NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046563

Metagenome / Metatranscriptome Family F046563

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046563
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 44 residues
Representative Sequence VAVTGLANLAVKVADLDAACAFYEAAGADVRDRMHWNNGERADVYLG
Number of Associated Samples 135
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 74.83 %
% of genes near scaffold ends (potentially truncated) 99.34 %
% of genes from short scaffolds (< 2000 bps) 92.72 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.265 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds
(7.947 % of family members)
Environment Ontology (ENVO) Unclassified
(16.556 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.424 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.33%    β-sheet: 20.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF06772LtrA 7.28
PF01408GFO_IDH_MocA 4.64
PF00884Sulfatase 4.64
PF07969Amidohydro_3 2.65
PF17124ThiJ_like 2.65
PF03551PadR 1.99
PF136224HBT_3 1.99
PF00582Usp 1.32
PF03795YCII 1.32
PF04101Glyco_tran_28_C 1.32
PF06445GyrI-like 1.32
PF09335SNARE_assoc 1.32
PF08448PAS_4 1.32
PF04909Amidohydro_2 1.32
PF11716MDMPI_N 1.32
PF00881Nitroreductase 1.32
PF12697Abhydrolase_6 1.32
PF07690MFS_1 1.32
PF02894GFO_IDH_MocA_C 1.32
PF00144Beta-lactamase 0.66
PF05726Pirin_C 0.66
PF13614AAA_31 0.66
PF13673Acetyltransf_10 0.66
PF01261AP_endonuc_2 0.66
PF12681Glyoxalase_2 0.66
PF13424TPR_12 0.66
PF13649Methyltransf_25 0.66
PF02518HATPase_c 0.66
PF02687FtsX 0.66
PF01450IlvC 0.66
PF11026DUF2721 0.66
PF05982Sbt_1 0.66
PF00171Aldedh 0.66
PF13193AMP-binding_C 0.66
PF10604Polyketide_cyc2 0.66
PF13577SnoaL_4 0.66
PF00444Ribosomal_L36 0.66
PF01844HNH 0.66
PF04237YjbR 0.66
PF08245Mur_ligase_M 0.66
PF01152Bac_globin 0.66
PF00201UDPGT 0.66
PF13561adh_short_C2 0.66
PF00730HhH-GPD 0.66
PF13426PAS_9 0.66
PF01520Amidase_3 0.66
PF05139Erythro_esteras 0.66
PF04138GtrA 0.66
PF00903Glyoxalase 0.66
PF01636APH 0.66
PF01575MaoC_dehydratas 0.66
PF03060NMO 0.66
PF02771Acyl-CoA_dh_N 0.66
PF04115Ureidogly_lyase 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 7.28
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.99
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.99
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.99
COG0059Ketol-acid reductoisomeraseAmino acid transport and metabolism [E] 1.32
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 1.32
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 1.32
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 1.32
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 1.32
COG1819UDP:flavonoid glycosyltransferase YjiC, YdhE familyCarbohydrate transport and metabolism [G] 1.32
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.32
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.66
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.66
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.66
COG0257Ribosomal protein L36Translation, ribosomal structure and biogenesis [J] 0.66
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.66
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 0.66
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.66
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.66
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.66
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.66
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.66
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 0.66
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.66
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.66
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.66
COG2312Erythromycin esterase homologSecondary metabolites biosynthesis, transport and catabolism [Q] 0.66
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 0.66
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.66
COG2367Beta-lactamase class ADefense mechanisms [V] 0.66
COG3194Ureidoglycolate hydrolase (allantoin degradation)Nucleotide transport and metabolism [F] 0.66
COG3329Na+-dependent bicarbonate transporter SbtAEnergy production and conversion [C] 0.66
