NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F046868

Metagenome Family F046868

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046868
Family Type Metagenome
Number of Sequences 150
Average Sequence Length 41 residues
Representative Sequence LVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAR
Number of Associated Samples 89
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.68 %
% of genes near scaffold ends (potentially truncated) 97.33 %
% of genes from short scaffolds (< 2000 bps) 82.00 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(62.000 % of family members)
Environment Ontology (ENVO) Unclassified
(77.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(62.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.88%    β-sheet: 14.71%    Coil/Unstructured: 79.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF13271DUF4062 14.00
PF05977MFS_3 10.00
PF00248Aldo_ket_red 4.00
PF13411MerR_1 4.00
PF13302Acetyltransf_3 3.33
PF07690MFS_1 2.67
PF08543Phos_pyr_kin 2.67
PF00415RCC1 2.00
PF13649Methyltransf_25 2.00
PF03109ABC1 2.00
PF03466LysR_substrate 2.00
PF01243Putative_PNPOx 1.33
PF13401AAA_22 1.33
PF00877NLPC_P60 1.33
PF01381HTH_3 1.33
PF03706LPG_synthase_TM 1.33
PF13936HTH_38 1.33
PF05960DUF885 1.33
PF02627CMD 0.67
PF00196GerE 0.67
PF00486Trans_reg_C 0.67
PF00111Fer2 0.67
PF00355Rieske 0.67
PF05988DUF899 0.67
PF13358DDE_3 0.67
PF02332Phenol_Hydrox 0.67
PF10935DUF2637 0.67
PF12697Abhydrolase_6 0.67
PF01425Amidase 0.67
PF03625DUF302 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 10.00
COG5184Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteinsCell cycle control, cell division, chromosome partitioning [D] 4.00
COG0351Hydroxymethylpyrimidine/phosphomethylpyrimidine kinaseCoenzyme transport and metabolism [H] 2.67
COG0524Sugar or nucleoside kinase, ribokinase familyCarbohydrate transport and metabolism [G] 2.67
COG2240Pyridoxal/pyridoxine/pyridoxamine kinaseCoenzyme transport and metabolism [H] 2.67
COG2870ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferaseCell wall/membrane/envelope biogenesis [M] 2.67
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 2.00
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 1.33
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 1.33
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 1.33
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.67
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.67
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.67
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 0.67
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.67 %
UnclassifiedrootN/A23.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005332|Ga0066388_100885893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1473Open in IMG/M
3300005436|Ga0070713_100105597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2447Open in IMG/M
3300005764|Ga0066903_100105909All Organisms → cellular organisms → Bacteria3826Open in IMG/M
3300005764|Ga0066903_104344902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300005764|Ga0066903_105065772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia698Open in IMG/M
3300005764|Ga0066903_106796735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia594Open in IMG/M
3300006914|Ga0075436_101120589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300009792|Ga0126374_10828811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium710Open in IMG/M
3300010046|Ga0126384_11699334Not Available597Open in IMG/M
3300010048|Ga0126373_10713068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1062Open in IMG/M
