NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F046560

Metagenome Family F046560

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046560
Family Type Metagenome
Number of Sequences 151
Average Sequence Length 46 residues
Representative Sequence MWFQLRSPELAEDFERLMAEDRDIVRGSLDTVSDWRLTRPADVP
Number of Associated Samples 134
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 8.82 %
% of genes near scaffold ends (potentially truncated) 88.74 %
% of genes from short scaffolds (< 2000 bps) 86.09 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.563 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.894 % of family members)
Environment Ontology (ENVO) Unclassified
(29.801 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.020 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.28%    β-sheet: 0.00%    Coil/Unstructured: 59.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF12697Abhydrolase_6 5.96
PF06055ExoD 3.97
PF00293NUDIX 3.31
PF12680SnoaL_2 2.65
PF01243Putative_PNPOx 1.99
PF13460NAD_binding_10 1.99
PF00989PAS 1.32
PF00196GerE 1.32
PF03401TctC 0.66
PF13191AAA_16 0.66
PF00891Methyltransf_2 0.66
PF02627CMD 0.66
PF00583Acetyltransf_1 0.66
PF11158DUF2938 0.66
PF00353HemolysinCabind 0.66
PF00107ADH_zinc_N 0.66
PF00383dCMP_cyt_deam_1 0.66
PF12902Ferritin-like 0.66
PF00578AhpC-TSA 0.66
PF00027cNMP_binding 0.66
PF07992Pyr_redox_2 0.66
PF00486Trans_reg_C 0.66
PF00561Abhydrolase_1 0.66
PF01435Peptidase_M48 0.66
PF13714PEP_mutase 0.66
PF01740STAS 0.66
PF13420Acetyltransf_4 0.66
PF05974DUF892 0.66
PF02782FGGY_C 0.66
PF00248Aldo_ket_red 0.66
PF01638HxlR 0.66
PF01027Bax1-I 0.66
PF08002DUF1697 0.66
PF07676PD40 0.66
PF12681Glyoxalase_2 0.66
PF03704BTAD 0.66
PF01872RibD_C 0.66
PF13487HD_5 0.66
PF08241Methyltransf_11 0.66
PF09851SHOCT 0.66
PF07690MFS_1 0.66
PF02823ATP-synt_DE_N 0.66
PF10604Polyketide_cyc2 0.66
PF14528LAGLIDADG_3 0.66
PF00326Peptidase_S9 0.66
PF06772LtrA 0.66
PF01791DeoC 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG3932Exopolysaccharide synthesis protein ExoDCell wall/membrane/envelope biogenesis [M] 3.97
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.66
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 0.66
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.66
COG0355FoF1-type ATP synthase, epsilon subunitEnergy production and conversion [C] 0.66
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.66
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.66
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.66
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.66
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.66
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.66
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 0.66
COG3797Uncharacterized conserved protein, DUF1697 familyFunction unknown [S] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.56 %
UnclassifiedrootN/A34.44 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573003|GZIR7W401C3836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101322548Not Available779Open in IMG/M
3300000955|JGI1027J12803_101795723Not Available783Open in IMG/M
3300000955|JGI1027J12803_106216490Not Available607Open in IMG/M
3300001686|C688J18823_10629802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300002568|C688J35102_119731688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300002568|C688J35102_120407981Not Available1046Open in IMG/M
3300002568|C688J35102_120855321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1839Open in IMG/M
3300003987|Ga0055471_10109574All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300004157|Ga0062590_101432303All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300004643|Ga0062591_100839481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium853Open in IMG/M