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.66

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.26 %
UnclassifiedrootN/A39.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908007|FWIRElOz_GKZ9IRQ02JAH2NAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Neomegalonemataceae → Neomegalonema → Neomegalonema perideroedes526Open in IMG/M
2170459005|F1BAP7Q02IQ8ZHAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
2170459013|GO6OHWN01CMFV7All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300001661|JGI12053J15887_10473308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales599Open in IMG/M
3300003219|JGI26341J46601_10044468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1405Open in IMG/M
3300003369|JGI24140J50213_10050466Not Available1477Open in IMG/M
3300003861|Ga0031654_10094296Not Available837Open in IMG/M
3300003987|Ga0055471_10246343Not Available566Open in IMG/M
3300004092|Ga0062389_102349679Not Available704Open in IMG/M
3300004479|Ga0062595_102424904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300005167|Ga0066672_10164039All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300005176|Ga0066679_10366287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria943Open in IMG/M
3300005332|Ga0066388_108042559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300005335|Ga0070666_11527519Not Available500Open in IMG/M
3300005455|Ga0070663_101850122Not Available542Open in IMG/M
3300005456|Ga0070678_101221198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia698Open in IMG/M
3300005456|Ga0070678_102109651Not Available534Open in IMG/M
3300005518|Ga0070699_101939676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300005569|Ga0066705_10207070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1230Open in IMG/M
3300005995|Ga0066790_10190185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium878Open in IMG/M
3300006046|Ga0066652_100903578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium842Open in IMG/M
3300006050|Ga0075028_100246027All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300006050|Ga0075028_100956821All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300006052|Ga0075029_100587600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia743Open in IMG/M
3300006052|Ga0075029_101312603Not Available508Open in IMG/M
3300006057|Ga0075026_100865664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces albidoflavus group → Streptomyces albidoflavus553Open in IMG/M
3300006059|Ga0075017_100621332Not Available827Open in IMG/M
3300006059|Ga0075017_101559691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300006102|Ga0075015_100143766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1236Open in IMG/M
3300006102|Ga0075015_100785603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Cellulosimicrobium → Cellulosimicrobium cellulans570Open in IMG/M
3300006173|Ga0070716_100941533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300006176|Ga0070765_101402186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300006196|Ga0075422_10603181Not Available508Open in IMG/M
3300006572|Ga0074051_10727822Not Available547Open in IMG/M
3300006795|Ga0075520_1008890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5068Open in IMG/M
3300009093|Ga0105240_12309253Not Available557Open in IMG/M
3300009094|Ga0111539_12570226Not Available590Open in IMG/M
3300009143|Ga0099792_10656148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300009148|Ga0105243_11831954Not Available638Open in IMG/M
3300009174|Ga0105241_11953988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300009176|Ga0105242_10022665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4943Open in IMG/M
3300009523|Ga0116221_1028327All Organisms → cellular organisms → Bacteria2812Open in IMG/M
3300009525|Ga0116220_10271367Not Available743Open in IMG/M
3300009686|Ga0123338_10387164All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300009839|Ga0116223_10356932Not Available865Open in IMG/M
3300009840|Ga0126313_11344740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae591Open in IMG/M
