NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046606

Metagenome / Metatranscriptome Family F046606

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046606
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 44 residues
Representative Sequence MRNLTEDEFLRGKERLRRAIRHAEDTANPETRSNWLDLLVLR
Number of Associated Samples 138
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.97 %
% of genes near scaffold ends (potentially truncated) 90.73 %
% of genes from short scaffolds (< 2000 bps) 90.73 %
Associated GOLD sequencing projects 127
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.199 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.232 % of family members)
Environment Ontology (ENVO) Unclassified
(28.477 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.397 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.29%    β-sheet: 0.00%    Coil/Unstructured: 55.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF04978DUF664 9.27
PF00582Usp 7.95
PF08241Methyltransf_11 4.64
PF08327AHSA1 3.31
PF00903Glyoxalase 2.65
PF03575Peptidase_S51 1.99
PF07883Cupin_2 1.99
PF00561Abhydrolase_1 1.99
PF02585PIG-L 1.32
PF13439Glyco_transf_4 1.32
PF01243Putative_PNPOx 1.32
PF00355Rieske 1.32
PF01594AI-2E_transport 1.32
PF01613Flavin_Reduct 1.32
PF01872RibD_C 1.32
PF12840HTH_20 1.32
PF01370Epimerase 1.32
PF01039Carboxyl_trans 1.32
PF13672PP2C_2 0.66
PF16697Yop-YscD_cpl 0.66
PF01436NHL 0.66
PF03795YCII 0.66
PF03551PadR 0.66
PF12802MarR_2 0.66
PF13489Methyltransf_23 0.66
PF12695Abhydrolase_5 0.66
PF12680SnoaL_2 0.66
PF00107ADH_zinc_N 0.66
PF04343DUF488 0.66
PF13425O-antigen_lig 0.66
PF05977MFS_3 0.66
PF10027DUF2269 0.66
PF00486Trans_reg_C 0.66
PF13302Acetyltransf_3 0.66
PF01883FeS_assembly_P 0.66
PF13517FG-GAP_3 0.66
PF06821Ser_hydrolase 0.66
PF00067p450 0.66
PF09413DUF2007 0.66
PF00144Beta-lactamase 0.66
PF00313CSD 0.66
PF13304AAA_21 0.66
PF04828GFA 0.66
PF00480ROK 0.66
PF14329DUF4386 0.66
PF13649Methyltransf_25 0.66
PF00483NTP_transferase 0.66
PF00884Sulfatase 0.66
PF02597ThiS 0.66
PF06778Chlor_dismutase 0.66
PF10604Polyketide_cyc2 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 1.32
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.32
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 1.32
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 1.32
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 1.32
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.32
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 1.32
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 1.32
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 1.32
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.66
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.66
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.66
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.66
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.66
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 0.66
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 0.66
COG2124Cytochrome P450Defense mechanisms [V] 0.66
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.66
COG2367Beta-lactamase class ADefense mechanisms [V] 0.66
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.66
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.66
COG3253Coproheme decarboxylase/chlorite dismutaseCoenzyme transport and metabolism [H] 0.66
COG3545Predicted esterase of the alpha/beta hydrolase foldGeneral function prediction only [R] 0.66
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.52 %
UnclassifiedrootN/A28.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003324|soilH2_10163788Not Available1506Open in IMG/M
3300003990|Ga0055455_10092756All Organisms → cellular organisms → Bacteria → Terrabacteria group881Open in IMG/M
3300004479|Ga0062595_101826406Not Available579Open in IMG/M