3300005093|Ga0062594_103396301Not Available501Open in IMG/M
3300005179|Ga0066684_10477198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium838Open in IMG/M
3300005187|Ga0066675_10057845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae2417Open in IMG/M
3300005327|Ga0070658_10634084Not Available927Open in IMG/M
3300005337|Ga0070682_100839149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium750Open in IMG/M
3300005347|Ga0070668_100214996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1583Open in IMG/M
3300005355|Ga0070671_102028251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300005366|Ga0070659_100607240Not Available940Open in IMG/M
3300005366|Ga0070659_101260737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia655Open in IMG/M
3300005435|Ga0070714_102313078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes lobatus523Open in IMG/M
3300005447|Ga0066689_10903652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300005466|Ga0070685_10810685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300005560|Ga0066670_10224166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1135Open in IMG/M
3300005560|Ga0066670_10241052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli1095Open in IMG/M
3300005560|Ga0066670_10439266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales804Open in IMG/M
3300005568|Ga0066703_10664599Not Available602Open in IMG/M
3300005616|Ga0068852_100126629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2346Open in IMG/M
3300005718|Ga0068866_11282741Not Available532Open in IMG/M
3300005719|Ga0068861_100295069All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300005840|Ga0068870_10756435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300005844|Ga0068862_100340063All Organisms → cellular organisms → Bacteria1390Open in IMG/M
3300005937|Ga0081455_10233762Not Available1355Open in IMG/M
3300006173|Ga0070716_101129647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300006800|Ga0066660_10535014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli984Open in IMG/M
3300006806|Ga0079220_11742601All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300006847|Ga0075431_101837990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300006871|Ga0075434_100514831All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300006894|Ga0079215_10174108Not Available1058Open in IMG/M
3300006969|Ga0075419_10372952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces974Open in IMG/M
3300006969|Ga0075419_11310032Not Available538Open in IMG/M
3300009094|Ga0111539_11279332All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300009100|Ga0075418_12036411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes polyasparticus625Open in IMG/M
3300009148|Ga0105243_12012171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300009156|Ga0111538_11496225All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300009156|Ga0111538_11919113Not Available745Open in IMG/M
3300009156|Ga0111538_12903196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300009162|Ga0075423_10109784Not Available2888Open in IMG/M
3300009176|Ga0105242_11717201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300009176|Ga0105242_12856853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_3_64_12533Open in IMG/M
3300009545|Ga0105237_10189192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli2059Open in IMG/M
3300009551|Ga0105238_11401021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium726Open in IMG/M
3300009789|Ga0126307_11711207All Organisms → cellular organisms → Bacteria → Terrabacteria group511Open in IMG/M