3300010379|Ga0136449_100193094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3890Open in IMG/M
3300010379|Ga0136449_101580050Not Available998Open in IMG/M
3300010880|Ga0126350_11052345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3896Open in IMG/M
3300012930|Ga0137407_10037178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3856Open in IMG/M
3300012930|Ga0137407_11896811Not Available568Open in IMG/M
3300012951|Ga0164300_10940971Not Available550Open in IMG/M
3300012958|Ga0164299_11458572Not Available532Open in IMG/M
3300012985|Ga0164308_12171082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300012987|Ga0164307_10366841Not Available1050Open in IMG/M
3300012988|Ga0164306_11763517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300013308|Ga0157375_11488651Not Available799Open in IMG/M
3300014058|Ga0120149_1239274Not Available509Open in IMG/M
3300014164|Ga0181532_10494756Not Available671Open in IMG/M
3300014201|Ga0181537_11163034Not Available521Open in IMG/M
3300014325|Ga0163163_11599296Not Available713Open in IMG/M
3300014325|Ga0163163_11658286All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300014489|Ga0182018_10042109Not Available2834Open in IMG/M
3300014498|Ga0182019_11370193Not Available524Open in IMG/M
3300014499|Ga0182012_10507831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria783Open in IMG/M
3300014502|Ga0182021_13419921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium528Open in IMG/M
3300014638|Ga0181536_10387605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300014745|Ga0157377_11289672Not Available570Open in IMG/M
3300014838|Ga0182030_11731898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300015374|Ga0132255_101765569All Organisms → cellular organisms → Bacteria → Terrabacteria group939Open in IMG/M
3300017924|Ga0187820_1060725All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300017948|Ga0187847_10089760Not Available1701Open in IMG/M
3300017995|Ga0187816_10488300Not Available554Open in IMG/M
3300018012|Ga0187810_10437702Not Available553Open in IMG/M
3300018034|Ga0187863_10816266Not Available529Open in IMG/M
3300018064|Ga0187773_10901228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium571Open in IMG/M
3300018090|Ga0187770_11582064Not Available534Open in IMG/M
3300018476|Ga0190274_12684968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae595Open in IMG/M
3300020213|Ga0163152_10474171Not Available576Open in IMG/M
3300021384|Ga0213876_10017121All Organisms → cellular organisms → Bacteria3827Open in IMG/M
3300021384|Ga0213876_10705238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300025505|Ga0207929_1102831Not Available533Open in IMG/M
3300025907|Ga0207645_11206700All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium508Open in IMG/M
3300025915|Ga0207693_11182799Not Available577Open in IMG/M
3300025937|Ga0207669_10742805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium810Open in IMG/M
3300025939|Ga0207665_11017645Not Available659Open in IMG/M
3300025961|Ga0207712_12129771Not Available502Open in IMG/M
3300027497|Ga0208199_1037138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1055Open in IMG/M
3300027826|Ga0209060_10346314Not Available677Open in IMG/M
3300027898|Ga0209067_10160760Not Available1195Open in IMG/M
3300027911|Ga0209698_10078531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens2804Open in IMG/M
3300027911|Ga0209698_11332508Not Available525Open in IMG/M
3300028563|Ga0265319_1261132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300028743|Ga0302262_10279810Not Available567Open in IMG/M
3300028780|Ga0302225_10379426Not Available665Open in IMG/M
3300028800|Ga0265338_10992611Not Available569Open in IMG/M
3300028882|Ga0302154_10105536Not Available1514Open in IMG/M
3300028906|Ga0308309_11340250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300029908|Ga0311341_10666991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300029914|Ga0311359_10211420All Organisms → cellular organisms → Bacteria1692Open in IMG/M
3300029920|Ga0302142_1084890Not Available983Open in IMG/M
