS*
Ga0066675_1120112313300005187SoilMWKVQTGRMREEFARRGMPWLTPDEEHALLDYLAAHAGRS*
Ga0066388_10076775023300005332Tropical Forest SoilMTADMWRYQVDRMRALFAQRGLSWLPPGDERALLDYLTAHAGTS*
Ga0066388_10370483913300005332Tropical Forest SoilMTLEMWKVQIARMHLEFNRRGVPWLTSAEEQALMTYLAAHAGTS*
Ga0066388_10692705513300005332Tropical Forest SoilMTIAMWKMQLERMKALFADRGIPWLSPGDERALLDYLAAHAGTS*
Ga0066388_10781043813300005332Tropical Forest SoilMTAEMWRFQVGRMRGLFAERGIPWLAPGDERALLDYLTAHAGSS*
Ga0070692_1074338023300005345Corn, Switchgrass And Miscanthus RhizosphereMTLEMWRFQVDRMREQFARRGLPWLTAEEQSALMDYLAAHAGKS*
Ga0070708_10051202113300005445Corn, Switchgrass And Miscanthus RhizosphereMTAEMWTLQVARMRGEFARRGLPWLGTAEEQALLDYLAAHAGTS*
Ga0066682_1009904133300005450SoilLNAPGSMTFPMWQVQIERMHGLFAQRGLPWLSAHEERELLDYLAAHAGTS*
Ga0070706_10039975133300005467Corn, Switchgrass And Miscanthus RhizosphereMWEVQIARMRDLFAQRGVPWLTPAEERALRDYLAAHAGSS*
Ga0070706_10078530723300005467Corn, Switchgrass And Miscanthus RhizosphereGSMTLAMWQVQLGRMREEFARRGMPWLAPDEERALLEYLASHAGTS*
Ga0070707_10006561313300005468Corn, Switchgrass And Miscanthus RhizosphereLYAPGSMTLAMWQVQLGRMHEEFARRGVPWLAPDEERALLDYLGVHAGTS*
Ga0070699_10007749743300005518Corn, Switchgrass And Miscanthus RhizosphereMTAEMWTLQVARMRGEFARRGLPWLGTDEERALLDYLAAHAGTT*
Ga0070699_10178150313300005518Corn, Switchgrass And Miscanthus RhizosphereSMTLAMWQVQLGRMREEFARRGMPWLAPDEERALLEYLASHAGTS*
Ga0070741_1000939283300005529Surface SoilMTLEMWKVQIARMHEEFARRGVPWLAADEEAALLDYLTAHAGTS*
Ga0070734_100003661073300005533Surface SoilMTAAMWRLQVARMRAPFAQRGLPWLTPAEEQALLDYLTAHAGTR*
Ga0070697_10076588013300005536Corn, Switchgrass And Miscanthus RhizosphereVLQQRCASCHRIPAPGSMTYEMWRVQLERMRGLYAQRGLPWLTATEEDALRAYLQVHAGES*
Ga0066697_1076388623300005540SoilMTSEMWQVQIARMRSLFAQRSVPWLTPAEERVVLDYLVAHAGTS*
Ga0070704_10032014413300005549Corn, Switchgrass And Miscanthus RhizosphereMTLEMWKVQVDRMHAEFVRRGVPWLAPDEERALLDYLGAHAGTG*
Ga0066695_1013803843300005553SoilVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS*
Ga0066692_1012842423300005555SoilVVFRARCAGCHRLSAPASMTWPMWQVQVDRMRALFAQRGLPWLSADEERELRAYLAAHAGTS*
Ga0066704_1030406623300005557SoilGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS*
Ga0066704_1052769523300005557SoilMWKVQTGRMREEFARRGMPWLVPDEERALLDYLAAHAGRS*
Ga0066670_1015339913300005560SoilMTWPMWQVQVDRMRALFAQRGLSWLSADEERETRAYLAAHAGTS*
Ga0066699_1035689423300005561SoilMTFPMWQVQLERMRGLFAQRGLPWLDAREERALLDYLAAHAGRS*
Ga0066693_1005191233300005566SoilTLAMWKVQIGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS*
Ga0066703_1077365613300005568SoilTLAMWKVQIGRMREEFARRGMPWLAPDEERALLDYLAAHAGGS*