3300009815|Ga0105070_1115657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300009840|Ga0126313_10691488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium826Open in IMG/M
3300010037|Ga0126304_11009812All Organisms → cellular organisms → Bacteria → Terrabacteria group567Open in IMG/M
3300010038|Ga0126315_10272869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1037Open in IMG/M
3300010038|Ga0126315_10487974All Organisms → cellular organisms → Bacteria → Terrabacteria group784Open in IMG/M
3300010038|Ga0126315_10984937Not Available564Open in IMG/M
3300010040|Ga0126308_11380888Not Available500Open in IMG/M
3300010042|Ga0126314_10441128All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300010044|Ga0126310_10901650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium689Open in IMG/M
3300010166|Ga0126306_11540702All Organisms → cellular organisms → Bacteria → Terrabacteria group552Open in IMG/M
3300010373|Ga0134128_10147847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2656Open in IMG/M
3300010375|Ga0105239_11236786All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300010379|Ga0136449_103808797Not Available567Open in IMG/M
3300010396|Ga0134126_11081294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300010403|Ga0134123_13303966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales520Open in IMG/M
3300012198|Ga0137364_11399183Not Available518Open in IMG/M
3300012212|Ga0150985_112899323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium755Open in IMG/M
3300012907|Ga0157283_10088580Not Available804Open in IMG/M
3300012924|Ga0137413_11464326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia554Open in IMG/M
3300012955|Ga0164298_10938254All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales633Open in IMG/M
3300012957|Ga0164303_11145048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300012988|Ga0164306_10958924All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300013105|Ga0157369_10952841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria879Open in IMG/M
3300013306|Ga0163162_12444831Not Available601Open in IMG/M
3300013307|Ga0157372_11136594Not Available903Open in IMG/M
3300013308|Ga0157375_10400376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1539Open in IMG/M
3300016319|Ga0182033_11858072Not Available547Open in IMG/M
3300017792|Ga0163161_10789842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria797Open in IMG/M
3300017965|Ga0190266_10423209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia748Open in IMG/M
3300017973|Ga0187780_11159483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300018061|Ga0184619_10044291All Organisms → cellular organisms → Bacteria1921Open in IMG/M
3300018089|Ga0187774_10673567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli681Open in IMG/M
3300018422|Ga0190265_10922222All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300018433|Ga0066667_11335242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300018468|Ga0066662_12687948All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300018469|Ga0190270_12113604All Organisms → cellular organisms → Bacteria → Terrabacteria group622Open in IMG/M
3300018482|Ga0066669_10344482Not Available1234Open in IMG/M
3300019361|Ga0173482_10192512Not Available829Open in IMG/M
3300021362|Ga0213882_10196637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300024288|Ga0179589_10129294All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300025908|Ga0207643_10612257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300025915|Ga0207693_10228188All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300025919|Ga0207657_11020557Not Available634Open in IMG/M
3300025920|Ga0207649_10654943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia812Open in IMG/M
