Basic Information | |
---|---|
Family ID | F046560 |
Family Type | Metagenome |
Number of Sequences | 151 |
Average Sequence Length | 46 residues |
Representative Sequence | MWFQLRSPELAEDFERLMAEDRDIVRGSLDTVSDWRLTRPADVP |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 151 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 8.82 % |
% of genes near scaffold ends (potentially truncated) | 88.74 % |
% of genes from short scaffolds (< 2000 bps) | 86.09 % |
Associated GOLD sequencing projects | 126 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.563 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.894 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.801 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.020 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 151 Family Scaffolds |
---|---|---|
PF12697 | Abhydrolase_6 | 5.96 |
PF06055 | ExoD | 3.97 |
PF00293 | NUDIX | 3.31 |
PF12680 | SnoaL_2 | 2.65 |
PF01243 | Putative_PNPOx | 1.99 |
PF13460 | NAD_binding_10 | 1.99 |
PF00989 | PAS | 1.32 |
PF00196 | GerE | 1.32 |
PF03401 | TctC | 0.66 |
PF13191 | AAA_16 | 0.66 |
PF00891 | Methyltransf_2 | 0.66 |
PF02627 | CMD | 0.66 |
PF00583 | Acetyltransf_1 | 0.66 |
PF11158 | DUF2938 | 0.66 |
PF00353 | HemolysinCabind | 0.66 |
PF00107 | ADH_zinc_N | 0.66 |
PF00383 | dCMP_cyt_deam_1 | 0.66 |
PF12902 | Ferritin-like | 0.66 |
PF00578 | AhpC-TSA | 0.66 |
PF00027 | cNMP_binding | 0.66 |
PF07992 | Pyr_redox_2 | 0.66 |
PF00486 | Trans_reg_C | 0.66 |
PF00561 | Abhydrolase_1 | 0.66 |
PF01435 | Peptidase_M48 | 0.66 |
PF13714 | PEP_mutase | 0.66 |
PF01740 | STAS | 0.66 |
PF13420 | Acetyltransf_4 | 0.66 |
PF05974 | DUF892 | 0.66 |
PF02782 | FGGY_C | 0.66 |
PF00248 | Aldo_ket_red | 0.66 |
PF01638 | HxlR | 0.66 |
PF01027 | Bax1-I | 0.66 |
PF08002 | DUF1697 | 0.66 |
PF07676 | PD40 | 0.66 |
PF12681 | Glyoxalase_2 | 0.66 |
PF03704 | BTAD | 0.66 |
PF01872 | RibD_C | 0.66 |
PF13487 | HD_5 | 0.66 |
PF08241 | Methyltransf_11 | 0.66 |
PF09851 | SHOCT | 0.66 |
PF07690 | MFS_1 | 0.66 |
PF02823 | ATP-synt_DE_N | 0.66 |
PF10604 | Polyketide_cyc2 | 0.66 |
PF14528 | LAGLIDADG_3 | 0.66 |
PF00326 | Peptidase_S9 | 0.66 |
PF06772 | LtrA | 0.66 |
PF01791 | DeoC | 0.66 |
COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
---|---|---|---|
COG3932 | Exopolysaccharide synthesis protein ExoD | Cell wall/membrane/envelope biogenesis [M] | 3.97 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.66 |
COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.66 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.66 |
COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.66 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.66 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.66 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.66 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.66 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.66 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.66 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.66 |
COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.66 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.56 % |
Unclassified | root | N/A | 34.44 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573003|GZIR7W401C3836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101322548 | Not Available | 779 | Open in IMG/M |
3300000955|JGI1027J12803_101795723 | Not Available | 783 | Open in IMG/M |
3300000955|JGI1027J12803_106216490 | Not Available | 607 | Open in IMG/M |