3300005158|Ga0066816_1025594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300005162|Ga0066814_10063654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300005163|Ga0066823_10143440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia524Open in IMG/M
3300005172|Ga0066683_10366579Not Available893Open in IMG/M
3300005328|Ga0070676_10921885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300005332|Ga0066388_100590434All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300005332|Ga0066388_100705944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1615Open in IMG/M
3300005364|Ga0070673_102203009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300005435|Ga0070714_100096346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2600Open in IMG/M
3300005436|Ga0070713_100361351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1349Open in IMG/M
3300005439|Ga0070711_100587884Not Available927Open in IMG/M
3300005545|Ga0070695_100865966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300005546|Ga0070696_101309410All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005560|Ga0066670_10106875All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300005578|Ga0068854_101439777Not Available624Open in IMG/M
3300005616|Ga0068852_102833505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300005764|Ga0066903_108076857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300006028|Ga0070717_12006426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces521Open in IMG/M
3300006172|Ga0075018_10212657All Organisms → cellular organisms → Bacteria → Terrabacteria group922Open in IMG/M
3300006174|Ga0075014_100435616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300006196|Ga0075422_10352287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300006804|Ga0079221_10081647All Organisms → cellular organisms → Bacteria1540Open in IMG/M
3300006806|Ga0079220_11647921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300006853|Ga0075420_100813556All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300006903|Ga0075426_10453443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia950Open in IMG/M
3300006903|Ga0075426_11106618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia600Open in IMG/M
3300009098|Ga0105245_11855562Not Available656Open in IMG/M
3300009147|Ga0114129_10262168All Organisms → cellular organisms → Bacteria2315Open in IMG/M
3300009148|Ga0105243_12558716Not Available550Open in IMG/M
3300009156|Ga0111538_11697915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia795Open in IMG/M
3300009162|Ga0075423_10221811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1982Open in IMG/M
3300009174|Ga0105241_10483169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1101Open in IMG/M
3300009174|Ga0105241_11161998Not Available729Open in IMG/M
3300009551|Ga0105238_10253598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1738Open in IMG/M
3300009789|Ga0126307_10922653Not Available705Open in IMG/M
3300009789|Ga0126307_11605295Not Available528Open in IMG/M
3300009792|Ga0126374_10618945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia802Open in IMG/M
3300009792|Ga0126374_11784953All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010036|Ga0126305_10067116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2081Open in IMG/M
3300010038|Ga0126315_11071140Not Available543Open in IMG/M
3300010040|Ga0126308_10822066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14644Open in IMG/M
3300010043|Ga0126380_11400612All Organisms → cellular organisms → Bacteria → Terrabacteria group614Open in IMG/M
3300010337|Ga0134062_10023398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium2385Open in IMG/M
3300010359|Ga0126376_13059073Not Available517Open in IMG/M
3300010360|Ga0126372_10304150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1403Open in IMG/M
3300010361|Ga0126378_11643122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii730Open in IMG/M
3300010366|Ga0126379_11498827Not Available780Open in IMG/M