3300025923|Ga0207681_10675269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria858Open in IMG/M
3300025924|Ga0207694_11168243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300025932|Ga0207690_10870467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria746Open in IMG/M
3300025932|Ga0207690_11045942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium680Open in IMG/M
3300025933|Ga0207706_11383425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300025938|Ga0207704_10404406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1078Open in IMG/M
3300025939|Ga0207665_11316574Not Available576Open in IMG/M
3300025942|Ga0207689_10326132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1274Open in IMG/M
3300025972|Ga0207668_10993645Not Available750Open in IMG/M
3300025981|Ga0207640_11037777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300026041|Ga0207639_11176958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria719Open in IMG/M
3300027616|Ga0209106_1067752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium800Open in IMG/M
3300027616|Ga0209106_1093450All Organisms → cellular organisms → Bacteria → Proteobacteria675Open in IMG/M
3300027669|Ga0208981_1108958All Organisms → cellular organisms → Bacteria → Terrabacteria group707Open in IMG/M
3300028380|Ga0268265_11851391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300028592|Ga0247822_10817239Not Available760Open in IMG/M
3300028592|Ga0247822_11756834Not Available529Open in IMG/M
3300028705|Ga0307276_10177967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300028719|Ga0307301_10046238All Organisms → cellular organisms → Bacteria1333Open in IMG/M
3300028755|Ga0307316_10337953Not Available553Open in IMG/M
3300028771|Ga0307320_10458260All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300028784|Ga0307282_10423036All Organisms → cellular organisms → Bacteria → Terrabacteria group646Open in IMG/M
3300028791|Ga0307290_10069158All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300028809|Ga0247824_10411342Not Available783Open in IMG/M
3300028819|Ga0307296_10786640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300028824|Ga0307310_10455082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300028876|Ga0307286_10101966Not Available1008Open in IMG/M
3300028881|Ga0307277_10315130Not Available695Open in IMG/M
3300030336|Ga0247826_10005132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4674Open in IMG/M
3300031771|Ga0318546_10909895Not Available619Open in IMG/M
3300031854|Ga0310904_10793340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300031903|Ga0307407_10236768Not Available1243Open in IMG/M
3300031912|Ga0306921_11002476Not Available942Open in IMG/M
3300031995|Ga0307409_102480311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300031996|Ga0308176_10795576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales988Open in IMG/M
3300031996|Ga0308176_11612100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300032074|Ga0308173_10259580All Organisms → cellular organisms → Bacteria1476Open in IMG/M
3300032090|Ga0318518_10547297Not Available592Open in IMG/M
3300033550|Ga0247829_11165481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.28%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil6.62%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere5.30%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.31%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.99%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.32%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.32%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.32%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.66%