3300010048|Ga0126373_11590497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia718Open in IMG/M
3300010048|Ga0126373_12340891All Organisms → cellular organisms → Bacteria → Terrabacteria group594Open in IMG/M
3300010048|Ga0126373_12890277All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300010358|Ga0126370_10650170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii918Open in IMG/M
3300010359|Ga0126376_12718086Not Available544Open in IMG/M
3300010360|Ga0126372_10587288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1066Open in IMG/M
3300010360|Ga0126372_11096124Not Available814Open in IMG/M
3300010360|Ga0126372_11221597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria777Open in IMG/M
3300010360|Ga0126372_12581935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300010361|Ga0126378_10798299Not Available1053Open in IMG/M
3300010361|Ga0126378_12234975Not Available624Open in IMG/M
3300010361|Ga0126378_13112954All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300010362|Ga0126377_11919843Not Available668Open in IMG/M
3300010366|Ga0126379_11793193All Organisms → cellular organisms → Bacteria → Terrabacteria group718Open in IMG/M
3300010376|Ga0126381_100048070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5207Open in IMG/M
3300010376|Ga0126381_102243928Not Available785Open in IMG/M
3300012948|Ga0126375_10932843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300012971|Ga0126369_12007360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi666Open in IMG/M
3300012971|Ga0126369_12094275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria653Open in IMG/M
3300016270|Ga0182036_11546692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis558Open in IMG/M
3300016294|Ga0182041_10328996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1277Open in IMG/M
3300016319|Ga0182033_10501022All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300016341|Ga0182035_11028583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-64-8731Open in IMG/M
3300016341|Ga0182035_11422652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia623Open in IMG/M
3300016387|Ga0182040_10786747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii783Open in IMG/M
3300016422|Ga0182039_10342310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1253Open in IMG/M
3300017924|Ga0187820_1036676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1290Open in IMG/M
3300017974|Ga0187777_11202059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300021560|Ga0126371_12258745Not Available657Open in IMG/M
3300021560|Ga0126371_13328802Not Available543Open in IMG/M
3300027497|Ga0208199_1010332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella2190Open in IMG/M
3300031543|Ga0318516_10741003All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300031546|Ga0318538_10187260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1103Open in IMG/M
3300031546|Ga0318538_10391614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae751Open in IMG/M
3300031546|Ga0318538_10592542Not Available601Open in IMG/M
3300031549|Ga0318571_10172046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis760Open in IMG/M
3300031549|Ga0318571_10181504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia743Open in IMG/M
3300031572|Ga0318515_10338482Not Available807Open in IMG/M
3300031573|Ga0310915_10053155All Organisms → cellular organisms → Bacteria2623Open in IMG/M
3300031573|Ga0310915_10807613All Organisms → cellular organisms → Bacteria → Terrabacteria group660Open in IMG/M