3300010371|Ga0134125_10646729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1167Open in IMG/M
3300010371|Ga0134125_12592363Not Available551Open in IMG/M
3300010376|Ga0126381_102069516Not Available820Open in IMG/M
3300010396|Ga0134126_10732982All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300010399|Ga0134127_10075748All Organisms → cellular organisms → Bacteria → Terrabacteria group2873Open in IMG/M
3300010399|Ga0134127_10201131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1853Open in IMG/M
3300010401|Ga0134121_11233555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium749Open in IMG/M
3300011270|Ga0137391_10481368Not Available1053Open in IMG/M
3300012198|Ga0137364_11249843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300012201|Ga0137365_10951398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300012207|Ga0137381_11326825Not Available612Open in IMG/M
3300012900|Ga0157292_10107164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300012944|Ga0137410_10582465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia923Open in IMG/M
3300012951|Ga0164300_10430707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia734Open in IMG/M
3300012960|Ga0164301_11538853Not Available549Open in IMG/M
3300012985|Ga0164308_10050227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2691Open in IMG/M
3300012987|Ga0164307_10284518Not Available1171Open in IMG/M
3300012987|Ga0164307_10498694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia919Open in IMG/M
3300013105|Ga0157369_11121088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium804Open in IMG/M
3300013296|Ga0157374_10144848All Organisms → cellular organisms → Bacteria2307Open in IMG/M
3300013297|Ga0157378_11968080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Gordonia634Open in IMG/M
3300013306|Ga0163162_11687350Not Available723Open in IMG/M
3300014745|Ga0157377_10843090Not Available680Open in IMG/M
3300014968|Ga0157379_10734367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria929Open in IMG/M
3300015371|Ga0132258_13842538Not Available1022Open in IMG/M
3300015372|Ga0132256_100486908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1343Open in IMG/M
3300015373|Ga0132257_101644528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia822Open in IMG/M
3300015374|Ga0132255_100069295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4680Open in IMG/M
3300015374|Ga0132255_100850822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1362Open in IMG/M
3300016371|Ga0182034_11563749Not Available578Open in IMG/M
3300017959|Ga0187779_11294799Not Available516Open in IMG/M
3300017966|Ga0187776_10051553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2343Open in IMG/M
3300017972|Ga0187781_10257497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1235Open in IMG/M
3300017974|Ga0187777_10337185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1035Open in IMG/M
3300018060|Ga0187765_10639745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces incarnatus691Open in IMG/M
3300018081|Ga0184625_10149447All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300018468|Ga0066662_12082089Not Available595Open in IMG/M
3300019356|Ga0173481_10295389All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300020199|Ga0179592_10342175Not Available659Open in IMG/M
3300020579|Ga0210407_11007969All Organisms → cellular organisms → Bacteria → Terrabacteria group635Open in IMG/M
3300020583|Ga0210401_10664479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria903Open in IMG/M
3300021478|Ga0210402_10516910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1108Open in IMG/M
3300021560|Ga0126371_10405374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1506Open in IMG/M
3300022467|Ga0224712_10386589Not Available665Open in IMG/M
3300022533|Ga0242662_10239444Not Available585Open in IMG/M
3300024182|Ga0247669_1022628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1080Open in IMG/M