3300001686|C688J18823_10629802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
3300002568|C688J35102_119731688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
3300002568|C688J35102_120407981 | Not Available | 1046 | Open in IMG/M |
3300002568|C688J35102_120855321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1839 | Open in IMG/M |
3300003987|Ga0055471_10109574 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300004157|Ga0062590_101432303 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300004643|Ga0062591_100839481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 853 | Open in IMG/M |
3300005093|Ga0062594_103396301 | Not Available | 501 | Open in IMG/M |
3300005179|Ga0066684_10477198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 838 | Open in IMG/M |
3300005187|Ga0066675_10057845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 2417 | Open in IMG/M |
3300005327|Ga0070658_10634084 | Not Available | 927 | Open in IMG/M |
3300005337|Ga0070682_100839149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 750 | Open in IMG/M |
3300005347|Ga0070668_100214996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1583 | Open in IMG/M |
3300005355|Ga0070671_102028251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
3300005366|Ga0070659_100607240 | Not Available | 940 | Open in IMG/M |
3300005366|Ga0070659_101260737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
3300005435|Ga0070714_102313078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes lobatus | 523 | Open in IMG/M |
3300005447|Ga0066689_10903652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
3300005466|Ga0070685_10810685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
3300005560|Ga0066670_10224166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1135 | Open in IMG/M |
3300005560|Ga0066670_10241052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli | 1095 | Open in IMG/M |
3300005560|Ga0066670_10439266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 804 | Open in IMG/M |
3300005568|Ga0066703_10664599 | Not Available | 602 | Open in IMG/M |
3300005616|Ga0068852_100126629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2346 | Open in IMG/M |
3300005718|Ga0068866_11282741 | Not Available | 532 | Open in IMG/M |
3300005719|Ga0068861_100295069 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300005840|Ga0068870_10756435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
3300005844|Ga0068862_100340063 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
3300005937|Ga0081455_10233762 | Not Available | 1355 | Open in IMG/M |
3300006173|Ga0070716_101129647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
3300006800|Ga0066660_10535014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli | 984 | Open in IMG/M |
3300006806|Ga0079220_11742601 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300006847|Ga0075431_101837990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300006871|Ga0075434_100514831 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300006894|Ga0079215_10174108 | Not Available | 1058 | Open in IMG/M |
3300006969|Ga0075419_10372952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 974 | Open in IMG/M |
3300006969|Ga0075419_11310032 | Not Available | 538 | Open in IMG/M |
3300009094|Ga0111539_11279332 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300009100|Ga0075418_12036411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes polyasparticus | 625 | Open in IMG/M |
3300009148|Ga0105243_12012171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