3300029922|Ga0311363_10416872All Organisms → cellular organisms → Bacteria1417Open in IMG/M
3300029984|Ga0311332_10664969All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300029987|Ga0311334_10703257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium827Open in IMG/M
3300029988|Ga0302190_10165527Not Available933Open in IMG/M
3300029992|Ga0302276_10316828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces669Open in IMG/M
3300029994|Ga0302283_1206996All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300029998|Ga0302271_10531111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300030007|Ga0311338_10874140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300030010|Ga0302299_10168247Not Available1181Open in IMG/M
3300030010|Ga0302299_10471513Not Available634Open in IMG/M
3300030019|Ga0311348_10849705All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300030706|Ga0310039_10092195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1276Open in IMG/M
3300031184|Ga0307499_10196364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300031240|Ga0265320_10480157All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300031250|Ga0265331_10079354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1527Open in IMG/M
3300031344|Ga0265316_10929102Not Available607Open in IMG/M
3300031344|Ga0265316_11072799Not Available559Open in IMG/M
3300031455|Ga0307505_10646157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300031543|Ga0318516_10454789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia736Open in IMG/M
3300031572|Ga0318515_10347708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium795Open in IMG/M
3300031671|Ga0307372_10024445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales6923Open in IMG/M
3300031713|Ga0318496_10586203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300031722|Ga0311351_10893145Not Available679Open in IMG/M
3300031747|Ga0318502_10224846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1091Open in IMG/M
3300031751|Ga0318494_10706819All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300031794|Ga0318503_10211155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300031805|Ga0318497_10174380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1183Open in IMG/M
3300031805|Ga0318497_10368827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium802Open in IMG/M
3300031835|Ga0318517_10452454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300031890|Ga0306925_10599677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1163Open in IMG/M
3300031910|Ga0306923_12157150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha rutila560Open in IMG/M
3300031999|Ga0315274_11596887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300032044|Ga0318558_10490754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300032091|Ga0318577_10228308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium891Open in IMG/M
3300032118|Ga0315277_10549301All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300032126|Ga0307415_101423177Not Available661Open in IMG/M
3300032143|Ga0315292_10399812Not Available1153Open in IMG/M
3300032143|Ga0315292_11339229Not Available585Open in IMG/M
3300032156|Ga0315295_11166760Not Available757Open in IMG/M
3300032160|Ga0311301_10700946Not Available1423Open in IMG/M
3300032160|Ga0311301_11010520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1098Open in IMG/M
3300032160|Ga0311301_12349454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300032177|Ga0315276_10208278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2054Open in IMG/M
3300032397|Ga0315287_10361980All Organisms → cellular organisms → Bacteria1716Open in IMG/M
3300032770|Ga0335085_11068948All Organisms → cellular organisms → Bacteria → Terrabacteria group867Open in IMG/M
3300032893|Ga0335069_12028161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia606Open in IMG/M
3300033803|Ga0314862_0112681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300033818|Ga0334804_030287Not Available1743Open in IMG/M
3300034128|Ga0370490_0199342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium658Open in IMG/M