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.66%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.66%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.66%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.66%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.66%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.66%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.66%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.66%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.66%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573003Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027669Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FE2_028220202189573003Grass SoilMWFQLRSPDLAEDFERLMTDDRDIVRGSLDTVSDWRLTRPADVPGQ
INPhiseqgaiiFebDRAFT_10132254823300000364SoilMWFSLRSPELGEEFERLMTSDRDIVSSSLXTMSXXRXTRPTDVPGQ
JGI1027J12803_10179572323300000955SoilMWFQLRSPELAEDFERLMTGDRDIVRGSLDTVSDWR
JGI1027J12803_10621649013300000955SoilMSPPATLVMWFQLRSPELAEDFERLMTEDRDIVGGSLDTVSDWRLTRPADVP
C688J18823_1062980213300001686SoilMIPPATLLMWFLLRSPELAEDFERLMTEDRDIVRGSLDTVSDYRLTRPADVPGQS
C688J35102_11973168823300002568SoilMWFLLRSPELAEDFERLMREDRDIVRGSLDTVSDYRLTRPADVPGQS
C688J35102_12040798123300002568SoilMWFLLRSPELADDFERLMTEDRDIVRGSLDTVSDYRLTRPAD
C688J35102_12085532133300002568SoilMMPPATLLMWFLLRSPALAEDFERLMTEDRDIVRGSLDTVSDYRLTRPADVPGQSI
Ga0055471_1010957413300003987Natural And Restored WetlandsMWFQLRSPELAQDFERLMTEDRDIVRGSLDTVGDWRLARPADVPGQS
Ga0063454_10186643923300004081SoilMMPPATLLMWFLLRSPALAEDFERLMTEDRDIVRGSLDTVSDYR
Ga0062590_10143230323300004157SoilMAQATLVMWFSLRSPELADDFERLMASDRDIVSSSLDTMSDYRLTRPMDVPGQAG
Ga0062591_10083948113300004643SoilMAAAATLIMWFSLRSPELAEDFERLMASDRDIVRGSLDTMSDWRLTRPMDVPGQ
Ga0062594_10339630113300005093SoilMWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPADVPGQSIGQA
Ga0066684_1047719823300005179SoilMSSPATLLMWFQLRSPELAEDFERLMAGDRDIVRGSLDTVSDWRLTRPADVPGQA
Ga0066675_1005784513300005187SoilMWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVPGQ
Ga0070658_1063408413300005327Corn RhizosphereMSPPATLVMWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTR
Ga0070682_10083914913300005337Corn RhizosphereMWFLLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVPGQSIG
Ga0070691_1062210723300005341Corn, Switchgrass And Miscanthus RhizosphereVTAGHATLLMWFSLRSPELAEDFERLMASDRDIVFGSLDTMRDYRL
Ga0070692_1046488123300005345Corn, Switchgrass And Miscanthus RhizosphereMSPPATLVMWFQLRSPDLAKDFERLMTQDRDIVSGSLDTIS
Ga0070668_10021499613300005347Switchgrass RhizosphereMWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIG
Ga0070671_10202825113300005355Switchgrass RhizosphereMWFQLRSPELADDFERLMTGDRDIVRGSLDTVSEWRLTRPADVP
Ga0070673_10119585923300005364Switchgrass RhizosphereMSPPATLVMWFQLRSPELAKDFERLMADDRDVVSGSLDTMSDWR
Ga0070659_10060724013300005366Corn RhizosphereMSPPATLVMWFQLRSPDLAKDFERLMTQDRDIVSGSLDTISDWRLT
Ga0070659_10126073713300005366Corn RhizosphereMWFQLRSPDLAEDFERLMAEDRDIVRGSLDTISDWRLTRPADVPGQTM
Ga0070714_10231307823300005435Agricultural SoilMSPPATLLMWFQLRSPELAEDFERLMAGDRDIVRGSLDTVSDWRLTRP
Ga0070694_10008402553300005444Corn, Switchgrass And Miscanthus RhizosphereVTATQATLLMWFSLRSPELAEDFERLMASDRDIVFGSLDTMRDYRL
Ga0066689_1090365223300005447SoilMWFQLRSPELAEDFERLMAGDRDIVRGSLDTVSDWRLTRPADVPGQA
Ga0070685_1081068513300005466Switchgrass RhizosphereMSSPATLVMWFQLRSPDLAGEFEQLMAEDRDIVRGSLDTVSDWR
Ga0070696_10065678313300005546Corn, Switchgrass And Miscanthus RhizosphereVTAAHATLLMWFSLRSPELAEDFERLMASDRDIVFGSLDTMRDYRL
Ga0066670_1022416633300005560SoilMWFQLRSPELAEDFERLMAEDRDIVRGSLDTVSDWRLTRPAD
Ga0066670_1024105233300005560SoilMWFQLRSPELAEDFERLMTGDRDIVRGSLDTVSDWRLTRP
Ga0066670_1043926613300005560SoilMWFQLRSPELAEDFERLMAEDRDIVRGSLDTVSEWRL
Ga0066703_1066459913300005568SoilMWFQLRSPELAEDFERLMREDRDIVRGSMDTVSDWRLTRPADVPGQ