Ga0066705_1015719243300005569SoilMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS*
Ga0066705_1093887313300005569SoilYAPGSMTFPMWQAQIERMHGLFAQRRLPWLSAHEERELLDYLAAHAGTS*
Ga0066691_1014180723300005586SoilVVFRARCAGCHRLSAPASMTWPMWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAGTS*
Ga0066706_1016863733300005598SoilGSMTLAMWKVQTGRMREEFARRGMPWLTPDEEHALLDYLAAHAGRS*
Ga0066905_10021382723300005713Tropical Forest SoilMTIAMWKMQLERMKALFAERGIPWLSPGDERALLDYLAAHAGTS*
Ga0066905_10203330323300005713Tropical Forest SoilMTAEMWNVQIERMRALFASRGIPWLTRDDEAALRAY
Ga0066903_10365121023300005764Tropical Forest SoilMTIAMWKMQLERMKALFAERGIPWLSPGDERALLDYLTAHAGTS*
Ga0066903_10545512413300005764Tropical Forest SoilQVERMRALFAQRGIPWLAPGDERVLLDYLTAHAGGS*
Ga0066651_1007327933300006031SoilMWQVQVERMRALIAQRGLPWLSADEERELRAYLAAHAGTS*
Ga0066696_1005943423300006032SoilVVFRARCAGCHRLSAPASMTWPMWQVQVERMRALFAQRGLPWLSADEERELREYLAAHAGTS*
Ga0066665_1002366013300006796SoilPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS*
Ga0075433_1021574713300006852Populus RhizosphereMTADMWKFQVARMQGLFAQRGIPPLTTDEERLLMEYLTAHAGTS
Ga0075425_10015614033300006854Populus RhizosphereMTADMWKFQVARMQGLFAQRGIPPLTADEERMLMEYLTAHAGTS*
Ga0075434_10048384233300006871Populus RhizosphereMTADMWKVQVARMQGLFAQRGIPRLTADEERELMEYLAAHAGT
Ga0075424_10010824153300006904Populus RhizosphereMTADMWKFQVARMQGLFAQRGIPPLTTDEERLLMEYLTAHAGTS*
Ga0066710_10055044713300009012Grasslands SoilRLYAPGSMTLAMWKVQTGRMREEFARRGMPWLTPDEERALLDYLAAHAGRS
Ga0066710_10096910533300009012Grasslands SoilMTLAMWKLQLDRMRALFARRGMPWLTPEEERALQDYLAAHAGTT
Ga0099827_1038645723300009090Vadose Zone SoilMTWPMWQVQVDRMRALFAQRALPWLSADEERDLRAYLAAHAGTS*
Ga0066709_10244043623300009137Grasslands SoilEMWNLQVARMRALFARRGIPWLTPEEERALQDYLVAHAGTA*
Ga0066709_10373337923300009137Grasslands SoilMTLAMWKLQLDRMRALFARRGIPWITPEEERALQDYLAAHA
Ga0066709_10391054813300009137Grasslands SoilDRMRALFARRGMPWLTPEEERALQDYLAAHAGTT*
Ga0126374_1182622913300009792Tropical Forest SoilHRVYAPGSMTAEMWRFQVGRMRGLFAERGIPWLAPGDERALLDYLVAHAGSS*
Ga0131092_1055597323300009870Activated SludgeMTAEMWAFQVPRMQERFRQRGMPWLTADEQRQLLEYLTAHAGSG*
Ga0126382_1195257313300010047Tropical Forest SoilEQVARMQALFAQRGIPALPPDEERVLLEYLTAHAGTS*
Ga0126382_1252078923300010047Tropical Forest SoilMTAEMWNVQIERMRALFASRGIPWLTPDDEAALRAYVRDHAGTV*
Ga0126373_1107075023300010048Tropical Forest SoilMTAEMWRFQVGRMRGLFAERGIPWLAPGDERALLDYLVAHAGSS*
Ga0134082_1013396023300010303Grasslands SoilMWQVQVERMRALFAQRGLPWLSADEERDLRAYLAAHAGTS*
Ga0134088_1013222313300010304Grasslands SoilGCHRLYAPGSMTFPMWQVQIERMHGLFAQRRLPWLSAHEERELLDYLAAHAGTS*