3300024288|Ga0179589_10526258All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300025552|Ga0210142_1041823All Organisms → cellular organisms → Bacteria → Terrabacteria group881Open in IMG/M
3300025911|Ga0207654_10483561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia872Open in IMG/M
3300025915|Ga0207693_11474241All Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300025921|Ga0207652_10158386All Organisms → cellular organisms → Bacteria2029Open in IMG/M
3300025924|Ga0207694_11452244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Ericales → Theaceae → Gordonia579Open in IMG/M
3300025927|Ga0207687_11102748All Organisms → cellular organisms → Bacteria → Terrabacteria group682Open in IMG/M
3300025928|Ga0207700_10304186All Organisms → cellular organisms → Bacteria → Terrabacteria group1378Open in IMG/M
3300025928|Ga0207700_11388072All Organisms → cellular organisms → Bacteria → Terrabacteria group625Open in IMG/M
3300025929|Ga0207664_10376233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. FMUSA5-51260Open in IMG/M
3300025931|Ga0207644_10632576All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300025935|Ga0207709_11713935All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300025937|Ga0207669_10359366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1128Open in IMG/M
3300025944|Ga0207661_10012598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6153Open in IMG/M
3300025944|Ga0207661_11050288Not Available750Open in IMG/M
3300026041|Ga0207639_10207112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1686Open in IMG/M
3300026041|Ga0207639_11024218Not Available773Open in IMG/M
3300026118|Ga0207675_102133442Not Available576Open in IMG/M
3300026959|Ga0207852_1022644Not Available649Open in IMG/M
3300027725|Ga0209178_1063389All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300027765|Ga0209073_10208385Not Available746Open in IMG/M
3300027821|Ga0209811_10434776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300028072|Ga0247675_1048063All Organisms → cellular organisms → Bacteria → Terrabacteria group633Open in IMG/M
3300028138|Ga0247684_1069950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia576Open in IMG/M
3300028775|Ga0302231_10520386Not Available504Open in IMG/M
3300028790|Ga0307283_10060430Not Available924Open in IMG/M
3300028791|Ga0307290_10202343Not Available728Open in IMG/M
3300031525|Ga0302326_11649837Not Available849Open in IMG/M
3300031543|Ga0318516_10472661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia720Open in IMG/M
3300031549|Ga0318571_10377471Not Available549Open in IMG/M
3300031572|Ga0318515_10310873All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300031679|Ga0318561_10853449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora globispora501Open in IMG/M
3300031682|Ga0318560_10777538All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300031720|Ga0307469_11030639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia770Open in IMG/M
3300031769|Ga0318526_10054860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1528Open in IMG/M
3300031782|Ga0318552_10494859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300031793|Ga0318548_10227725Not Available916Open in IMG/M
3300031795|Ga0318557_10568556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300031805|Ga0318497_10327796All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300031845|Ga0318511_10475995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300031860|Ga0318495_10492908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300031947|Ga0310909_11452427Not Available547Open in IMG/M
3300032039|Ga0318559_10128475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1141Open in IMG/M
3300032055|Ga0318575_10650789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia533Open in IMG/M
3300032068|Ga0318553_10087474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1576Open in IMG/M