3300031668|Ga0318542_10098211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-71410Open in IMG/M
3300031668|Ga0318542_10119182Not Available1289Open in IMG/M
3300031679|Ga0318561_10281916All Organisms → cellular organisms → Bacteria → Terrabacteria group908Open in IMG/M
3300031680|Ga0318574_10580702All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300031682|Ga0318560_10097091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1521Open in IMG/M
3300031682|Ga0318560_10586076Not Available604Open in IMG/M
3300031713|Ga0318496_10078406All Organisms → cellular organisms → Bacteria1749Open in IMG/M
3300031719|Ga0306917_10342290All Organisms → cellular organisms → Bacteria → Terrabacteria group1161Open in IMG/M
3300031723|Ga0318493_10156516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1182Open in IMG/M
3300031723|Ga0318493_10270901Not Available911Open in IMG/M
3300031723|Ga0318493_10648684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii590Open in IMG/M
3300031736|Ga0318501_10191123All Organisms → cellular organisms → Bacteria → Terrabacteria group1068Open in IMG/M
3300031736|Ga0318501_10586375All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300031748|Ga0318492_10404223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis718Open in IMG/M
3300031748|Ga0318492_10406296All Organisms → cellular organisms → Bacteria → Terrabacteria group716Open in IMG/M
3300031748|Ga0318492_10760274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300031751|Ga0318494_10036488All Organisms → cellular organisms → Bacteria2544Open in IMG/M
3300031751|Ga0318494_10908482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae516Open in IMG/M
3300031764|Ga0318535_10029963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2171Open in IMG/M
3300031765|Ga0318554_10004419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6486Open in IMG/M
3300031765|Ga0318554_10268656All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300031765|Ga0318554_10618787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300031765|Ga0318554_10656470Not Available590Open in IMG/M
3300031770|Ga0318521_10252550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1029Open in IMG/M
3300031770|Ga0318521_10707043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300031771|Ga0318546_10047316All Organisms → cellular organisms → Bacteria2659Open in IMG/M
3300031777|Ga0318543_10547445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis519Open in IMG/M
3300031778|Ga0318498_10446086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis573Open in IMG/M
3300031779|Ga0318566_10002470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6336Open in IMG/M
3300031779|Ga0318566_10027061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2599Open in IMG/M
3300031795|Ga0318557_10272919All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300031798|Ga0318523_10033521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2342Open in IMG/M
3300031798|Ga0318523_10210411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae972Open in IMG/M
3300031799|Ga0318565_10015810All Organisms → cellular organisms → Bacteria3232Open in IMG/M
3300031805|Ga0318497_10122289All Organisms → cellular organisms → Bacteria → Terrabacteria group1410Open in IMG/M
3300031805|Ga0318497_10365811All Organisms → cellular organisms → Bacteria → Terrabacteria group806Open in IMG/M
3300031821|Ga0318567_10056050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2049Open in IMG/M
3300031821|Ga0318567_10244112All Organisms → cellular organisms → Bacteria → Terrabacteria group1008Open in IMG/M