Ga0134067_1028541723300010321Grasslands SoilMTFPMWQAQIERMHGLFAQRRLPWLSAHEERELLDYLAAHAGTS*
Ga0134086_1016875113300010323Grasslands SoilAPGSMTLAMWKVQIGRMREEFARRGMPWLVPDEERALLDYLAAHAGRS*
Ga0126372_1224645413300010360Tropical Forest SoilMTIAMWQFQVERMRGEFAKRGMPWLTTREESALLEYLAAHAGKG*
Ga0126378_1268387123300010361Tropical Forest SoilKVQLDRMRGLFAKRGIPWLSPDDEHALLDYLQAHAGTS*
Ga0126381_10362442223300010376Tropical Forest SoilMTVATWRFQVGRMRELFAQRGLPWLTAEEERQLLDYLAAHAGTS*
Ga0134124_1087520223300010397Terrestrial SoilDRMHAEFVRRGVPWLAPDEERALLDYLGAHAGTG*
Ga0126383_1112458123300010398Tropical Forest SoilMTAEMWNVQLERMRALFASRGLPWLAPDDEAALRAYLREHAGTV*
Ga0126383_1127272813300010398Tropical Forest SoilMTAEMWRFQVGRMRALFADRGLPWLAAGDERALLEYLTAHAGTS*
Ga0126383_1320071423300010398Tropical Forest SoilQLERMKALFAERGIPWLSPGDERALLEYLAAHAGTS*
Ga0134122_1341543513300010400Terrestrial SoilPATMTLEMWRFQVDRMREQFARRGLPWLTAEEQSALMDYLAAHAGTS*
Ga0137393_1103765213300011271Vadose Zone SoilLYAPGSMTLAMWQVQLGRMHEEFARRGMPWLAPDEERALLDYLGAHAGTS*
Ga0137388_1139019223300012189Vadose Zone SoilMTWPMWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAG
Ga0137399_1074207113300012203Vadose Zone SoilMWELQLGRMRELFARRGIPWLTSEEERALLDYLRAHAGTS*
Ga0137377_1014463543300012211Vadose Zone SoilPDSMTLAMWKVQIGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS*
Ga0137370_1105107113300012285Vadose Zone SoilIGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS*
Ga0137385_1031272933300012359Vadose Zone SoilHQLYAPGSMTLAMWKVQIGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS*
Ga0134054_107773113300012390Grasslands SoilGSMTAEMWNVQVAKMHEEFARRGMPWLEKDEEQALLQYLHDHAGQS*
Ga0134051_124393823300012398Grasslands SoilKVQTGRMREEFARRGMPWLVPDEERALLDYLVAHAGRS*
Ga0137358_1106027223300012582Vadose Zone SoilEMWKVQTGRMREEFTRRGMPWLVPDEERALLDYLAAHAGRS*
Ga0137404_1045774823300012929Vadose Zone SoilMTAEMWQVQIARMRGLFAQRGIPWLTPAEERILLDYLAAHAGTS*
Ga0134076_1039603513300012976Grasslands SoilEMWKVQTGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS*
Ga0134075_1026360723300014154Grasslands SoilMTWPMWQVQVERMRALFAQRGLPWLSADEERDLRAYLAAHAGTS*
Ga0134078_1031267223300014157Grasslands SoilMTFPMWQVQLERMRGLFAQRGLPWLDAREERALLDYLAAHAGTS*
Ga0137418_1027530013300015241Vadose Zone SoilMWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAGTS*
Ga0137409_1137443123300015245Vadose Zone SoilWKVQIGRMREEFARRGMPWLVPDEERALLDYLAAHAGRS*
Ga0134072_1039503323300015357Grasslands SoilPASMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS*
Ga0134089_1051736623300015358Grasslands SoilLYAPGSMTLAMWKVQIGRMREEFARRGMPWLVPDEERALLDYLAAHAGRS*