3300032074|Ga0308173_10353965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1279Open in IMG/M
3300032126|Ga0307415_100775752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300032174|Ga0307470_10502362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium885Open in IMG/M
3300032770|Ga0335085_10639490Not Available1191Open in IMG/M
3300032892|Ga0335081_12551833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300032895|Ga0335074_10964882Not Available759Open in IMG/M
3300032898|Ga0335072_10295770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1819Open in IMG/M
3300033134|Ga0335073_10229134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2282Open in IMG/M
3300033134|Ga0335073_10250854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2156Open in IMG/M
3300033158|Ga0335077_10217276Not Available2137Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.30%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.64%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.64%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.64%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.97%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.31%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.31%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.99%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.99%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.32%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.32%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.32%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.32%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.32%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.66%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.66%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.66%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.66%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005158Soil and rhizosphere microbial communities from Laval, Canada - mgHAAEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
soilH2_1016378823300003324Sugarcane Root And Bulk SoilLLAQVDTLRRADTTLHSLSEEEFQRGKDRLRRAAQAATATASPEPRSNWLDLLVLR*
Ga0055455_1009275623300003990Natural And Restored WetlandsRNLTDDEFLRGKDRLRRAVRHAETTGNAEHRSNWLDLLVLR*
Ga0062595_10182640613300004479SoilADTTMRSLSDDEFEQGKERLRRAMRQAAATGAPEPRGNLLDLLVLR*
Ga0066816_102559423300005158SoilSLAEFLDQADNLRRADTIMRGLTEEEFLRGKEQLRRAVQHAGRTARTETRTSWLDLMVLR
Ga0066814_1006365423300005162SoilRADTIMRGLTEEEFLRGKEQLRRAVQHAGRTARTETRTSWLDLLVLR*
Ga0066823_1014344023300005163SoilLAEFLDQADNFRRADTNMRGLTEEEFLRGKEQLRRTVQHAGHTSRTETRTNWLDLLVLR*
Ga0066683_1036657913300005172SoilNLTEDEFRRGKARLRRAVRHAEDTTNPEIRSSWLDLLVLR*
Ga0070676_1092188523300005328Miscanthus RhizosphereDVDAFRQADTTLRGLTDDEFRRGKQRLRRAVQDSSPEPRSNWLDLLVLRAG*
Ga0066388_10059043413300005332Tropical Forest SoilQADNFRRADTNMRGLTEEEFLRGKEQLRRAVQHTKQTARTETRTNWLDLLVLR*
Ga0066388_10070594413300005332Tropical Forest SoilDTTMRGLTDDEFLRGKARLRRAVQHAEDTAQPENRSNRLDLLVLR*
Ga0070673_10220300913300005364Switchgrass RhizosphereFRDADTTMRTLSDDEFVRGKERLRRAVRQANPEPRSNVLDLLVLR*
Ga0070714_10009634643300005435Agricultural SoilLTEDEFARGKERLRRAVRDAEGTPNPETRSNWLDLLVLR*
Ga0070713_10036135143300005436Corn, Switchgrass And Miscanthus RhizosphereAFRHADTTMRDLTEAEFLRGRERLRRAVEEAEDAATPETRSNWLDLLVLR*
Ga0070711_10058788423300005439Corn, Switchgrass And Miscanthus RhizosphereTMRNLTEEEFLRGKERLRRAAQDAEETPSPEPRTNWLDLLVLR*
Ga0070695_10086596623300005545Corn, Switchgrass And Miscanthus RhizosphereMRNLTEGEFLRGKERLRRAARDAQTTANREPRSNWLDLLVLH*
Ga0070696_10130941013300005546Corn, Switchgrass And Miscanthus RhizosphereRSLTDDEFERGKERLRRAVRQAEASGAPERRGNWLELLVLR*
Ga0066670_1010687513300005560SoilLRHADTSLRALTEDEFRRGKERLRRAAQQAEDLRSNWLDLLVLRRRRRR*
Ga0068854_10143977723300005578Corn RhizosphereLRRADTTMRSLSDDEFRRGKERLRRAVRHAEAGGARKPHGNWLDLLVLR*
Ga0068852_10283350523300005616Corn RhizosphereSLTDDQFLRGKDRVRRAVRDATDTEPRSNWLDLLVLRAP*