3300031831|Ga0318564_10002564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6368Open in IMG/M
3300031880|Ga0318544_10311104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis611Open in IMG/M
3300031890|Ga0306925_10024245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6111Open in IMG/M
3300031890|Ga0306925_10346999All Organisms → cellular organisms → Bacteria1594Open in IMG/M
3300031890|Ga0306925_10562317All Organisms → cellular organisms → Bacteria → Terrabacteria group1208Open in IMG/M
3300031890|Ga0306925_11889669Not Available568Open in IMG/M
3300031890|Ga0306925_12062442Not Available536Open in IMG/M
3300031890|Ga0306925_12279567Not Available501Open in IMG/M
3300031896|Ga0318551_10036924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2403Open in IMG/M
3300031912|Ga0306921_10221713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2216Open in IMG/M
3300031912|Ga0306921_11247028Not Available825Open in IMG/M
3300031912|Ga0306921_11491622Not Available739Open in IMG/M
3300031941|Ga0310912_11309157Not Available549Open in IMG/M
3300031942|Ga0310916_11407261All Organisms → cellular organisms → Bacteria → Terrabacteria group571Open in IMG/M
3300031942|Ga0310916_11416500Not Available569Open in IMG/M
3300031946|Ga0310910_10640780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia842Open in IMG/M
3300031947|Ga0310909_10316479All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300031954|Ga0306926_12166255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300031981|Ga0318531_10507726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis546Open in IMG/M
3300032009|Ga0318563_10771212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis515Open in IMG/M
3300032010|Ga0318569_10372753All Organisms → cellular organisms → Bacteria → Terrabacteria group665Open in IMG/M
3300032035|Ga0310911_10534839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis680Open in IMG/M
3300032039|Ga0318559_10518527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300032041|Ga0318549_10243524All Organisms → cellular organisms → Bacteria → Terrabacteria group809Open in IMG/M
3300032042|Ga0318545_10134198All Organisms → cellular organisms → Bacteria → Terrabacteria group877Open in IMG/M
3300032042|Ga0318545_10201577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii712Open in IMG/M
3300032043|Ga0318556_10077597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1653Open in IMG/M
3300032043|Ga0318556_10605783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → Microbispora bryophytorum571Open in IMG/M
3300032044|Ga0318558_10016540All Organisms → cellular organisms → Bacteria2904Open in IMG/M
3300032044|Ga0318558_10075378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1542Open in IMG/M
3300032052|Ga0318506_10258063All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300032054|Ga0318570_10031690Not Available2101Open in IMG/M
3300032060|Ga0318505_10186021All Organisms → cellular organisms → Bacteria → Terrabacteria group970Open in IMG/M
3300032060|Ga0318505_10189898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia960Open in IMG/M
3300032063|Ga0318504_10019202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2560Open in IMG/M
3300032064|Ga0318510_10185996Not Available834Open in IMG/M
3300032064|Ga0318510_10227209Not Available761Open in IMG/M
3300032065|Ga0318513_10034657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2200Open in IMG/M
3300032065|Ga0318513_10369563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300032066|Ga0318514_10210882Not Available1018Open in IMG/M