3300034195|Ga0370501_0371940Not Available521Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.28%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds7.95%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.62%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.30%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.64%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.65%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.99%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.99%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.99%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.99%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.32%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.32%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.32%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.32%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.32%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.32%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.32%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.32%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.32%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.32%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.32%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.32%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.66%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.66%
Glacier ValleyEnvironmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley0.66%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.66%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.66%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.66%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.66%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.66%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.66%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.66%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.66%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.66%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.66%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.66%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908007Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2EnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459013Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cmEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300003369Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22AEnvironmentalOpen in IMG/M
3300003861Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CREnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009686Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020213Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300025505Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028743Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029920Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029988Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3EnvironmentalOpen in IMG/M
3300029992Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3EnvironmentalOpen in IMG/M
3300029994Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4EnvironmentalOpen in IMG/M
3300029998Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031671Soil microbial communities from Risofladan, Vaasa, Finland - OX-1EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FWIRElOz_083407702124908007SoilMANLAVKVADLDAACAFYEAAGAEVRDRMEWNNGERAD
E41_107785502170459005Grass SoilMAITGMANMGSKGRRLDAACAFYEGAGAEVRDRMHWNNG
N57_042690302170459013Grass SoilMANLAVKVADLDAACAYYERAGADVRDRMHWGNGERAD
JGI12053J15887_1047330833300001661Forest SoilMSVREDSSVTVIGMANLAVKVADLDAAIAFYERAGAEVHNRMSWAGSERADVGFGALQLT
JGI26341J46601_1004446833300003219Bog Forest SoilMSVTGLANLAVKVADLDAAIAFYEGAGAVVRDRMVWGGGE
JGI24140J50213_1005046623300003369Arctic Peat SoilVVVTGLANLAVKVADLDAACRFYEAAGAQIRDRQHWRNSERADVYL
Ga0031654_1009429613300003861Freshwater Lake SedimentMPVTGVANLAVKVTDLDAAVAYYEAAGASVTDRMVWYGAERADVTLGP
Ga0055471_1024634323300003987Natural And Restored WetlandsVAVVGLANLALNVSDLDGACSFYRAAGAEIRDRMHWNGGERADVFLGPVM