Ga0066903_10807685713300005764Tropical Forest SoilDEFLRGKERLRRAVRHADDTANPETRTNWLDLLVLR*
Ga0070717_1200642623300006028Corn, Switchgrass And Miscanthus RhizosphereGELLAELDTLRHADTTLRNLTEDEFLRGKERIRRAAESGDREPRSNRLDLIVLR*
Ga0075018_1021265733300006172WatershedsFLRGKEQLRRAVQHAGHTSRTETRTNWLDLLVLR*
Ga0075014_10043561623300006174WatershedsAEFLDQADNFRRADTNMRGLTEEEFLRGKEQLRRAVQHAGHTSRTETRTNWLDLLVLR*
Ga0075422_1035228713300006196Populus RhizosphereLSEDEFLRGKERLRRAVRHGGDTASPETRSNSLDLLVLR*
Ga0079221_1008164733300006804Agricultural SoilMRGLTEEEFLRGKEQLRRAVQHAGHAAHTEARTNWLDLLVLR*
Ga0079220_1164792113300006806Agricultural SoilSLTEDEFLRGKKRLRRAVRRAETTANPETRRSWFDFLVLR*
Ga0075420_10081355613300006853Populus RhizosphereHLTEDEFLRGKERLRRAVRDAEDTEARSNWLDLLVLR*
Ga0075426_1045344343300006903Populus RhizosphereLTEEEYLRGKEQLRRAVEQAGPAARNEARTSWLELLVLR*
Ga0075426_1110661813300006903Populus RhizosphereFRDADTTMRTLSDDEFLRGKERLRRAARQANPEPRSNVLDLLVLR*
Ga0105245_1185556213300009098Miscanthus RhizosphereTDDQFLRGKDRVRRAVRDATDTEPRSNWLDLLVLRAS*
Ga0114129_1026216833300009147Populus RhizosphereADTTMRNLTEDEFLRGKERLRRAVRHADDSAHPETRSNRLDLLVLR*
Ga0105243_1255871623300009148Miscanthus RhizosphereDDEFRRGKERLRRAVRHAEAGGARKPHGNWLDLLVLR*
Ga0111538_1169791513300009156Populus RhizosphereSLTEEEFRRGKERIRRAVDAGNLETRNNRLDLLILR*
Ga0075423_1022181133300009162Populus RhizosphereTMRSLTDDEFLRGKERLRRALRHAEAGAAPEPRGNWLELVVLR*
Ga0105241_1048316933300009174Corn RhizosphereADLLGQVDTFRHADTTMRNLTEGEFLRGKERVRRAARHAETTANREPRSNWLDLLVLR*
Ga0105241_1116199833300009174Corn RhizosphereGLTEDEFLRGKEHLRRAIEQAEGTPSPEPRSNRLDLLVLR*
Ga0105238_1025359823300009551Corn RhizosphereMRSLSDDEFERGKERLRRAIRQADRTGAPEPRGNLLDLLVLR*
Ga0126307_1092265313300009789Serpentine SoilMVQVDTFRQADTTMRQLTEEAFLRGKDRLRGAARPAEDTATREPRSNWLDLLVLR*
Ga0126307_1160529513300009789Serpentine SoilTNMRGLTEEEFRRGKERLRRAVQHAEHTARTETRTNWLDLLVLR*
Ga0126374_1061894513300009792Tropical Forest SoilSDTNLRSLTEEEYLRGKEQLRRAVERAGPAARNEARTSWLELLVLR*
Ga0126374_1178495323300009792Tropical Forest SoilRQLTEDEFLRGKERLRRGVRQAEDTANPEIRSNWLDLLVLR*
Ga0126305_1006711633300010036Serpentine SoilMVQVDTFRQADTTMRQLTEEEFLRGKDRRRRAVRPAEDTATPEPRSNWLDLLVLR*
Ga0126315_1107114013300010038Serpentine SoilMVQVDTFRQADTTMRQLTEEEFLRGKDRLRRAVRPAEDTATPEPRSNWLDLLVLR*
Ga0126308_1082206633300010040Serpentine SoilRHLTEDELLRGKERLRRAVRQAENTATPETRSNWLDLLVLR*
Ga0126380_1140061233300010043Tropical Forest SoilADTTLRNLTEDEFLRGKERLRRAVDTGSPALRSNRLDLLVLRRGK*
Ga0134062_1002339813300010337Grasslands SoilTMRNLTEDEFRRGKARLRRAVRHAEDTTNPEIRSSWLDLLVLR*
Ga0126376_1305907323300010359Tropical Forest SoilLTEDEFLRGQERLRLAVRHAEDAANQGTRSNWLDLLVLR*
Ga0126372_1030415043300010360Tropical Forest SoilRSLSEEEFRRGKERLRSAVEAGMREPRTNWLDLLVLR*
Ga0126378_1164312213300010361Tropical Forest SoilEFLRGKERLCRAAQDAEKTPSPKPRTSWLDLLVLR*
Ga0126379_1149882713300010366Tropical Forest SoilEDEFLRGKERLRRAVRHAGDTANPDTRSNWLDLLVLR*
Ga0134125_1064672913300010371Terrestrial SoilDDEFLRGKARLRRAVRRAEAGAAREPRGNWLELLVLR*
Ga0134125_1259236313300010371Terrestrial SoilRRADTTMRNLTEEEFLRGTERLRRAAQDAEETPSPEPRTNWLDLLVLR*
Ga0126381_10206951613300010376Tropical Forest SoilTTMRILTDDEFLRGTERLRRAVDDAQSEPRSNTLDLLVLR*
Ga0134126_1073298213300010396Terrestrial SoilSLAEFLAQADTFRRADTTMRNLTEEEFLRGTERLRRAAQDAEETPSPEPRTNWLDLLVLR
Ga0134127_1007574813300010399Terrestrial SoilDTTMRSLTDDEFRRGKERLRRAVRRAEAGGVREARGNWLDLLVLR*
Ga0134127_1020113153300010399Terrestrial SoilVDTFRDADTTMRTLSDDEFVSGKERLRRAVGQANPEPRSNVL
Ga0134121_1123355523300010401Terrestrial SoilDTSLRALTEDEFRRGKERLRRAAQQAEDTRSNWLDLLVLR*
Ga0137391_1048136823300011270Vadose Zone SoilMRGLTEEEFLPGKQRLRRAVQHAEHTARTETRTSWLDLLVLR*
Ga0137364_1124984313300012198Vadose Zone SoilTLRGLTEQEFLRGKERLSRAARHAGDRAKPESRSNWLDLLVLR*
Ga0137365_1095139813300012201Vadose Zone SoilHADTTMRNLTEDEFLRGKERLGRAVRQDEEAADPATRSNWLDLLVLR*
Ga0137381_1132682513300012207Vadose Zone SoilDQADNFRRADTVMRGLTEEEFLRGKQRLRRAMQHAGHTARTETRTSWLDILVLR*