3300032067|Ga0318524_10094582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1475Open in IMG/M
3300032068|Ga0318553_10034308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium2447Open in IMG/M
3300032068|Ga0318553_10190445All Organisms → cellular organisms → Bacteria → Terrabacteria group1069Open in IMG/M
3300032068|Ga0318553_10295213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii847Open in IMG/M
3300032068|Ga0318553_10732361Not Available517Open in IMG/M
3300032068|Ga0318553_10780132All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300032076|Ga0306924_10296740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-71855Open in IMG/M
3300032090|Ga0318518_10097122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1466Open in IMG/M
3300032090|Ga0318518_10352655All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300032090|Ga0318518_10514530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis613Open in IMG/M
3300032090|Ga0318518_10667002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300032094|Ga0318540_10177071Not Available1025Open in IMG/M
3300032261|Ga0306920_100160681Not Available3350Open in IMG/M
3300032261|Ga0306920_101493993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → unclassified Geodermatophilus → Geodermatophilus sp. DSM 45219965Open in IMG/M
3300032261|Ga0306920_101508044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium960Open in IMG/M
3300032261|Ga0306920_103059416Not Available630Open in IMG/M
3300033289|Ga0310914_10556379Not Available1036Open in IMG/M
3300033289|Ga0310914_11070404All Organisms → cellular organisms → Bacteria → Terrabacteria group707Open in IMG/M
3300033289|Ga0310914_11232073Not Available650Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil62.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil16.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.67%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066388_10088589323300005332Tropical Forest SoilPGKLADLVAYPLNPLTADLDDLADLTPALTIAGGQATYDPDKRLSP*
Ga0070713_10010559713300005436Corn, Switchgrass And Miscanthus RhizosphereKLADLAAYPLDPLAADPDDLAELTPAFTIVGGRATHDPGKRLVR*
Ga0066903_10010590913300005764Tropical Forest SoilAPGKLADLVAYRVDPLAADPASLPDLTPAFTIVGGRATHDPDGRLAH*
Ga0066903_10434490223300005764Tropical Forest SoilPGKLADLAGYPVDPMTADPDDLAGLIPEFTVVGGRPVHDPDKRLAR*
Ga0066903_10506577213300005764Tropical Forest SoilGYPADPMTADPDDLAGLIPAFTVVGGRPVHDPDKRLAR*
Ga0066903_10679673513300005764Tropical Forest SoilADLAAYPLDPLTAGPDELAKLTPVFTIVGGRPVHDPDKRLV*
Ga0075436_10112058913300006914Populus RhizospherePIDPLKADVDDLAELKPTFTVVGGKPMYDPDQRLSPA*
Ga0126374_1082881123300009792Tropical Forest SoilKLADLVGYAADPLVADPDDLAELTPVFTMVGGRATHDPDKRLAP*
Ga0126384_1169933413300010046Tropical Forest SoilLADLVAYPLDPLTASPDDLAELTPAFTIVGGRPVHDPDKRLAR*
Ga0126373_1071306813300010048Tropical Forest SoilGYPVDPLAADPEDLAELIPAFTIVGGRPTHDPDKRLAR*
Ga0126373_1159049723300010048Tropical Forest SoilADLVAYPLDPLAADPDDLASLTPVFTIVGGRPSYDRDKRLAR*
Ga0126373_1234089123300010048Tropical Forest SoilDLLVADPGDLASLTPVFTIVGGRPSYDRDKRLTR*
Ga0126373_1289027723300010048Tropical Forest SoilLAAAPDDLPELVPAFTMVGGRAIHDPSKRLAPGPARAAW*
Ga0126370_1065017023300010358Tropical Forest SoilSITPGKLADLAGYPLDPLTADPDDLAELTPAFTIMGGRPTHDPDKRLAR*
Ga0126376_1271808613300010359Tropical Forest SoilLVAYSIDPLTASPDDLAGLTPAFTIVGGRPVHDPDKRLVR*
Ga0126372_1058728833300010360Tropical Forest SoilADPLAADPDDLAELTPAFTVVGGRPVHDPDKRLVRRAGNRHH*
Ga0126372_1109612443300010360Tropical Forest SoilLADLVAYPVDPLVADPDGLAELTPVFTMVGGKPVHDPDKRLSL*