Ga0062389_10234967913300004092Bog Forest SoilMANLALKVADLDAACAFYERAGATVRDRMVWRDGERADVFL
Ga0062595_10242490423300004479SoilMANLAVKVADLDAACAFYVAAGAEVRDRAQWNNGERADVFLGPVMITL
Ga0066672_1016403913300005167SoilMTVTGIANLAVKVSDMDAAVAFYERAGGIVRDRMTWNGIERADVHLGPIQI
Ga0066679_1036628713300005176SoilVRRHYPSGVAITGMANLAVKVADLDAACAFYVAAGADVRDRMQWNNGERAD
Ga0066388_10804255923300005332Tropical Forest SoilMAITGMANLAVKVSDLDAACSFYERAGAEVRDRMMWGNGERADVYLGP
Ga0070666_1152751923300005335Switchgrass RhizosphereVAITGMANLAIKVADLDAACAHYERAGADVRDRMSWHGGE
Ga0070663_10185012213300005455Corn RhizosphereVTVTGMANLAVKVTDLDAACDFYRAAGGDVRDRMEWGGGERADV
Ga0070678_10122119823300005456Miscanthus RhizosphereMSVTGMANLAVKVADLDAACAFYQRAGAEVRDRMEWNGAE
Ga0070678_10210965113300005456Miscanthus RhizosphereMAVTGMANLAVKVADLDAAVEFYERAGADVRDRMMWNGSERADVYLGP
Ga0070699_10193967613300005518Corn, Switchgrass And Miscanthus RhizosphereVPVTGLANLAVKVADIDAACAFYEAAGAEVRDRMTWNNGERA
Ga0066705_1020707013300005569SoilMANLAVKVVDLDAACAFYVAAGAEVRDRAQWNNGERADVFLGPVMITLF
Ga0066790_1019018523300005995SoilMTVTGLGNLAVKVGDLDAAIQFYEGAGATLGDRGPWHGGERA
Ga0066652_10090357823300006046SoilMAVTGMANLAVKVANMDEAVAFYERAGAVVRDRMMWNGSERADVF
Ga0075028_10024602713300006050WatershedsMANLAVKVTNLDEACAFYEGLGAEVRDRMHWNNSERADVY
Ga0075028_10095682113300006050WatershedsVSVTGLANLAVKVADLDDACRFYKAAGAEIRDRMTWGNGERADVFLGP
Ga0075029_10058760023300006052WatershedsVGVTGLANLAVKVADLDEACAFYERAGFDVRDRMQ
Ga0075029_10131260313300006052WatershedsVAVVGLANLAVKVADLDAACRYYAAAGGDSRDRMAWRNGERADV
Ga0075026_10086566413300006057WatershedsMANLAVKVADLDDACAFYEHAGAEVRDRMHWNGGERADVFLGPVMI
Ga0075017_10062133233300006059WatershedsMANIAVKVADLDAACQFYSAAGAEVRDRMEWNNGERADVFLGPVMITLFT
Ga0075017_10155969123300006059WatershedsVGVTGLANLAVKVADLDAACTFYESAGAQVRDRMEWAGG
Ga0075015_10014376613300006102WatershedsVTVTGVANLAVKVADLDAAIAYYERAGASVADRIEWNGAER
Ga0075015_10078560313300006102WatershedsMAITGMANLAVKVADLDAACAFYAAAGADVRDRMRWNDAE
Ga0070716_10094153313300006173Corn, Switchgrass And Miscanthus RhizosphereMANLAVKVADLDAACAFYEAAGAEVRDRMHWNNGERADVFLGPVMI
Ga0070765_10140218623300006176SoilVAVTGMANLAIKVSDLDAAVSFYEGAGAEVRDRMHWNNGERADVFLGPIMIT
Ga0075422_1060318123300006196Populus RhizosphereVAVTGLANLAIKVADLDAACAFYDAAGAEVRDRMAWE
Ga0074051_1072782223300006572SoilVAVTGMANLAVKVADLDAACRFYAAAGGDVRDRMHWGNGERADEFLGPVMI
Ga0075520_100889063300006795Arctic Peat SoilVGVTGLANLAVKVADLDGAVAFYLAAGAEVRDRMEWAGGERVDV*
Ga0105240_1230925313300009093Corn RhizosphereMANLAVKVADLDAAVEFYERAGAEVRDRMTWNGSERADVY
Ga0111539_1257022623300009094Populus RhizosphereVAVAVTGMANLAVKVSDLDAAIAFYERGGFEVRDRMQWR
Ga0099792_1065614823300009143Vadose Zone SoilMANLAVKVADLDAACAFYVAAGADVRDRMQWNNGERADVFLGPVVITLF
Ga0105243_1183195413300009148Miscanthus RhizosphereMANLAIKVADLDAACAYYERAGADVRDRMPWHGGERA
Ga0105241_1195398823300009174Corn RhizosphereMAITGMANLAVKVVDLDAACAFYIAAGAEVRDRMRWNNGER
Ga0105242_1002266513300009176Miscanthus RhizosphereMAITGLANLAIKVADLDAACAFYEAAGAEVRDRVHWNNG
Ga0116221_102832753300009523Peatlands SoilMANLAVKVADLDAAVSFYEAAGAEVRDRMHWNNGERADVFLGPVMIT
Ga0116220_1027136723300009525Peatlands SoilVSVTGLANLAVKVADLDAAVAFYESAGAEVRDRMPWHGGERADV
Ga0123338_1038716413300009686Glacier ValleyMTVTGMANLAVKVSDLDTAIAFYERSGAIVRDRMV
Ga0116223_1035693223300009839Peatlands SoilLAVTGIANLAVKVADLDAACAFYEEVGAQVRERMHWNNGERADVYLG
Ga0126313_1134474013300009840Serpentine SoilMANLAVKVADLDAACAYYERAGAEVRDRIEWNGAERA
Ga0136449_10019309473300010379Peatlands SoilVAITGLANIAVKVADLDAACTFYSDAGAEIRDRVHWGNGERADVFLGP
Ga0136449_10158005013300010379Peatlands SoilVGAVAVVGLANLAVKVADLDAACRFYLEAGAEVRDRMVWRNGER
Ga0126350_1105234513300010880Boreal Forest SoilVSVTGLANLAVKVTDLDDACRFYEEAGAEVRDRMEWGNGERADVF
Ga0137407_1003717853300012930Vadose Zone SoilMANLAIKVADLDAACAFYEAAGAQVRDRMHWNNGERADVFL
Ga0137407_1189681123300012930Vadose Zone SoilVPVTGLANLAVKVADLDGACAFYEAAGAEVRDRMTWNNGERADV
Ga0164300_1094097123300012951SoilMANLAVKVADLDRACAFYEVAGAEVRDRMLWNNGE
Ga0164299_1145857223300012958SoilMANLAVKVADLDAAVEFYERAGAEVRDRMTWNGSERADVYLGPVMIT
Ga0164308_1217108213300012985SoilMANLAVKVSDLDAACAFYEGAGATVRDRMQWNGGERAD