Ga0157292_1010716433300012900SoilFLRGKERLRRAVRQAEDTANPQTRSNSLDLLVLR*
Ga0137410_1058246513300012944Vadose Zone SoilDTTMRNLTEDEFLRGKERLRRAIRDAEGTASPETRSNWLDLLVLR*
Ga0164300_1043070713300012951SoilRDADTTLRSLTDDQFLRGKDRVRRAVRDATDTEPRRNSLDLLVLRAP*
Ga0164301_1153885323300012960SoilMRNLTEEEFLRGKERLRRAAQDAEETPSPEPRTNWLDLLVLR*
Ga0164308_1005022713300012985SoilRHADTTLRHLSEDEFQRGKERLRRAVRASEAQADPEPRSNWLDLLVLR*
Ga0164307_1028451813300012987SoilSDTNLRSLTEEEYQRGKEQLRRAVERAGPAARNEARTSWLELLVLR*
Ga0164307_1049869433300012987SoilLRDADTTMRSLTDDQFLRGKDRVRRAVRDATDTEPRSNWLDLLVLRAS*
Ga0157369_1112108813300013105Corn RhizosphereTFRHADTTMHNLTENEFRRGKERLRRAARDAETTGNGEPRSNWLDLLVLR*
Ga0157374_1014484813300013296Miscanthus RhizosphereFRQADTTMRSLTDDEFVRGKERIRRAIRDGEDTGDPEARSNWLDLLVLR*
Ga0157378_1196808013300013297Miscanthus RhizosphereLGEVDTFRRADTTMRDLTEDEFLRGKQRLRRAVRQTESTANPEPRGNWLDLLVLR*
Ga0163162_1168735023300013306Switchgrass RhizosphereEFRRGKERLRRAVRHAEAGGARKPHGNWLDLLVLR*
Ga0157377_1084309013300014745Miscanthus RhizosphereSDDEFRRGKERLRRAVRHAEAGGARKPHGNWLDLLVLR*
Ga0157379_1073436713300014968Switchgrass RhizosphereRQADTTMRSLTDDEFLRGKARLRRAVRRAEAGAAREPRGNWLELLVLR*
Ga0132258_1384253823300015371Arabidopsis RhizosphereGSLTDLLRQVDTLRLADTTLRNLTDDEFLRGKESLRRAARRGESESTPPSRINWLDLLVLR*
Ga0132256_10048690813300015372Arabidopsis RhizosphereTMRALTEEEFLRGKDRVRRALRHAEATGSAETRSNWLDLLVLR*
Ga0132257_10164452823300015373Arabidopsis RhizosphereDQADNLRRADTVMRGLTEEEFLRGRERLRRAVQHAGHTARTETRTNWLDLLILR*
Ga0132255_10006929593300015374Arabidopsis RhizosphereLTEDEFQRGKKRLRSAVRAGANAEPRSNRLDLLVLR*
Ga0132255_10085082213300015374Arabidopsis RhizosphereQVDTFRHADTTMRTLTEDEFLRGKKRLRRAARDAESTGIREPRSNWLDLLVLR*
Ga0182034_1156374913300016371SoilTMRNLTEDEFLRGKERLHRAVRDAEDTANPETRTNWLDLLVLR
Ga0187779_1129479923300017959Tropical PeatlandLAEFLAQADTFRRADTTMRNLTEEEFLRGKKRLRRAARAAERPEPRANWLDLLVLR
Ga0187776_1005155323300017966Tropical PeatlandMGGLTEEEFLRGKERLRRAVQHAGHTARTETRTNWLDLLVLR
Ga0187781_1025749723300017972Tropical PeatlandLTEEEFLRGKERLRRAVQHAEHTARSQTRTNWLDLLVLR
Ga0187777_1033718523300017974Tropical PeatlandDEFLRGKERLRRAVRHALDTPNPDARSNRLDLLVLR
Ga0187765_1063974513300018060Tropical PeatlandDTTMRDLTEDEFLRGKERLRRAVRDAERTPSQETRSNWLDLLVLRAG
Ga0184625_1014944713300018081Groundwater SedimentTMRGLTEDEFLRGKERLRRAVRQAEDTANPETRSNSLDLLVLR
Ga0066662_1208208933300018468Grasslands SoilDLSEAEFLRGKERLRRAAQDAEHTSDQEPRTNWLDLLVLR
Ga0173481_1029538923300019356SoilLTEDEFLRGKERLRHAVRHAEDTANPETRSNWLDLLVLR
Ga0179592_1034217533300020199Vadose Zone SoilADTNMRGLTEEEFLRGKERLRRAVQHAEHSARTETRTNWLDLLVLR
Ga0210407_1100796913300020579SoilSLAGFLDQADNFRRADTNMRGLTEEEFLRGKEQLRRAVQHAGHTSRTETRTNWLDLLVLR
Ga0210401_1066447923300020583SoilSTIRNLTEEEFRRGKERLRRAAQDAEQAPSPEPRTSWLDLLVLR
Ga0210402_1051691033300021478SoilEEEFLRGKEQLRRAVQHAGHTSRTETRTNWLDLLVLR
Ga0126371_1040537443300021560Tropical Forest SoilDQADDFRRADTNMRGLTEEEFLRGKEQLRRAVRHAGHTASTQTRTNWLDLLVLR
Ga0224712_1038658913300022467Corn, Switchgrass And Miscanthus RhizosphereLTDDEFLRGKARLRRAVRRAEAGAAREPRGNWLELLVLR
Ga0242662_1023944413300022533SoilMRGLTEEEFLRGKEQLRRAVQHAGHTARTQTRTNWLDLLVLR
Ga0247669_102262833300024182SoilADTTMRTLSDDEFLRGKERLRRAARQANPEPRSNVLDLLVLR
Ga0179589_1052625823300024288Vadose Zone SoilMRGLTEEEFLRGKERLRRAVQHAGHTARPETRTNWLDLLVLR
Ga0210142_104182313300025552Natural And Restored WetlandsRNLTDDEFLRGKDRLRRAVRHAETTGNAEHRSNWLDLLVLR
Ga0207654_1048356123300025911Corn RhizosphereMRSLSDDEFERGKERLRRAIRQADRTGAPEPRGNLLDLLVLR
Ga0207693_1147424113300025915Corn, Switchgrass And Miscanthus RhizosphereTTMRSLTDDEFRRGKERLRRAVRHAEASGTGEPRGNRLDLLVLR
Ga0207652_1015838613300025921Corn RhizosphereDDEFEQGKERLRRAMRQAAATGAPEPRGNLLDLLVLR
Ga0207694_1145224413300025924Corn RhizosphereTLRGLTDDEFRRGKQRLRRAVQDSSPEPRSNWLDLLVLRAG
Ga0207687_1110274823300025927Miscanthus RhizosphereSLTEEEYQRGKEQLRRAVERAGPAARNEARTSWLELLVLR
Ga0207700_1030418643300025928Corn, Switchgrass And Miscanthus RhizosphereLGQIDAFRHADTTMRDLTEAEFLRGRERLRRAVEEAEDAATPETRSNWLDLLVLR