Ga0068852_10012662943300005616Corn RhizosphereMWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPADVP
Ga0068866_1128274123300005718Miscanthus RhizosphereMWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPADVPGQSIGQADYVL
Ga0068861_10029506913300005719Switchgrass RhizosphereMWFQLRSPELAEDFERLMTEDRDIVRGSLDTISDWRLTRPADVPGQSIG
Ga0068870_1075643523300005840Miscanthus RhizosphereMWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIGQ
Ga0068862_10034006333300005844Switchgrass RhizosphereMWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVPGQSIGQA
Ga0081455_1023376233300005937Tabebuia Heterophylla RhizosphereMAAEATLLMWFSLRSPELAEDFERLMASDRDIVRGSLDTMSGWRLTRPTDVPGQAG
Ga0070716_10112964713300006173Corn, Switchgrass And Miscanthus RhizosphereMWFSLRSPELAEDFERLMADDRDIVRGSLDTVSDWRLTRPLDVPGQSS
Ga0066660_1053501433300006800SoilMWFQLRSPELAEDFERLMAGDRDVVRGSLDTVTDWRLT
Ga0079220_1174260113300006806Agricultural SoilMWFQLRSPELAEDFERLMTGDRDIVRGSLDTVADWR
Ga0075431_10183799013300006847Populus RhizosphereMWFQLRSPDLAEDFERLMTEDRDIVRGSLDTISDWRLTRPADVPGQAIGQA
Ga0075434_10051483133300006871Populus RhizosphereMWFSLRSPELAEDFERLMAGDKDVVRGSLDTVTEWRLTRPLDVPGQS
Ga0079215_1017410813300006894Agricultural SoilMAAAATLVMWFSLRSPELAEDFERLMASDRDIVRSSLDTMSDWRLTRPLDVPGQAG
Ga0075419_1037295213300006969Populus RhizosphereMSPPATLLVWFQLRSPELAEDFERLMAEDRDIVSGSLDSISDWRLT
Ga0075419_1131003223300006969Populus RhizosphereMSPPATLVMWFQLRSPELAEDFERFMAEDRDIVRGSLDTVSDWRLTRPSDVPGQS
Ga0111539_1127933223300009094Populus RhizosphereMWFQLRSPELAGDFERLMTEDRDIVRGSLDTLSDWRLTRPADVPG
Ga0075418_1203641123300009100Populus RhizosphereMWFQLRSPELAEDFERLMTEDRDIVRGSLDAISDYRLTRPADVPGQSIGQADY
Ga0105243_1201217113300009148Miscanthus RhizosphereVWFLLRSPELAEEFERVMTEDREVVRGSLDAVSDWRLTRPADVPGQSIGQAD
Ga0111538_1149622513300009156Populus RhizosphereMWFQLRSPELAEDFERFMAEDRDIVRGSLDTISDWRLTRPSDVP
Ga0111538_1191911333300009156Populus RhizosphereMSAPATLLIWFQLRSPDLAGDFERLMAEDRDIVGGSLDTVSDWRLTR
Ga0111538_1290319613300009156Populus RhizosphereMWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQ
Ga0075423_1010978443300009162Populus RhizosphereMWFQLRSPELAEDFERLMAGDRDIVRGSLDTVSDWRLTR
Ga0105242_1171720113300009176Miscanthus RhizosphereMWFQLRSPELAEDFERLMTEDRDIVRSSLDTVSDWRLTRPAD
Ga0105242_1285685313300009176Miscanthus RhizosphereMAAAATLLMWFSLRSPDLAEDFERLMASDRDIVGDSLDTMSDYRLTRPMDVPGQA
Ga0105237_1018919213300009545Corn RhizosphereMWFQLRSPDLAKDFERLMTQDRDIVSGSLDTISDWRLT
Ga0105238_1140102113300009551Corn RhizosphereMWFQLRSPDLAEDFERLMTEDRDLVRGSLDTVSDWRLTRPADVP
Ga0126307_1171120713300009789Serpentine SoilMWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRL
Ga0105070_111565723300009815Groundwater SandMWFQLRSPELAEEFERLMASDRDIVHGSLDTMSDWRLTRPTDVPGQASESA
Ga0126313_1069148833300009840Serpentine SoilMSSPATLLLWFKLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRL
Ga0126304_1100981223300010037Serpentine SoilMWFQLRSPELAEDFERLMTEDRAIVRGSLDTVSDWRLMRPADVPGQSIGQ
Ga0126315_1027286913300010038Serpentine SoilMWFQLRSPELAEDFERLMTEDRDIVRGSLDTISDWR
Ga0126315_1048797423300010038Serpentine SoilMAAAATLVMWFSLRSPELAEDFERLMASDRDIVRGSLDTMSDWRLTR
Ga0126315_1098493713300010038Serpentine SoilMGAAATLIMWFSLRSPELAEDFERLMASDRDVVRGSLDTMSDWRLTRPMDVPG*
Ga0126308_1138088813300010040Serpentine SoilMWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVP
Ga0126314_1044112823300010042Serpentine SoilMWFQLRSPELAEDFERLMTKDRDIVGGSLDTISDWRLTRPADVPGQSIGQADY
Ga0126310_1090165013300010044Serpentine SoilMSPPATLLVWFKLRSPDLAEDFERLMAGDRDVVRTSLDTVSDWRLTRPADVPGQSL
Ga0126306_1154070223300010166Serpentine SoilMWFQLRSPELAEDFERLMTEDRAIVRGSLDTVSDWRLTRPADV
Ga0126372_1143398623300010360Tropical Forest SoilMAAAATLVMWFSLRSPELAEEFERLMAGDRDVVRGSLDTMSDWRLT