Ga0164307_1036684123300012987SoilMSVTGMANLAVKVADLDAACAYYEQAGAEIRDRMEWNGAERA
Ga0164306_1176351723300012988SoilVAVTGMANLAVKVADLDAACAFYERAGATVRDRMVWNGGERADVHLGPVMITLF
Ga0157375_1148865113300013308Miscanthus RhizosphereVAITGMANLAIKVADLDAACAYYERAGADVRDRMSWHGGERAD
Ga0120149_123927433300014058PermafrostMAITGMANLAVKVADLDAACAFYLAAGAQVRDRMVWN
Ga0181532_1049475623300014164BogMMTVTGLANLAVKVADIDEACAFYTAAGADVRDRMMWRNG
Ga0181537_1116303413300014201BogVSVTGLANLAVKVADLDEACRFYEEAGAEVRDRMVWGNGERADVFLGPVMLTL
Ga0163163_1159929613300014325Switchgrass RhizosphereMANLAIKVADLDAACAYYERAGFEVRDRMEWNGAERAD
Ga0163163_1165828613300014325Switchgrass RhizosphereMANLAVKVADLDAACAFYRAAGGEVRDRMVWGGGERADVFLGPVMITLF
Ga0182018_1004210943300014489PalsaVTVTGLANLAVKVGDLDAALAFYEAAGAEVHDRMPWHGGERADVFLGPVMI
Ga0182019_1137019313300014498FenVGVTGLANLAVKVADLDGAVDFYLAAGAEVRDRMAWAG
Ga0182012_1050783123300014499BogMAVTGLANLAIKVADLDEACAFYTRAGAGVRDRMHWRN
Ga0182021_1341992123300014502FenMTVTGVANLAVKVADLDHAMAFYRRAGAEVRDRGPWCGGE
Ga0181536_1038760523300014638BogMAVTGIANLAIKVADLDEACAYYVRAGAQVRDRMHWRNGERA
Ga0157377_1128967223300014745Miscanthus RhizosphereMANLAVKVADLDAACAYYERAGGDVRDRMHWGNGERADVYL
Ga0182030_1173189813300014838BogVAVTGLANLAVKVEDLDAACRFYADAGADVRDRMRWRNG
Ga0132255_10176556913300015374Arabidopsis RhizosphereMANLAVKVADLNAACAFYAAAGAEIRDRMAWNGAE
Ga0187820_106072523300017924Freshwater SedimentMAVTGMANLAVKVKDLDAAVAFYEAMGAQVRDRMEWNGTERADVF
Ga0187847_1008976023300017948PeatlandMTVTGMANLAVKVSDLDAAVDFYQKAGAEVRDRMAWHGGERA
Ga0187816_1048830013300017995Freshwater SedimentLANLAVKVSDLDAACTFYASAGAEVRDRMEWDGGERA
Ga0187810_1043770223300018012Freshwater SedimentVTVLSLANLAVKVADLDAACAFYEAAGGVVSNRIVWHGAERADVQLG
Ga0187863_1081626613300018034PeatlandMTVTGMANLAVKVSDLDAALSFYEGSGAEIRDRMPWHGGERADVYLGS
Ga0187773_1090122813300018064Tropical PeatlandVAVTGMANIAVKVADLDAACAFYEAAGAEIRNRMTWNGSERADVHLG
Ga0187770_1158206413300018090Tropical PeatlandVTVTGMANLAVKVADLDAACAYYEAAGAVVRDRMHWAGAERA
Ga0190274_1268496823300018476SoilMANLAVKVADLDAACAYYERAGAEIRDRMEWNGSERADVFLGPVQITL
Ga0163152_1047417123300020213Freshwater Microbial MatVAVTGMANMAVKVADLDAACAFYSAAGAEIRDRMMWNNGERADVFL
Ga0213876_1001712113300021384Plant RootsMITGMANLAVKVDDVDRAVAWYTERGFEVRDRMTWNGIERADVFLG
Ga0213876_1070523823300021384Plant RootsVAVTGLANLAVKVADLDAACAFYEAAGADVRDRMHWNNGERADVYLG
Ga0207929_110283123300025505Arctic Peat SoilMAITGMANLAVKVADLDAACAFYVAAGAQVRDRMVWNNGERA
Ga0207645_1120670013300025907Miscanthus RhizosphereMAITGMANLAVKVVDLDAACAFYIAAGAEVRDRMRWNNGE
Ga0207693_1118279923300025915Corn, Switchgrass And Miscanthus RhizosphereVPVTGLANLAVKVSDLDSACAFYEASGAEVRDRMTWNNGERADVYL
Ga0207669_1074280523300025937Miscanthus RhizosphereVTVTGMANMAVKVADLDAACAFYAAAGGEVRDRMEWNNGERADVYL
Ga0207665_1101764513300025939Corn, Switchgrass And Miscanthus RhizosphereMANLAVKVADLDAACAFYEAAGAEVRDRMHWNNGERADVFLGPVMIT
Ga0207712_1212977113300025961Switchgrass RhizosphereVTVTGMANLAVKVADLDAACDFYRAAGGDVRDRMAWG
Ga0208199_103713823300027497Peatlands SoilVAVTGMANLAVKVADLDAAVSFYEAAGAEVRDRMHWN
Ga0209060_1034631413300027826Surface SoilVTVTGLANLAVKVSDLSAAVAFYERAGAEVRDRMAWEGAERADV
Ga0209067_1016076013300027898WatershedsMAVTGLANLAVKVADLDAACAFYDAAGARIRDRMTWRNGERADVHLGPV
Ga0209698_1007853113300027911WatershedsMAVTALANLAVKVADLDAACAFYDAAGARIRDRMTWRNGERADVHLGPV
Ga0209698_1133250823300027911WatershedsVAVVGLANLAVKVADLDAACRYYTAGGADVRDRMVWRNGE
Ga0265319_126113223300028563RhizosphereMANLAVKVADLDAACAFYEAAGAEVRDRMLWNNGERADVFLG
Ga0302262_1027981013300028743FenMAVTGMANLAVKVADLDAAVAFYERAGAEVWDRMEWNGAERADVYLGPV
Ga0302225_1037942623300028780PalsaVAVVGLANLAVKVADLDAACAFYLRAGADVRDRMG
Ga0265338_1099261113300028800RhizosphereMANLAIKVADLDAACAFYEAAGAQVRDRMHWNNGERADVFLGPVMITLFTH
Ga0302154_1010553633300028882BogVAVVGMANLAVKVTDLDTACAFYESAGAEVRDRMHWNNGE
Ga0308309_1134025013300028906SoilMTVTGLANLAVKVKDLDAACRFYEASGATVRDRMLWRDGERAD
Ga0311341_1066699123300029908BogVAVTGLANLAVKVADLDAACRFYEAAGAEVRDRMEWRNGERADVFLGPVMIT
Ga0311359_1021142013300029914BogVGVTGLANLAVKVADLDGAVAFYLAAGAEVRDRMEWAGGERADV
Ga0302142_108489013300029920BogVGVTGLANLAVKVADLDGAVAFYLAAGAEVRDRMEWAGGERADVYLGPVMITLF
Ga0311363_1041687233300029922FenVSVTGLANLAVKVADLDEACRFYEEAGAEVRDRMVWGNGERADVFL