3300009156|Ga0111538_11496225 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300009156|Ga0111538_11919113 | Not Available | 745 | Open in IMG/M |
3300009156|Ga0111538_12903196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
3300009162|Ga0075423_10109784 | Not Available | 2888 | Open in IMG/M |
3300009176|Ga0105242_11717201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
3300009176|Ga0105242_12856853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_3_64_12 | 533 | Open in IMG/M |
3300009545|Ga0105237_10189192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 2059 | Open in IMG/M |
3300009551|Ga0105238_11401021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
3300009789|Ga0126307_11711207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
3300009815|Ga0105070_1115657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
3300009840|Ga0126313_10691488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 826 | Open in IMG/M |
3300010037|Ga0126304_11009812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 567 | Open in IMG/M |
3300010038|Ga0126315_10272869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1037 | Open in IMG/M |
3300010038|Ga0126315_10487974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 784 | Open in IMG/M |
3300010038|Ga0126315_10984937 | Not Available | 564 | Open in IMG/M |
3300010040|Ga0126308_11380888 | Not Available | 500 | Open in IMG/M |
3300010042|Ga0126314_10441128 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300010044|Ga0126310_10901650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 689 | Open in IMG/M |
3300010166|Ga0126306_11540702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
3300010373|Ga0134128_10147847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2656 | Open in IMG/M |
3300010375|Ga0105239_11236786 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300010379|Ga0136449_103808797 | Not Available | 567 | Open in IMG/M |
3300010396|Ga0134126_11081294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
3300010403|Ga0134123_13303966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 520 | Open in IMG/M |
3300012198|Ga0137364_11399183 | Not Available | 518 | Open in IMG/M |
3300012212|Ga0150985_112899323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 755 | Open in IMG/M |
3300012907|Ga0157283_10088580 | Not Available | 804 | Open in IMG/M |
3300012924|Ga0137413_11464326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 554 | Open in IMG/M |
3300012955|Ga0164298_10938254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 633 | Open in IMG/M |
3300012957|Ga0164303_11145048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
3300012988|Ga0164306_10958924 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300013105|Ga0157369_10952841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 879 | Open in IMG/M |
3300013306|Ga0163162_12444831 | Not Available | 601 | Open in IMG/M |
3300013307|Ga0157372_11136594 | Not Available | 903 | Open in IMG/M |
3300013308|Ga0157375_10400376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1539 | Open in IMG/M |
3300016319|Ga0182033_11858072 | Not Available | 547 | Open in IMG/M |
3300017792|Ga0163161_10789842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
3300017965|Ga0190266_10423209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 748 | Open in IMG/M |
3300017973|Ga0187780_11159483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