Ga0134128_1014784753300010373Terrestrial SoilMWFSLRSPELAEDFERLMASDRDIVFGSLDTMRDYRLTRPMDVPG
Ga0105239_1123678613300010375Corn RhizosphereMWFQLRSPELAKDFERLMADDRDVVSGSLDTMSDWRLTRPADVPGQSIGQAD
Ga0136449_10380879733300010379Peatlands SoilMWFRLRSPELAEDFERLMAEDRDIVRQALDTVSDWR
Ga0134126_1108129423300010396Terrestrial SoilMWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIGQAD
Ga0134123_1330396623300010403Terrestrial SoilMWFQLRSPELADDFVRLMTEDRDIVRGSLDTISDWRL
Ga0137424_112237813300011412SoilMAAAATLVMWFSLRSPELAEDFERLMASDRDIVRSSLDTMSDWRLTRP
Ga0137364_1139918313300012198Vadose Zone SoilMGLPATLLMWFQRRSPELAEDFERLMAEDRDIVRGSLDTVSDWRLTRPA
Ga0150985_11289932323300012212Avena Fatua RhizosphereMWFLLRSPELAEDFERLMTEERDIVRWSLDTVSDYRLTRPADVPGQSIGQADYVLIA
Ga0157300_106174513300012884SoilMWFSLRSPELAEDFERLMASDRDIVGGSLDTMSDYRLTRPM
Ga0157295_1028763613300012906SoilMWFSLRSPELAEEFERLMASDRDIVSSSLDTMSDYRLTR
Ga0157283_1008858023300012907SoilMWFSLRSPELAEDFERLMASDRDIVGGSLDTMSDYRLTRPMDVPGQASESA
Ga0137413_1146432613300012924Vadose Zone SoilMWFSLRSPELAEEFERLMADDRDVVRGSLDTVTDWRLTRPLDVPGQSSEAADYVLI
Ga0164298_1093825413300012955SoilMWFQLRSPELAEDFEQLMAGDRDIVRGSLDTVSDWRLTRPADVPGQS
Ga0164303_1114504813300012957SoilMWFQLRSPELAEDFERLMAEDRDIVRGSLDTMSNWRLMRPADVPGQAIG
Ga0164304_1072809313300012986SoilMWFSLRSPELAEDFERLMASDREIVSSSLDTMSDWRLTRPMD
Ga0164306_1095892413300012988SoilMWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLARPADVPGQSIG
Ga0157369_1095284113300013105Corn RhizosphereMWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIGQADYVL
Ga0163162_1244483113300013306Switchgrass RhizosphereMWFQLRSPELAEDFERLMADDRDIVSGSLDTMSDWRLTKPA
Ga0157372_1113659433300013307Corn RhizosphereMWFQLRSPELAEDFERLMAEDRDIVGGSLDTVSDWRLTRPAD
Ga0157375_1040037613300013308Miscanthus RhizosphereMWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIGQADYVLI
Ga0173483_1014926913300015077SoilMWFSLRSPELAEDFERLMASDRDVVRSSLDTMSDYRL
Ga0182033_1185807223300016319SoilMWSRLRSPELAEDFERVMAGDRDIVRGSLDPVSDRRLTRSADVPG
Ga0163161_1078984213300017792Switchgrass RhizosphereMWFQLRSPELAEEFERLMTDDRDIVRGSLDTISDWRLTRPAD
Ga0190266_1042320913300017965SoilMSAPATLLLWFQLRSPELADDFERLMAEDRDIVRGSLDTVSDWRLTRP
Ga0187780_1115948333300017973Tropical PeatlandMSPPATLLMWFQLRSPELAEDFERLMTRDRDIVRGSLDTVSDWRLTQPADVPGQAIG
Ga0184619_1004429113300018061Groundwater SedimentMWFQLRSPELAEDFERLMTEDRDIVNGSLNTVSDWRLTRPADVPGQSIG
Ga0187774_1067356713300018089Tropical PeatlandMWFQLRSPELAEDFERLMAGDRDVVRGSLDTVSDWRLTRPADVPGQSID
Ga0190265_1092222223300018422SoilMSSPATLLIWFQLRSPEMAGDFERLMTEDREIVRGSLDTLSDWRLTRPADVPGQ
Ga0066667_1133524223300018433Grasslands SoilMAAATLVMWFSLRSPELAEDFERLMASDRDIVRGSLDTMSDWRLTRPM
Ga0066662_1268794823300018468Grasslands SoilMWFQLRSPELAEDFERLMTADRDIVRGSLDTVSDWRLTRPADV
Ga0190270_1211360413300018469SoilMAAAATLVMWFSLRSPELAEDFERLMASDRDIVRSSLDTMSDWRLTRPMDVP
Ga0066669_1034448213300018482Grasslands SoilMWFSLRSPELAEDFERLMADDRDIVRGSLDTVSDWRLTRPLDVPGQSIEAADY
Ga0173482_1019251233300019361SoilMAPAATLLMWFSLRSPELAEDFERLMASDRDIVVGSLDTMSDYRLTRPMD
Ga0213882_1019663733300021362Exposed RockMSPPATLLMWFRLRSPELAEDFERLMAGDRDIVRGSLDTVSDWRLTRPADVPGQV
Ga0179589_1012929443300024288Vadose Zone SoilMWFALRSPELAEDFERLMAEDRDIVRGSLDTVSDWR
Ga0207647_1009775033300025904Corn RhizosphereMSPPATLVMWFQLRSPDLAKDFERLMTQDRDIVSGSLEMSNVDLSQEF
Ga0207643_1061225723300025908Miscanthus RhizosphereMWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIGQA
Ga0207693_1022818833300025915Corn, Switchgrass And Miscanthus RhizosphereMSPPATLIMWFQLRSPELAEDFERLMTEDRDIVGGSLDTVSDWRLTRPADVPGQSI
Ga0207657_1102055723300025919Corn RhizosphereMWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPAD
Ga0207649_1065494323300025920Corn RhizosphereMWFQLRSPDLAEDFERLMTEDRDIVGGSLDTISEWRLTRPADVPGQSIGQADY