Ga0132258_1018624253300015371Arabidopsis RhizosphereMTPDMWRYQVDRMRTLFAQRGIPWLAPDEERALLDYVTSHAGAS*
Ga0132255_10326622223300015374Arabidopsis RhizosphereYQVDRMRGLFAQRGIPWLAPGDERALLDYVTSHAGSS*
Ga0182038_1013188013300016445SoilQLGRMRGLYAQRGIPWLSSDDEHALLDYLQAHAGTS
Ga0134083_1004648313300017659Grasslands SoilKVQIGRMREEFARRGMPWLAADEERALLDYLAAHAGRS
Ga0134083_1005927113300017659Grasslands SoilAPGSMTFPMWQAQIERMHGLFAQRRLPWLSAHEERELLDYLAAHAGTS
Ga0134083_1025974723300017659Grasslands SoilMTFPMWQVQVERMHGLFAQRGLPWLSAHEERELLDYLASHALAS
Ga0187766_1004717633300018058Tropical PeatlandMTFEMWKLQVARMQGEFSRRGLPWLTPAEEHALLDYLAAHAGTS
Ga0187765_1016092623300018060Tropical PeatlandMTIAMWEVQLERMRDVFARRGIPWLMPAEEQALREYLAAHAGGS
Ga0066655_1001782033300018431Grasslands SoilMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS
Ga0066655_1128274223300018431Grasslands SoilMWKVQIGRMREEFARRGMPWLAPDEERALLDYLAAHAGRS
Ga0066662_1080655813300018468Grasslands SoilMKWPMWKVQVERMRALCAQRGIPWLSADEERELRAYLAAHAGTS
Ga0066669_1037132343300018482Grasslands SoilGCHRLYAPASMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS
Ga0066669_1041303523300018482Grasslands SoilMTSEMWKVQVGRMRELFARRGVPWLAPDEERALLEYLATHAGAS
Ga0210401_1153789723300020583SoilGGCHRVDAPGSMTFEMWKVQLAQMRVLFAKRGIPWLSSDDEQALLDYLQAHAGTS
Ga0210402_1100982613300021478SoilGGCHRVDAPGSMTFEMWKVQLAQMRVLFAKRGIPWLSSDDEHALLDYLQAHAGTS
Ga0210123_120690313300025823Natural And Restored WetlandsVHAPGTMTFEMWKMQLTRMRVLFAQRGIPWLTDVEEQALLRYLERHAGTQ
Ga0207646_1110295023300025922Corn, Switchgrass And Miscanthus RhizosphereMTLEMWRLQIGRMHELFARREIPWLAPDEERALLDYLGAHAGTG
Ga0207646_1142226123300025922Corn, Switchgrass And Miscanthus RhizosphereMTAEMWTLQVARMRGEFARRGLPWLGTAEEQALLDYLAAHAGTS
Ga0207708_1110755023300026075Corn, Switchgrass And Miscanthus RhizosphereSMTLETWRFQVDRMREQFARRGLPWLTAEEQSALMDYLAAHAGKS
Ga0209469_107484023300026307SoilMTWPMWQVQVDRMRALFAQRGLPWLSADEERELRAYLAAHAGTS
Ga0209469_115300613300026307SoilPGSMTLAMWKVQIGRMREEFARRGMPWLVPDEERALLDYLAAHAGRS
Ga0209686_100295353300026315SoilMTFPMWQAQIERMHGLFAQRGLPWLSAHEERELLDYLAAHAGTS
Ga0209470_102613153300026324SoilSMTLEMWKVQTGRMREEFARRGMPWLVPDEERALLDYLVAHAGRS
Ga0209470_126409413300026324SoilVFRARCAGCHRLSAPASMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGT
Ga0209801_111798133300026326SoilMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS
Ga0209801_133617823300026326SoilHRLYAPDSMTLAMWKVQIGRMREEFTRRGMPWLAPDEERTLLDYLAAHAGRS
Ga0209266_126341023300026327SoilSMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS
Ga0209267_100351583300026331SoilMTFPMWQAQIERMHGLFAQRRLPWLSAHEERELLDYLAAHAGTS