Ga0207700_1138807213300025928Corn, Switchgrass And Miscanthus RhizosphereLTEEEYQRGKEQLRRAVEQAGPAARNEARTSWLELLVLR
Ga0207664_1037623313300025929Agricultural SoilTTMRNLTEDEFARGKERLRRAVRDAEGTPNPETRSNWLDLLVLR
Ga0207644_1063257613300025931Switchgrass RhizosphereDDEFRRGKERLRRAVRRAEAGGVREPRGNWLDLLVLR
Ga0207709_1171393513300025935Miscanthus RhizosphereGLTDEEFLRGKERLRRAVEQERAGAAEHDRSNWLDLLVLR
Ga0207669_1035936613300025937Miscanthus RhizosphereRADTTMRDLTEDEFLRGKQRLRRAVRQTESTANPEPRGNWLDLLVLR
Ga0207661_1001259883300025944Corn RhizosphereMRSLTDEFLRGKARLRRAVRRAEAGAAREPRGNWLELLVLR
Ga0207661_1105028813300025944Corn RhizosphereDTTLRGLTEDEFLRGKERLRRAIEQAEGTPSPEPRSNRLDLLVLR
Ga0207639_1020711223300026041Corn RhizosphereVRDTTMRSLSDDEFERGKERLRRAIRQADRTGAPEPRGNLLDLLVLR
Ga0207639_1102421823300026041Corn RhizosphereTTMRDLTEDEFLRGKERLRSAVRQAEGTAKPEARSNWLDLLVLR
Ga0207675_10213344213300026118Switchgrass RhizosphereTEEEFLRGRERLRRAVQHAGHTARTETRANWLDLLILR
Ga0207852_102264423300026959Tropical Forest SoilDSTMRTLTEEEFLCGKERLRRAVRDAEKTPSPEPRTSRLDLLVLR
Ga0209178_106338913300027725Agricultural SoilFRRADTTMRNLTEEEFLRGKDRLRRAVQRSDGTGNQESRTNWLDLLVLR
Ga0209073_1020838523300027765Agricultural SoilLTEDEFLRGKARLRRAVRHAEDTADPGTRSNWLDLLVLR
Ga0209811_1043477623300027821Surface SoilLRRADTTLRGLTEAEFLRGKERLGRAVRKAEETASPEPRSNWLDLLVLR
Ga0247675_104806313300028072SoilLTEEEYQRGKEQLRRAVERAGPAARNEARTSWLELLVLR
Ga0247684_106995013300028138SoilSLTEEEYLRGKEQLRRAVEQAGPAARNEARTSWLELLVLR
Ga0302231_1052038613300028775PalsaRNLTEDEPRRGKERLRRALRHAEDTANPETRSNWLDLLVLC
Ga0307283_1006043023300028790SoilTEDEFLRGKERLRSAVRQAEDAGTQETRSNWLDLLVLR
Ga0307290_1020234323300028791SoilEFLRGKERLRSAVRQAEDAGTQETRSNWLDLLVLR
Ga0302326_1164983713300031525PalsaADTTMRILTDEEFLRGKERLRRAVRKEEESATPEPRTNWLDLLVLR
Ga0318516_1047266123300031543SoilTEEEFLRGKERLRRAVRHAGHTARTETRTNWLELLVLR
Ga0318571_1037747113300031549SoilEDEFLRGKERLRRAIQHAGDTANQETRSNWLDLLVLR
Ga0318515_1031087323300031572SoilTNMRNLTEEEFLRGKERLRRAGYPRGPEPRTNWLDLLVLR
Ga0318561_1085344913300031679SoilDTTMRNLTEEEFLSGKERLRRAVRTASPEPRTSWLDLLVLR
Ga0318560_1077753813300031682SoilAEFLDQADNFRRSDTNMRGLTEEEFLRGKEQLRRAVQHAGHAAHTETRTNWLDLLVLR
Ga0307469_1103063913300031720Hardwood Forest SoilMRGLTEEEFLRGKERLRRAVQHAGHIARTETRTNW
Ga0318526_1005486033300031769SoilDEFLRGKERLRRAIQHAGDTANQETRSNWLDLLVLR
Ga0318552_1049485913300031782SoilMRNLTEEEFRRGKERLRRAAQHAEEAVGPQTRTSWLDLLVLR
Ga0318548_1022772513300031793SoilLTEDEFLRGKERLRRAIRHGEDTANLETRSNWLDLLVLR
Ga0318557_1056855623300031795SoilEFLRGKERLRQAALDAEKTSGPEPRTSWLDLLVLR
Ga0318497_1032779613300031805SoilRNLTEEEFLRGKERLRRAAQIPGPEPRTNWLDLLVLR
Ga0318511_1047599513300031845SoilGQLDTFRRADTTMRNLTEDEFRRGEDRLRRAVRHAEDTPSPDARSNWLDLLVLR
Ga0318495_1049290833300031860SoilTEDEFRRGEDRLRRAVRHAEDTPSPDARSNWLDLLVLR
Ga0310909_1145242713300031947SoilDEFLRGKERLHRAVRDAEDTANPETRTNWLDLLVLR
Ga0318559_1012847513300032039SoilTFRRADTNMRNLTEVEFLRGKERLRRAAQIPGPEPRTNWLDLLVLR
Ga0318575_1065078913300032055SoilMRNLTEDEFLRGKERLRRAIRHAEDTANPETRSNWLDLLVLR
Ga0318553_1008747433300032068SoilEDEFLRGKERLRRAIRHAGDTANQETRSNWLDLLVLR
Ga0308173_1035396513300032074SoilFRAADTTMRKLTDDEFLRGKERLGRAVLDPEHTANREPRHNWLDLLVLR
Ga0307415_10077575223300032126RhizosphereMVQVDTFRQADTTMRQLTEEEFLRGKDRLRRAVRPAEDTATPEPRSNWLDLLVLR
Ga0307470_1050236213300032174Hardwood Forest SoilTDDEFRRGKERLRRAVRDAESAGSPEPRSNWLDLLVLR
Ga0335085_1063949033300032770SoilMRGLTEEEFLRGKEQLRRAVQHAGHTAHTQTRTNWLDFLVLR
Ga0335081_1255183313300032892SoilVEFLRGKERLRRAVQHAEQASSQEPRTNWLDLLVLR
Ga0335074_1096488213300032895SoilNLTEEEFLRGKERLRRAAQDAEQAPSPEPRTSWLDLLVLR
Ga0335072_1029577013300032898SoilVDTFRQGDTTMRNLTEEEFRRGKQRLRGAVRTAGPESTTTWLDLLVLR
Ga0335073_1022913413300033134SoilRRSDTIMRGLTEEEFLRGKEQLRRAVRSADPAARTEPRTSWLDLLVLR
Ga0335073_1025085413300033134SoilLRRADSTMRTLTDDEFRRGKERIRRAVRRAAETGEPETRANWLDLLVLR
Ga0335077_1021727633300033158SoilHEFLRGKERLRRAVRQAERRGGAEPRSNWLDLLVLR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.