Ga0207681_1067526923300025923Switchgrass RhizosphereMWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSI
Ga0207694_1116824313300025924Corn RhizosphereMWFQLRSPELAEEFERLMTDDRDIVRGSLDTISDWRLTRP
Ga0207690_1087046713300025932Corn RhizosphereMWFQLRSPELADEFERLMSDDRDIVRGSLDTVSDWRLTRPADVP
Ga0207690_1104594223300025932Corn RhizosphereVWFLLRSPELAEEFERVMTEDRDVVSGSLDTIANWRLTRPADVPGQSMG
Ga0207706_1138342523300025933Corn RhizosphereMWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQ
Ga0207704_1040440633300025938Miscanthus RhizosphereMWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPADV
Ga0207665_1131657413300025939Corn, Switchgrass And Miscanthus RhizosphereMWFQLRSPELAEDFERLMTDDRDIVRGSLDTVSDWRLTR
Ga0207689_1032613233300025942Miscanthus RhizosphereMWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPADVPGQSIGQADY
Ga0207668_1099364523300025972Switchgrass RhizosphereMWFSLRSPELAEDFERLMASDRDIVFGSLDTMRDYRLTRPMDVPGQA
Ga0207640_1103777713300025981Corn RhizosphereMWFQLRSPELADEFERLMSDDRDIVRGSLDTVSDWRLTRPADVPGQSIGS
Ga0207639_1117695813300026041Corn RhizosphereMWFQLRSPELAEEFERLMTDDRDIVRGALDTISDGRLTR
Ga0209106_106775213300027616Forest SoilMWFSLRSPELAEEFERLMADDRDIVRGSLDTVSDWRLTRPLDVPGQ
Ga0209106_109345013300027616Forest SoilMWFSLRSPELAEDFERLMADDRDIVRGSLDTVSDWR
Ga0208981_110895823300027669Forest SoilMWFQLRSPELAEDFERLMAEDRDIVRGSLDTVSDWRLTRPADVP
Ga0268265_1185139113300028380Switchgrass RhizosphereMWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSEWRLTRPADVPGQA
Ga0247822_1081723913300028592SoilMWFQLRSPDLAEEFERLMAEDRDIVGGSLDTVSDWRLTRPA
Ga0247822_1175683413300028592SoilMWFQLRSPDLAKDFERLMTQDRDIVSGSLDTISDWR
Ga0307276_1010688923300028705SoilMWFSLRSPELAEDFERLMASDRDVVRSSLDTMSDYRLTRPM
Ga0307276_1017796723300028705SoilMWFLLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVPGQSIGQADYV
Ga0307301_1004623823300028719SoilMWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVPGQAIG
Ga0307316_1033795313300028755SoilMWFLLRSPELAEDFERLMTEDRDIVRGSLDTVSDYRL
Ga0307320_1045826023300028771SoilMWFQLRSPELAEDFERLMTEDRDIVGGSLDTVSDWRLTRPADV
Ga0307282_1042303613300028784SoilMAAAATLVMWFHLRSPELAEEFERLMASDRDIVHGSLDTMPDWQLTRPMDVPGQA
Ga0307290_1006915813300028791SoilMWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPTD
Ga0247824_1041134223300028809SoilMWFQLRSPELAEEFERLMAEDRDIVGGSLDTVSDWR
Ga0307296_1078664023300028819SoilMSPPATLLMWFQLRSPELAEDFERLMREDRDIVRGSMDTVSDWRLTRPADV
Ga0307310_1045508213300028824SoilMWFSLRSPELAEDFERLMADDRDIVRGSLDTVSDWRLTRPLDVPGQSSEAAD
Ga0307286_1010196613300028876SoilMWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSEWRLT
Ga0307277_1031513013300028881SoilMAAATLVMWFSLRSPELAEEFERLMASDKDIVRGSLDTMSDWRLTRPTDVPGQA
Ga0307304_1034043313300028885SoilMAAAATLIMWFSLRSPELAEDFERLMASDRDIVRSSLDTMSDWRLTRPM
Ga0247826_1000513243300030336SoilMWFQLRSPELAEEFERLMAEDRDIVGGSLDTVSDWRLTRPADVPGQSIGQAD
Ga0318546_1090989513300031771SoilVHYAPWINPPATLLMWSRLRSPELAEDFERVMAGDRDIVRGSLDPVSDRRLTR
Ga0310904_1079334043300031854SoilMWFQLRSPELAEDFERLMTEDRDIVRGSLDTISEWRLTRPSDVPGQSI
Ga0307407_1023676813300031903RhizosphereMWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPAD
Ga0306921_1100247613300031912SoilMWSRLRSPELAEDIERVMAGDRDIVRGSLDPVSDRRLTRSADVPGN
Ga0307409_10248031123300031995RhizosphereMWFLLRSPELAEDFERLMTEDRDIVRGSLDTVSDYRLTRPADVPGQS
Ga0308176_1079557633300031996SoilMSPPATLLVWFKLRSPELAQDFERLMAGDRDVVRSSLDTVSDWRLTRPADVPG
Ga0308176_1161210013300031996SoilMWFLLRSPELAEDFERLMAEDRDIVRGSLDTVSEYRLTRPADVPGQSIGQ
Ga0308173_1025958013300032074SoilMMSSPATLLVWFKLRSPALAEDFERLMADDRDVVRSSLDTVSDWRLTRPADVPG
Ga0318518_1054729713300032090SoilMWFQLRSPELAEDFERLMTEDRDIVRGSLDTMSDWRLTRPA
Ga0247829_1116548133300033550SoilMWFQLRSPDLAEDFERLMTEDRDLVRGSLDTVSDWRLTRPADVPG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.