3300018061|Ga0184619_10044291 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
3300018089|Ga0187774_10673567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli | 681 | Open in IMG/M |
3300018422|Ga0190265_10922222 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300018433|Ga0066667_11335242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
3300018468|Ga0066662_12687948 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300018469|Ga0190270_12113604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
3300018482|Ga0066669_10344482 | Not Available | 1234 | Open in IMG/M |
3300019361|Ga0173482_10192512 | Not Available | 829 | Open in IMG/M |
3300021362|Ga0213882_10196637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
3300024288|Ga0179589_10129294 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300025908|Ga0207643_10612257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
3300025915|Ga0207693_10228188 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
3300025919|Ga0207657_11020557 | Not Available | 634 | Open in IMG/M |
3300025920|Ga0207649_10654943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 812 | Open in IMG/M |
3300025923|Ga0207681_10675269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
3300025924|Ga0207694_11168243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
3300025932|Ga0207690_10870467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300025932|Ga0207690_11045942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
3300025933|Ga0207706_11383425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300025938|Ga0207704_10404406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1078 | Open in IMG/M |
3300025939|Ga0207665_11316574 | Not Available | 576 | Open in IMG/M |
3300025942|Ga0207689_10326132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1274 | Open in IMG/M |
3300025972|Ga0207668_10993645 | Not Available | 750 | Open in IMG/M |
3300025981|Ga0207640_11037777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
3300026041|Ga0207639_11176958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
3300027616|Ga0209106_1067752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 800 | Open in IMG/M |
3300027616|Ga0209106_1093450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
3300027669|Ga0208981_1108958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
3300028380|Ga0268265_11851391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
3300028592|Ga0247822_10817239 | Not Available | 760 | Open in IMG/M |
3300028592|Ga0247822_11756834 | Not Available | 529 | Open in IMG/M |
3300028705|Ga0307276_10177967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
3300028719|Ga0307301_10046238 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300028755|Ga0307316_10337953 | Not Available | 553 | Open in IMG/M |
3300028771|Ga0307320_10458260 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300028784|Ga0307282_10423036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 646 | Open in IMG/M |
3300028791|Ga0307290_10069158 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
3300028809|Ga0247824_10411342 | Not Available | 783 | Open in IMG/M |
3300028819|Ga0307296_10786640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300028824|Ga0307310_10455082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
3300028876|Ga0307286_10101966 | Not Available | 1008 | Open in IMG/M |
3300028881|Ga0307277_10315130 | Not Available | 695 | Open in IMG/M |
3300030336|Ga0247826_10005132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4674 | Open in IMG/M |