Ga0126372_1122159713300010360Tropical Forest SoilLVAYPLDPLAADPDDLPELTPAFTIVGGRATHDPGKRLAR*
Ga0126372_1258193513300010360Tropical Forest SoilKLADLVAYPLDPLAADPDDLPELTPAFTIVGGRATHDPGKRLAR*
Ga0126378_1079829913300010361Tropical Forest SoilADLAGYPADPMTAGPDDLAGLIPAFTVVGGRPAHDPDKRLAR*
Ga0126378_1223497513300010361Tropical Forest SoilSIAPGKLADLVAYPADPMAADMDDLADLMPIFTIVDGEPVHDPGQRLTR*
Ga0126378_1311295413300010361Tropical Forest SoilPLDPLAADPADLHDLKPAFTMVGGNPTHDPNHLLAR*
Ga0126377_1191984313300010362Tropical Forest SoilKLADLVAYPLDPLTASPDDLAELTPAFTIVGGRPVHDPDKRLAR*
Ga0126379_1179319323300010366Tropical Forest SoilVAYPLNPLSADLDDLADLTPALTIAGGQATYDPDKRLSP*
Ga0126381_10004807073300010376Tropical Forest SoilLADLVGYAADPLVADPDDLAELTPVFTMVGGRATHDPDKRLAP*
Ga0126381_10224392843300010376Tropical Forest SoilAYPVDPLAADPDDLAELTPVFTMVGGKPVHDPDKRLSL*
Ga0126375_1093284313300012948Tropical Forest SoilVTPGKLADLVAYPLDPLAADPDDLPELTPAFTIVGGRATHDPGKRLAR*
Ga0126369_1200736023300012971Tropical Forest SoilPGKLADLVAYPLDPLTAGPDDLAKLTPAFTMVGGRPVHDPGGLLDS*
Ga0126369_1209427523300012971Tropical Forest SoilAPGKLADIVAYPADPLTADVDDLPGLTPAFTIVGGRPVHDPGGRLGPRR*
Ga0182036_1154669223300016270SoilLVGYPADPLAVDRDDLAELTPTVTLVGGRATHDPDKRLAGDRARAGE
Ga0182041_1032899633300016294SoilAAYPLDPLTAGPDELAKLTPVFTIVGGKPVHDPDKRLVR
Ga0182033_1050102223300016319SoilDLVGYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0182035_1102858323300016341SoilGKLADLAGYPADPMTADSDDLAGLIPAFTVVGGRPVHDPDKRLAR
Ga0182035_1142265223300016341SoilAYPLDPLVADPGELASLTPVFTIVGGRPSYDRDKRLTR
Ga0182040_1078674723300016387SoilGYTVDPLTADPDDLAGLTPAFTIVGGRPVHDPDKRLAR
Ga0182039_1034231013300016422SoilVDPLAADPDDLAELTPAFTMAGGQVTHDPDKRLAK
Ga0187820_103667623300017924Freshwater SedimentYPIDPLTADVDDLADLRPVFTMVGGRATHDPDKRLAR
Ga0187777_1120205913300017974Tropical PeatlandRLGSITTGKLADLAGYPADPLAADPDDLAELTPAFTIMGGRATHDPDKRLAR
Ga0126371_1225874513300021560Tropical Forest SoilPVDPLTADPDDLAELTPVFTIVGGRATHDPEKRLAP
Ga0126371_1332880213300021560Tropical Forest SoilPADPLTADVDDLPGLTPAFTIVGGRPVHDPGDRLGSPR
Ga0208199_101033213300027497Peatlands SoilAHGKLADLVGYSIDPLAADLYDLADLTPAFTIVGGTGVHDPGRRLGDQVPMAH
Ga0318516_1074100323300031543SoilGRLADLVAYALDPLTANPDDLAKLTPVFTIVGGRPVHDPDKRLVR
Ga0318541_1018918513300031545SoilPFTADIDRLADMTPAFTIVGGRAMFDPDGRLSPRP
Ga0318538_1018726013300031546SoilPVDPLAADPDDLAELTPAFTMVGGRVTHDPDKRLTP
Ga0318538_1039161423300031546SoilGYPADPLAADPDDLAGLTPAFTIVGGRATHDPDQRLAR
Ga0318538_1059254223300031546SoilYLGDPLAADPDDLAELTPAFTSAGGRVTHDADKRPTR
Ga0318571_1017204623300031549SoilKLADLVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAP
Ga0318571_1018150423300031549SoilAGYPADPMTADPDNLADLTPAFTVVGGRPVHDPDKRLAR
Ga0318515_1033848223300031572SoilVAYPLDPLTADPGDLPELTPAFTMMGGRATHDPDKRLAG
Ga0310915_1005315553300031573SoilVGYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0310915_1080761313300031573SoilLTGYPADPMIADLDDLAGLTPEFTVVGGKPVHDPDKRLAR
Ga0318542_1009821123300031668SoilYPLDPLTAAPDGLAELTPAFTIVGGRATHDPDKRLAR
Ga0318542_1011918213300031668SoilLVGYPLDPLSADPDDLAELTPAFTIAGGRATHDPDKRLAR
Ga0318561_1028191613300031679SoilPRDPLAAELDDLADLKPVLTIAGGRATYDPDKRLAR
Ga0318574_1058070213300031680SoilDLVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLARPGVGEQRVGE
Ga0318560_1009709133300031682SoilLDPFTADLDDLPDLKPALTIAGGRATHDPDKRLAR
Ga0318560_1058607623300031682SoilLVGYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0318496_1007840613300031713SoilGYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0306917_1034229023300031719SoilADPLTADVDDLPGLTPAFTIVGGRPVHDPGGRLGPPR