Ga0209803_117539923300026332SoilPMWQVQIERMHGLFAQRGLPWLSAHEERELLDYLAAHAGTS
Ga0209377_113809423300026334SoilRLYAPGSMTLAMWKVQIGRMREEFARRGMPWLAPDEERALLDYLGAHAGRS
Ga0209808_116855923300026523SoilTLEMWKVQTGRMREEFARRGMPWLVPDEERALLDYLVAHAGRS
Ga0209806_117612033300026529SoilSMTLAMWKVQIGRMREEFTRRGMPWLAPDEERTLLDYLAAHAGRS
Ga0209376_137589713300026540SoilAPASMTWPMWQVQVERMRALFAQRGLPWLSADEERELRAYLAAHAGTS
Ga0209156_1022163323300026547SoilMTWPMWQVQVERMRALFAQRGLPWLSADEERELREYLAAHAGTS
Ga0209161_1005020113300026548SoilGSMTLAMWKVQTGRMREEFARRGMPWLTPDEEHALLDYLAAHAGRS
Ga0209474_1040683413300026550SoilVFRARCAGCRRLYAPASMTWPMWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAGT
Ga0209689_120032423300027748SoilMTWPMWQVQVDRMRALFAQRGLPWLSADEERDLRAYLAAHAGTS
Ga0209060_1000036123300027826Surface SoilMTAAMWRLQVARMRAPFAQRGLPWLTPAEEQALLDYLTAHAGTR
(restricted) Ga0233417_1030556213300028043SedimentTMTLAMWDVQLGRMRGLYAQRGIPWLSPDEEQALRDYLAKHAGTQ
Ga0307436_113010613300031563Salt MarshAPGSMTFAMWQVQLDRMRRLYAQRGIPWLRPDEERALLAYLRAHAGTQ
Ga0318496_1040616213300031713SoilMTFEMWKAQLARMRGLYARRGIPWLSSDDERALLDYLQ
Ga0307469_1035623423300031720Hardwood Forest SoilMWKFQVSRMHDLFAHRGLPWLTPDEERALLDYLAAHAGTS
Ga0318492_1003279533300031748SoilAPESMTFEMWKAQLGRMRGLYAQRGIPWLSSDDEHALLDYLQAHAGTS
Ga0318521_1097122313300031770SoilMWKAQLVNMRVLFAKRGIPWLSSDDEHALLDYLQAHAGTS
Ga0307478_1091754013300031823Hardwood Forest SoilMTIETWRFQLGRMRELFAQRGIPWLTPEEEHALTDYLAAHAG
Ga0306925_1009115933300031890SoilPGSMTFEMWKAQLGRMRGLYAQRGIPWLSSDDERALLDYLQAHAGTS
Ga0310909_1052710523300031947SoilEMWKAQLVNMRVLFAKRGIPWLSSDDEHALLDYLQAHAGTS
Ga0318549_1037661223300032041SoilYAPGSMTFEMWKVQLVNMRVLFAKRGIPWLSSDDEHALLDYLQAHASTS
Ga0315910_1006282813300032144SoilMTLAMWDVQLARMHALFQQRGIPWLSPPEEQALRDYLA
Ga0315910_1081481723300032144SoilHRLYTPSSMTLAMWDVQLARMHALFQQRGIPWLSPPEEQALRDYLAKYAGTQ
Ga0307470_1175847423300032174Hardwood Forest SoilMWKVQIARMHVEFTRRGMPWLTSAEEQALMTYLVAHAGTS
Ga0307471_10008057943300032180Hardwood Forest SoilMTLAMWKVQIERMRPLFAQRGMPWLAPDEERALLDYLAAHAGAS
Ga0307471_10106728623300032180Hardwood Forest SoilMWQVQVDRMRAMFGQRGLPWLSADEDRELREYLASHAGTS
Ga0307471_10407673013300032180Hardwood Forest SoilDAPGAVVLRTRCAGCHGLNAPGSMTFPMWQVQLERMRGLFAQRGLPWLDAREERALLDYLAAHAGRS
Ga0307472_10188326723300032205Hardwood Forest SoilMTFPMWQVQLERMRGLFARRGLPWLDARDERALLDYLAAHAGTS
Ga0310914_1019675413300033289SoilRVYGPGSMTFEMWKAQLGRMRGLYAQRGIPWLSSDDEHALLDYLQAHAGTS
Ga0316600_1135562313300033481SoilAMWEMQLGRMRSLFAQRGIPWLPPAEERTLRDYLAKHAGTQ
Ga0326731_105661023300033502Peat SoilMTLEMWKMQLGRMQALFAERGIPWLSPGDERALLDYLTAHAGTS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.