3300031771|Ga0318546_10909895 | Not Available | 619 | Open in IMG/M |
3300031854|Ga0310904_10793340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
3300031903|Ga0307407_10236768 | Not Available | 1243 | Open in IMG/M |
3300031912|Ga0306921_11002476 | Not Available | 942 | Open in IMG/M |
3300031995|Ga0307409_102480311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
3300031996|Ga0308176_10795576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 988 | Open in IMG/M |
3300031996|Ga0308176_11612100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
3300032074|Ga0308173_10259580 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
3300032090|Ga0318518_10547297 | Not Available | 592 | Open in IMG/M |
3300033550|Ga0247829_11165481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.28% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.30% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.64% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.31% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.65% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.99% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.99% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.99% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.99% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.32% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.32% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.32% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.66% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.66% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.66% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.66% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.66% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.66% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.66% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.66% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.66% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.66% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FE2_02822020 | 2189573003 | Grass Soil | MWFQLRSPDLAEDFERLMTDDRDIVRGSLDTVSDWRLTRPADVPGQ |
INPhiseqgaiiFebDRAFT_1013225482 | 3300000364 | Soil | MWFSLRSPELGEEFERLMTSDRDIVSSSLXTMSXXRXTRPTDVPGQ |
JGI1027J12803_1017957232 | 3300000955 | Soil | MWFQLRSPELAEDFERLMTGDRDIVRGSLDTVSDWR |
JGI1027J12803_1062164901 | 3300000955 | Soil | MSPPATLVMWFQLRSPELAEDFERLMTEDRDIVGGSLDTVSDWRLTRPADVP |
C688J18823_106298021 | 3300001686 | Soil | MIPPATLLMWFLLRSPELAEDFERLMTEDRDIVRGSLDTVSDYRLTRPADVPGQS |
C688J35102_1197316882 | 3300002568 | Soil | MWFLLRSPELAEDFERLMREDRDIVRGSLDTVSDYRLTRPADVPGQS |
C688J35102_1204079812 | 3300002568 | Soil | MWFLLRSPELADDFERLMTEDRDIVRGSLDTVSDYRLTRPAD |
C688J35102_1208553213 | 3300002568 | Soil | MMPPATLLMWFLLRSPALAEDFERLMTEDRDIVRGSLDTVSDYRLTRPADVPGQSI |
Ga0055471_101095741 | 3300003987 | Natural And Restored Wetlands | MWFQLRSPELAQDFERLMTEDRDIVRGSLDTVGDWRLARPADVPGQS |
Ga0063454_1018664392 | 3300004081 | Soil | MMPPATLLMWFLLRSPALAEDFERLMTEDRDIVRGSLDTVSDYR |
Ga0062590_1014323032 | 3300004157 | Soil | MAQATLVMWFSLRSPELADDFERLMASDRDIVSSSLDTMSDYRLTRPMDVPGQAG |
Ga0062591_1008394811 | 3300004643 | Soil | MAAAATLIMWFSLRSPELAEDFERLMASDRDIVRGSLDTMSDWRLTRPMDVPGQ |
Ga0062594_1033963011 | 3300005093 | Soil | MWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPADVPGQSIGQA |
Ga0066684_104771982 | 3300005179 | Soil | MSSPATLLMWFQLRSPELAEDFERLMAGDRDIVRGSLDTVSDWRLTRPADVPGQA |