Ga0318493_1015651623300031723SoilAGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAP
Ga0318493_1027090113300031723SoilGKLADLVGYPADPLAADPDDLAELTPAFTIMGGRATHDPDQRLAP
Ga0318493_1064868413300031723SoilMSRVPAEPGKLADLVGYPVDPTAADAAGLADLTPAFTMTGGRVTHDPDQRLAK
Ga0318500_1013045723300031724SoilDPFTADIDRLADMTPAFTIVGGRAMFDPDGRLSPRP
Ga0318501_1019112333300031736SoilVAYRLDPLTADLDELADLKPELTVVGGRATHDPDKRLAR
Ga0318501_1058637513300031736SoilLAADPDDLAELTPAFTIVGGRATHDPDKRLARPGVGEQRVGE
Ga0318492_1040422323300031748SoilLGSIAPGKLADLAGYPADPLTADPDDLAGLTPAFTIVGGRATHDPDKRLARGC
Ga0318492_1040629623300031748SoilIIPGKLADLVAYPLDPLTADLDDLADLTPALTIGGGQATYDPDKRMSP
Ga0318492_1076027423300031748SoilYPADPLAADPDDLAALTPAFTIVGGRATHDPDKRLAR
Ga0318494_1003648813300031751SoilADLVGYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0318494_1090848223300031751SoilVGYPADPLAADPDDLAELTPAFTIVGGRVTHDPDKRLAR
Ga0318535_1002996333300031764SoilVDPMTADPDDLAGLVPEFTVVGGRPVHDPDKRLAR
Ga0318554_1000441953300031765SoilGYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0318554_1026865623300031765SoilADLVGYPADPLAADPDDLAELTPAFTIVGGRVTHDPDKRLAR
Ga0318554_1061878713300031765SoilGKLADLVAYPLDPLTAELDDLADLKPVLTIAGGRATYDPDKRLAR
Ga0318554_1065647023300031765SoilLVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAR
Ga0318521_1025255013300031770SoilLVGYPADPLATDPDDLAEMTPAFTIVGGRATYDPDKRLAP
Ga0318521_1070704313300031770SoilSITPGKLADIVAYPIDPFTADLDDLAELLPTFTIIDGHGVHDPDGMLSS
Ga0318546_1004731633300031771SoilLVGYPVDPLAVDPDDLAELTPAFTMVGGRVTHDPDKRLTP
Ga0318543_1054744513300031777SoilVGYPADPLAADPDDLAGLTPAFTIVGGRATHDPDQRLAR
Ga0318498_1044608623300031778SoilLVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLARVGE
Ga0318566_1000247013300031779SoilGKLADLVGYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0318566_1002706113300031779SoilGKLADLVGYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0318557_1027291913300031795SoilGKLADLVGYPLDPLGADPDDLAGLTPAFTIAGGRATHDPDKRLAR
Ga0318523_1003352113300031798SoilVAYPIDPLTADPDDLAELTPAFTIVGGQATHDPDKRLAP
Ga0318523_1021041113300031798SoilITPGKLADLVGYPADPLAADPDDLPQLTPAFTMVGGRPTYDPDKRLAR
Ga0318565_1001581013300031799SoilAYPADPLTADPDALAELTPAFTIVGGRATHDPDKRLAP
Ga0318497_1012228923300031805SoilAGYPADPMTADPDDLAGLIPAFTLVGGRPVHDPDKRLAR
Ga0318497_1036581113300031805SoilPGKLADLAGYPMDPMTADPDDLAGLTPAFTVVGGRPVHDPDKRLAQ
Ga0318567_1005605033300031821SoilTPGKLADLAGYPVDPMTADPDDLAGLVPEFTVVGGRPVHDPDKRLAR
Ga0318567_1024411213300031821SoilIPGKLADLVAYPLDPLTADLDDLADLTPALTIGGGQATYDPDKRMSP
Ga0318564_1000256453300031831SoilADLVGYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0318544_1031110423300031880SoilPLDPLSADPDDLAELTPAFTIAGGRATHDPDKRLAR
Ga0306925_1002424513300031890SoilADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0306925_1034699933300031890SoilSGQLADIVAYPADPLTADVDDLPGLTPAFTIVGGRPVHDPGGRLGPPR
Ga0306925_1056231723300031890SoilKLADLAGYPVDPMTADPDDLARLTPAFTVVGGRPVHDPDKRLAR
Ga0306925_1188966913300031890SoilPLDPLAASPDDLPGLTPAFTMVGGRATHDPDKRLAQ
Ga0306925_1206244233300031890SoilYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLTP
Ga0306925_1227956723300031890SoilDLVGYPADPLAADLDDLAELTPAFTIVGGRATYDPDKRLAP
Ga0318551_1003692413300031896SoilLADLVGYPVDPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0306921_1022171313300031912SoilAYRLDPLTADLDELADLKPELTVVGGRATHDPDKRLAR
Ga0306921_1124702813300031912SoilDLAGYSADPLAADPDDLAELTPVFTIVGGRATHDPDKRLAR
Ga0306921_1149162213300031912SoilSITPGKLADLVAYPLDPLTANPRDLPELTPAFTMMGGRATHDPDKRLAP
Ga0310912_1130915713300031941SoilKLADLAGYPADPMTADSDDLAGLIPAFTVVGGRPVHDPDKRLAR
Ga0310916_1140726113300031942SoilADPMTADPDNLADLTPAFTVVGGRPVHDPDKRLAR