Ga0311332_1066496923300029984FenVTITGLANLAVKVADLDAACAFYERAGGEVHDRMLWRDGERAD
Ga0311334_1070325713300029987FenMTVTGMANLAIKVSDLDSAVAFYEHAGATISNRIMWNGSERADV
Ga0302190_1016552713300029988BogVGVTGLANLAVKVADLDGAVAFYRGAGAEVRDRMAWAGGERADVY
Ga0302276_1031682823300029992BogVSVTGLANLAVKVADLDSAVLFYESSGAEVRDRMVWRGGERADVYLGPVMIT
Ga0302283_120699613300029994FenVSVTGLANLAVKVADLDEACRFYEGAGAEVRDRMVWGNGERADVFL
Ga0302271_1053111123300029998BogVTVTGLANLAVKVADLDEACAFYEGAGAVVSHRMAWGG
Ga0311338_1087414013300030007PalsaVPVTGLANLAVKVKDLDDACRFYEGAGATVRDRMLWRDGERADVYLG
Ga0302299_1016824713300030010FenMTVTAVANLAVKVADLDAAISFYELAGAEVRDRLPWCGGERA
Ga0302299_1047151323300030010FenMTVTGMANLAIKVADLDAACAFYDAMGGAVRDRMTWNGGERADVFLGP
Ga0311348_1084970523300030019FenVTITGLANLAVKVADLDAACAFYERAGGEVHDRML
Ga0310039_1009219533300030706Peatlands SoilLAVTGIANLAVKVADLDAACAFYEEVGAQVRERMHWNNGERADVY
Ga0307499_1019636423300031184SoilVAVTGMANLAVKVVDLDAACAFYEHAGAEVRDRMHWGNG
Ga0265320_1048015713300031240RhizosphereMGVTGMANLAVKVADLDAACAYYERAGAEVRDRMEWNGAE
Ga0265331_1007935413300031250RhizosphereMAVTGMANMAVKVADLDAACAFYEAAGAEVRDRMLWNNGERAD
Ga0265316_1092910213300031344RhizosphereMANLAVKVADLDAACAFYEAAGAEVRDRMHWNNGERADVFLGPVMITLFTH
Ga0265316_1107279923300031344RhizosphereMAITGMANLAVKVADLDAACAFYVRAGAEVRDRMHWNNGERADVFLGPVM
Ga0307505_1064615723300031455SoilMTVTGLANLAVKVVDLDAALAFYEAAGAVVGDRMEWQGAERAEVRL
Ga0318516_1045478913300031543SoilMANLAVKVVDLDAACEYYERAGAEVRDRIEWNGTE
Ga0318515_1034770823300031572SoilMTVTGLANLAVKVADLDAACAFYADAGGEVRDRMVWNNGERADVRLGPVVIT
Ga0307372_1002444513300031671SoilVSVTGLANLAVKVADLDEACHFYEAAGADVRDRMVWGNG
Ga0318496_1058620323300031713SoilMTVTGLANLAVKVADLDAACAFYAAAGGEVHDRMVWNN
Ga0311351_1089314523300031722FenMTVTGMANLAVKVADLDAAVAFYEQAGAEVRDRMEWNGAERADVYLGPVMITL
Ga0318502_1022484613300031747SoilVTVTGMANLALKVRDLDESLRYFERLGASVRDRMM
Ga0318494_1070681913300031751SoilMANLAVKVVDLDAACEYYERAGAEVRDRIEWNGTERADVLL
Ga0318503_1021115523300031794SoilMTVTGLANLAVKVADLDAACAFYAAAGGEVRDRMVWNN
Ga0318497_1017438013300031805SoilMTVTGLANLAVKVADLDAACAFYAAAGGEVRDRMVWNNG
Ga0318497_1036882723300031805SoilVTGLANLAVKVADLDRACEFYESAGAAVRDRMEWGGGERADVYLGPVMIT
Ga0318517_1045245423300031835SoilVTVTGLANLAVKVSDLDAACGFYEAAGGEIRDRIEWNGAERADVV
Ga0306925_1059967733300031890SoilVTVTGMANLALKVRDLDESLRYFERLGASVRDRMMWAGGERADVYLGPVM
Ga0306923_1215715013300031910SoilVTVTGLANLAVKVSDLDAACGFYEAAGGEIRDRIEWNGAERADVVMGPLVIT
Ga0315274_1159688713300031999SedimentVAVTGLANLAVKVADLDAACAFYTAAGAEVCDRMH
Ga0318558_1049075413300032044SoilMTVTGLANLAVKVADLDAACAFYADAGGEIHDRMVWNNGERADVRL
Ga0318577_1022830823300032091SoilMTVTGLANLAVKVADLDAACAFYAAAGGEVHDRMVWNNGERAD
Ga0315277_1054930113300032118SedimentVAVTGMANLAVKVADLDAACAFYTAAGAEVRDRMHWNNGERADVFLGPVMI
Ga0307415_10142317723300032126RhizosphereVAVIGMANLAVKVADLDAACRFYERAGATVRDRIEWNGGERADVL
Ga0315292_1039981223300032143SedimentMAVTGMANFAVKVADLDEACAFYAAAGGEVRDRMQWNNGERADVYLG
Ga0315292_1133922913300032143SedimentMAVTGMANLAVKVVDLDAAIAFYERAGADVRDRMEWNGGDRADVFLGPVMI
Ga0315295_1116676013300032156SedimentVAVSGLANLAVKVADLDAACAFYTAAGAEVRDRMHWN
Ga0311301_1070094613300032160Peatlands SoilVAIIGMANLAIKVRDLDRACSFYAALGAQVRDRMVWNGLERADVFLGPLM
Ga0311301_1101052033300032160Peatlands SoilVAVTGMANLAIKVVDLDESLAFYERLGASVRDRMPWAGGERADV
Ga0311301_1234945423300032160Peatlands SoilVAITGLANIAVKVADLDAACTFYSDAGAEIRDRVHWGNGERADVFLGPVMIPLFT
Ga0315276_1020827843300032177SedimentVAVTGLANLAVKVADLDAACAFYTAAGAEVRDRMHWNNGE
Ga0315287_1036198013300032397SedimentVAVTGMANLAVKVADLDAACAFYTAAGAEVRDRMHWNHGERADVFLG
Ga0335085_1106894833300032770SoilMANLAVKVADLDAACAFYERAGAEVRDRIEWNGSERADVLLGPLQ
Ga0335069_1202816113300032893SoilMAVTGLSNLAVKVADLDEACAVYRSFGGQMRDRMPWAGGERVDVFLGP
Ga0314862_0112681_493_6363300033803PeatlandMTVTGLANLAVKVADLDAACAFYEDAGGVVRDRMVWHNGERADVRLGP
Ga0334804_030287_3_1493300033818SoilVTGLANLAVKVADLDEAVEFYEASGAEVRDRMRWRNGERADVYLGPVMI
Ga0370490_0199342_3_1433300034128Untreated Peat SoilMAVTGVANLAVKVPDLDPAIEFYERAGAEVRDRAPWFGGERVDVYLG
Ga0370501_0371940_370_5193300034195Untreated Peat SoilMTVTGMANLAIKVSDLDSAVAFYERAGATISNRIMWNGSERADVQLGTLA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.