Ga0066675_100578451 | 3300005187 | Soil | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVPGQ |
Ga0070658_106340841 | 3300005327 | Corn Rhizosphere | MSPPATLVMWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTR |
Ga0070682_1008391491 | 3300005337 | Corn Rhizosphere | MWFLLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVPGQSIG |
Ga0070691_106221072 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAGHATLLMWFSLRSPELAEDFERLMASDRDIVFGSLDTMRDYRL |
Ga0070692_104648812 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPPATLVMWFQLRSPDLAKDFERLMTQDRDIVSGSLDTIS |
Ga0070668_1002149961 | 3300005347 | Switchgrass Rhizosphere | MWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIG |
Ga0070671_1020282511 | 3300005355 | Switchgrass Rhizosphere | MWFQLRSPELADDFERLMTGDRDIVRGSLDTVSEWRLTRPADVP |
Ga0070673_1011958592 | 3300005364 | Switchgrass Rhizosphere | MSPPATLVMWFQLRSPELAKDFERLMADDRDVVSGSLDTMSDWR |
Ga0070659_1006072401 | 3300005366 | Corn Rhizosphere | MSPPATLVMWFQLRSPDLAKDFERLMTQDRDIVSGSLDTISDWRLT |
Ga0070659_1012607371 | 3300005366 | Corn Rhizosphere | MWFQLRSPDLAEDFERLMAEDRDIVRGSLDTISDWRLTRPADVPGQTM |
Ga0070714_1023130782 | 3300005435 | Agricultural Soil | MSPPATLLMWFQLRSPELAEDFERLMAGDRDIVRGSLDTVSDWRLTRP |
Ga0070694_1000840255 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VTATQATLLMWFSLRSPELAEDFERLMASDRDIVFGSLDTMRDYRL |
Ga0066689_109036522 | 3300005447 | Soil | MWFQLRSPELAEDFERLMAGDRDIVRGSLDTVSDWRLTRPADVPGQA |
Ga0070685_108106851 | 3300005466 | Switchgrass Rhizosphere | MSSPATLVMWFQLRSPDLAGEFEQLMAEDRDIVRGSLDTVSDWR |
Ga0070696_1006567831 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAAHATLLMWFSLRSPELAEDFERLMASDRDIVFGSLDTMRDYRL |
Ga0066670_102241663 | 3300005560 | Soil | MWFQLRSPELAEDFERLMAEDRDIVRGSLDTVSDWRLTRPAD |
Ga0066670_102410523 | 3300005560 | Soil | MWFQLRSPELAEDFERLMTGDRDIVRGSLDTVSDWRLTRP |
Ga0066670_104392661 | 3300005560 | Soil | MWFQLRSPELAEDFERLMAEDRDIVRGSLDTVSEWRL |
Ga0066703_106645991 | 3300005568 | Soil | MWFQLRSPELAEDFERLMREDRDIVRGSMDTVSDWRLTRPADVPGQ |
Ga0068852_1001266294 | 3300005616 | Corn Rhizosphere | MWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPADVP |
Ga0068866_112827412 | 3300005718 | Miscanthus Rhizosphere | MWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPADVPGQSIGQADYVL |
Ga0068861_1002950691 | 3300005719 | Switchgrass Rhizosphere | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTISDWRLTRPADVPGQSIG |
Ga0068870_107564352 | 3300005840 | Miscanthus Rhizosphere | MWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIGQ |
Ga0068862_1003400633 | 3300005844 | Switchgrass Rhizosphere | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVPGQSIGQA |
Ga0081455_102337623 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAAEATLLMWFSLRSPELAEDFERLMASDRDIVRGSLDTMSGWRLTRPTDVPGQAG |
Ga0070716_1011296471 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFSLRSPELAEDFERLMADDRDIVRGSLDTVSDWRLTRPLDVPGQSS |
Ga0066660_105350143 | 3300006800 | Soil | MWFQLRSPELAEDFERLMAGDRDVVRGSLDTVTDWRLT |
Ga0079220_117426011 | 3300006806 | Agricultural Soil | MWFQLRSPELAEDFERLMTGDRDIVRGSLDTVADWR |
Ga0075431_1018379901 | 3300006847 | Populus Rhizosphere | MWFQLRSPDLAEDFERLMTEDRDIVRGSLDTISDWRLTRPADVPGQAIGQA |
Ga0075434_1005148313 | 3300006871 | Populus Rhizosphere | MWFSLRSPELAEDFERLMAGDKDVVRGSLDTVTEWRLTRPLDVPGQS |
Ga0079215_101741081 | 3300006894 | Agricultural Soil | MAAAATLVMWFSLRSPELAEDFERLMASDRDIVRSSLDTMSDWRLTRPLDVPGQAG |
Ga0075419_103729521 | 3300006969 | Populus Rhizosphere | MSPPATLLVWFQLRSPELAEDFERLMAEDRDIVSGSLDSISDWRLT |