Ga0310916_1141650013300031942SoilDLVGYPADPLAADPDDLAELTPAFTIVGGRPTYDPDKRLAR
Ga0310910_1064078013300031946SoilYPADPLAADPDDLAELTPAFTIVGGRPTYDPDKRLAR
Ga0310909_1031647933300031947SoilGKLADLVGYPADPLAADPDDLAELTPAFTIVGGQATYDPDKRLDR
Ga0306926_1216625523300031954SoilLVAYPLDPLVADPDDLAELTPAFTMLGGRATHDPGKRLAR
Ga0318531_1050772613300031981SoilPGKLADLVGYPADPLAVDLDDLADLTPAFTIVGGRAGHDPDKRLVR
Ga0318563_1077121213300032009SoilADLAGYPADPLTADPDDLAGLTPAFTIVGGRAMHDPGKRLARGC
Ga0318569_1037275323300032010SoilAYSLDPFTADLDDLPDLKPALTIAGGRATHDPDKRLAR
Ga0310911_1053483923300032035SoilVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAP
Ga0318559_1051852713300032039SoilADLAAYPIDPLAADLDDLADLTPAFTIVGGRAVHDPGGRLAS
Ga0318549_1024352413300032041SoilLADIVAYPAVPLTADVDDLPGLTPAFTIVGGRPVHDPGGRLGPPR
Ga0318545_1013419813300032042SoilPGKLADLAGYPADPLTADPDDLAGLTPAFTVVGGRPVHDPDKRLAQ
Ga0318545_1020157713300032042SoilPGKLADLVGYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0318556_1007759733300032043SoilDLVAYPLDPLVADPGELASLTPVFTIVGGRPSYDRDKRLTR
Ga0318556_1060578333300032043SoilGYPVDPLAADPDDLAELTPAFTMAGGQVTHDPDKRLAK
Ga0318558_1001654013300032044SoilDLVGYPVDPLAADPDDLAELTPAFTMAGGQVTHDPDKRLAK
Ga0318558_1007537823300032044SoilYPVDPLAADPDDLAELTPAFTMVGGRVTHDPDKRLTP
Ga0318506_1025806323300032052SoilTPGKLADLVGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAR
Ga0318570_1003169023300032054SoilADLVGYPVDPLAADPDDLAELTPAFTMAGGQVTHDPDKRLAK
Ga0318533_1132478023300032059SoilADLVAYPADPLTVDVEALAELTPTFTMLGGRATHDPEGRLS
Ga0318505_1018602123300032060SoilYPADPLTADVDDLPGLTPAFTIVGGRPVHDPGGRLGPPR
Ga0318505_1018989813300032060SoilVAYPLDPLTADPDDLAELTPAFTIMGGRATHDPGKRLAR
Ga0318504_1001920213300032063SoilLVGYPADPLAADPDDLAELTPAFTIVGGRPTHDPDKRLAR
Ga0318510_1018599613300032064SoilADLVAYPLDPLTADPGDLPELTPAFTMMGGRATHDPDKRLAG
Ga0318510_1022720913300032064SoilGYPADPLATDPDDLAEMTPAFTIVGGRATYDPDKRLAP
Ga0318513_1003465713300032065SoilDLAGYPADPMTADPDNLADLTPAFTVVGGRPVHDPDKRLAR
Ga0318513_1036956313300032065SoilITPGKLADLVGYPVDPLAADPDDLAELTPAFTMVGGRAAHDPGKRLAP
Ga0318514_1021088223300032066SoilPGKLADLVGYPVDPLAADPDDLAELTPAFTMAGGQVTHDPDKRLAK
Ga0318524_1009458213300032067SoilPGKLADLVGYPADPLAADPEDLAELTPAFTIVGGRATHDPDKRLAR
Ga0318553_1003430853300032068SoilVAYPLDPLAADPRDLAELSPVFTMVGGRATHDPRNWLAR
Ga0318553_1019044513300032068SoilLVAYSLDPFTADLDDLPDLKPALTIAGGRATHDPDKRLAR
Ga0318553_1029521313300032068SoilVDPLAADPDDLAELAPAFTIVGGRPTHDPDKRLAR
Ga0318553_1073236123300032068SoilGYPADPLAADPDDLAELTPAFTIVGGRPTYDPDKRLAR
Ga0318553_1078013213300032068SoilIDPLTADPDDLAERTPAFTIVGGQATHDPDKRLAP
Ga0306924_1029674023300032076SoilADLAGYPADPLAADPDDLAELTPAFTIVGGRATHDPDKRLAP
Ga0318518_1009712233300032090SoilGYPVDPMTADPDDLAGLVPEFTVVGGRPVHDPDKRLAR
Ga0318518_1035265513300032090SoilLADLVGYPADPLAVDLDDLADLTPAFTIVGGRAGHDPDKRLVR
Ga0318518_1051453013300032090SoilGYPADPLAADPDDLPQLTPAFTMVGGRPTYDPDKRLAR
Ga0318518_1066700223300032090SoilTPGKLADLVAYPLDPLVADPDDLAGLTPAFTILGGRATYDPGKRLAR
Ga0318540_1017707123300032094SoilLVAYPADPFAVDVDELPQLLPAFTIVGGRVAYDPDGRLS
Ga0306920_10016068143300032261SoilKLADLVGYHLDPLAADPDDLAELTPTFTITGGRAVHDPSGMLGS
Ga0306920_10149399313300032261SoilADPLAADPDDLAEMTPAFTMMGGRATHDPDKRLAR
Ga0306920_10150804413300032261SoilLDPLAADPRDLAELSPVFTMVGGRATHDPRKWLAR
Ga0306920_10305941613300032261SoilADLVGYRLDPLAADPDDLAELTPTFTITGGRAVHDPSGMLGSPI
Ga0310914_1055637923300033289SoilPGKLADLVAYPADPFAVDVDELPQLLPAFTIVGGRVAYDPDGRLS
Ga0310914_1107040423300033289SoilAGYPADPMTADPDDLAGLTPAFTVVGGRPVHDPDKRLAR
Ga0310914_1123207313300033289SoilAYPLDPLAADPRDLAELSPVFTMVGGRATHDPRNWLAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.