Ga0075419_113100322 | 3300006969 | Populus Rhizosphere | MSPPATLVMWFQLRSPELAEDFERFMAEDRDIVRGSLDTVSDWRLTRPSDVPGQS |
Ga0111539_112793322 | 3300009094 | Populus Rhizosphere | MWFQLRSPELAGDFERLMTEDRDIVRGSLDTLSDWRLTRPADVPG |
Ga0075418_120364112 | 3300009100 | Populus Rhizosphere | MWFQLRSPELAEDFERLMTEDRDIVRGSLDAISDYRLTRPADVPGQSIGQADY |
Ga0105243_120121711 | 3300009148 | Miscanthus Rhizosphere | VWFLLRSPELAEEFERVMTEDREVVRGSLDAVSDWRLTRPADVPGQSIGQAD |
Ga0111538_114962251 | 3300009156 | Populus Rhizosphere | MWFQLRSPELAEDFERFMAEDRDIVRGSLDTISDWRLTRPSDVP |
Ga0111538_119191133 | 3300009156 | Populus Rhizosphere | MSAPATLLIWFQLRSPDLAGDFERLMAEDRDIVGGSLDTVSDWRLTR |
Ga0111538_129031961 | 3300009156 | Populus Rhizosphere | MWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQ |
Ga0075423_101097844 | 3300009162 | Populus Rhizosphere | MWFQLRSPELAEDFERLMAGDRDIVRGSLDTVSDWRLTR |
Ga0105242_117172011 | 3300009176 | Miscanthus Rhizosphere | MWFQLRSPELAEDFERLMTEDRDIVRSSLDTVSDWRLTRPAD |
Ga0105242_128568531 | 3300009176 | Miscanthus Rhizosphere | MAAAATLLMWFSLRSPDLAEDFERLMASDRDIVGDSLDTMSDYRLTRPMDVPGQA |
Ga0105237_101891921 | 3300009545 | Corn Rhizosphere | MWFQLRSPDLAKDFERLMTQDRDIVSGSLDTISDWRLT |
Ga0105238_114010211 | 3300009551 | Corn Rhizosphere | MWFQLRSPDLAEDFERLMTEDRDLVRGSLDTVSDWRLTRPADVP |
Ga0126307_117112071 | 3300009789 | Serpentine Soil | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRL |
Ga0105070_11156572 | 3300009815 | Groundwater Sand | MWFQLRSPELAEEFERLMASDRDIVHGSLDTMSDWRLTRPTDVPGQASESA |
Ga0126313_106914883 | 3300009840 | Serpentine Soil | MSSPATLLLWFKLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRL |
Ga0126304_110098122 | 3300010037 | Serpentine Soil | MWFQLRSPELAEDFERLMTEDRAIVRGSLDTVSDWRLMRPADVPGQSIGQ |
Ga0126315_102728691 | 3300010038 | Serpentine Soil | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTISDWR |
Ga0126315_104879742 | 3300010038 | Serpentine Soil | MAAAATLVMWFSLRSPELAEDFERLMASDRDIVRGSLDTMSDWRLTR |
Ga0126315_109849371 | 3300010038 | Serpentine Soil | MGAAATLIMWFSLRSPELAEDFERLMASDRDVVRGSLDTMSDWRLTRPMDVPG* |
Ga0126308_113808881 | 3300010040 | Serpentine Soil | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVP |
Ga0126314_104411282 | 3300010042 | Serpentine Soil | MWFQLRSPELAEDFERLMTKDRDIVGGSLDTISDWRLTRPADVPGQSIGQADY |
Ga0126310_109016501 | 3300010044 | Serpentine Soil | MSPPATLLVWFKLRSPDLAEDFERLMAGDRDVVRTSLDTVSDWRLTRPADVPGQSL |
Ga0126306_115407022 | 3300010166 | Serpentine Soil | MWFQLRSPELAEDFERLMTEDRAIVRGSLDTVSDWRLTRPADV |
Ga0126372_114339862 | 3300010360 | Tropical Forest Soil | MAAAATLVMWFSLRSPELAEEFERLMAGDRDVVRGSLDTMSDWRLT |
Ga0134128_101478475 | 3300010373 | Terrestrial Soil | MWFSLRSPELAEDFERLMASDRDIVFGSLDTMRDYRLTRPMDVPG |
Ga0105239_112367861 | 3300010375 | Corn Rhizosphere | MWFQLRSPELAKDFERLMADDRDVVSGSLDTMSDWRLTRPADVPGQSIGQAD |
Ga0136449_1038087973 | 3300010379 | Peatlands Soil | MWFRLRSPELAEDFERLMAEDRDIVRQALDTVSDWR |
Ga0134126_110812942 | 3300010396 | Terrestrial Soil | MWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIGQAD |
Ga0134123_133039662 | 3300010403 | Terrestrial Soil | MWFQLRSPELADDFVRLMTEDRDIVRGSLDTISDWRL |
Ga0137424_11223781 | 3300011412 | Soil | MAAAATLVMWFSLRSPELAEDFERLMASDRDIVRSSLDTMSDWRLTRP |
Ga0137364_113991831 | 3300012198 | Vadose Zone Soil | MGLPATLLMWFQRRSPELAEDFERLMAEDRDIVRGSLDTVSDWRLTRPA |
Ga0150985_1128993232 | 3300012212 | Avena Fatua Rhizosphere | MWFLLRSPELAEDFERLMTEERDIVRWSLDTVSDYRLTRPADVPGQSIGQADYVLIA |
Ga0157300_10617451 | 3300012884 | Soil | MWFSLRSPELAEDFERLMASDRDIVGGSLDTMSDYRLTRPM |
Ga0157295_102876361 | 3300012906 | Soil | MWFSLRSPELAEEFERLMASDRDIVSSSLDTMSDYRLTR |
Ga0157283_100885802 | 3300012907 | Soil | MWFSLRSPELAEDFERLMASDRDIVGGSLDTMSDYRLTRPMDVPGQASESA |
Ga0137413_114643261 | 3300012924 | Vadose Zone Soil | MWFSLRSPELAEEFERLMADDRDVVRGSLDTVTDWRLTRPLDVPGQSSEAADYVLI |
Ga0164298_109382541 | 3300012955 | Soil | MWFQLRSPELAEDFEQLMAGDRDIVRGSLDTVSDWRLTRPADVPGQS |
Ga0164303_111450481 | 3300012957 | Soil | MWFQLRSPELAEDFERLMAEDRDIVRGSLDTMSNWRLMRPADVPGQAIG |
Ga0164304_107280931 | 3300012986 | Soil | MWFSLRSPELAEDFERLMASDREIVSSSLDTMSDWRLTRPMD |
Ga0164306_109589241 | 3300012988 | Soil | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLARPADVPGQSIG |
Ga0157369_109528411 | 3300013105 | Corn Rhizosphere | MWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIGQADYVL |
Ga0163162_124448311 | 3300013306 | Switchgrass Rhizosphere | MWFQLRSPELAEDFERLMADDRDIVSGSLDTMSDWRLTKPA |
Ga0157372_111365943 | 3300013307 | Corn Rhizosphere | MWFQLRSPELAEDFERLMAEDRDIVGGSLDTVSDWRLTRPAD |
Ga0157375_104003761 | 3300013308 | Miscanthus Rhizosphere | MWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIGQADYVLI |
Ga0173483_101492691 | 3300015077 | Soil | MWFSLRSPELAEDFERLMASDRDVVRSSLDTMSDYRL |
Ga0182033_118580722 | 3300016319 | Soil | MWSRLRSPELAEDFERVMAGDRDIVRGSLDPVSDRRLTRSADVPG |
Ga0163161_107898421 | 3300017792 | Switchgrass Rhizosphere | MWFQLRSPELAEEFERLMTDDRDIVRGSLDTISDWRLTRPAD |
Ga0190266_104232091 | 3300017965 | Soil | MSAPATLLLWFQLRSPELADDFERLMAEDRDIVRGSLDTVSDWRLTRP |
Ga0187780_111594833 | 3300017973 | Tropical Peatland | MSPPATLLMWFQLRSPELAEDFERLMTRDRDIVRGSLDTVSDWRLTQPADVPGQAIG |
Ga0184619_100442911 | 3300018061 | Groundwater Sediment | MWFQLRSPELAEDFERLMTEDRDIVNGSLNTVSDWRLTRPADVPGQSIG |
Ga0187774_106735671 | 3300018089 | Tropical Peatland | MWFQLRSPELAEDFERLMAGDRDVVRGSLDTVSDWRLTRPADVPGQSID |
Ga0190265_109222222 | 3300018422 | Soil | MSSPATLLIWFQLRSPEMAGDFERLMTEDREIVRGSLDTLSDWRLTRPADVPGQ |
Ga0066667_113352422 | 3300018433 | Grasslands Soil | MAAATLVMWFSLRSPELAEDFERLMASDRDIVRGSLDTMSDWRLTRPM |
Ga0066662_126879482 | 3300018468 | Grasslands Soil | MWFQLRSPELAEDFERLMTADRDIVRGSLDTVSDWRLTRPADV |
Ga0190270_121136041 | 3300018469 | Soil | MAAAATLVMWFSLRSPELAEDFERLMASDRDIVRSSLDTMSDWRLTRPMDVP |
Ga0066669_103444821 | 3300018482 | Grasslands Soil | MWFSLRSPELAEDFERLMADDRDIVRGSLDTVSDWRLTRPLDVPGQSIEAADY |
Ga0173482_101925123 | 3300019361 | Soil | MAPAATLLMWFSLRSPELAEDFERLMASDRDIVVGSLDTMSDYRLTRPMD |
Ga0213882_101966373 | 3300021362 | Exposed Rock | MSPPATLLMWFRLRSPELAEDFERLMAGDRDIVRGSLDTVSDWRLTRPADVPGQV |
Ga0179589_101292944 | 3300024288 | Vadose Zone Soil | MWFALRSPELAEDFERLMAEDRDIVRGSLDTVSDWR |
Ga0207647_100977503 | 3300025904 | Corn Rhizosphere | MSPPATLVMWFQLRSPDLAKDFERLMTQDRDIVSGSLEMSNVDLSQEF |
Ga0207643_106122572 | 3300025908 | Miscanthus Rhizosphere | MWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSIGQA |
Ga0207693_102281883 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPPATLIMWFQLRSPELAEDFERLMTEDRDIVGGSLDTVSDWRLTRPADVPGQSI |
Ga0207657_110205572 | 3300025919 | Corn Rhizosphere | MWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPAD |
Ga0207649_106549432 | 3300025920 | Corn Rhizosphere | MWFQLRSPDLAEDFERLMTEDRDIVGGSLDTISEWRLTRPADVPGQSIGQADY |
Ga0207681_106752692 | 3300025923 | Switchgrass Rhizosphere | MWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQPADVPGQSI |
Ga0207694_111682431 | 3300025924 | Corn Rhizosphere | MWFQLRSPELAEEFERLMTDDRDIVRGSLDTISDWRLTRP |
Ga0207690_108704671 | 3300025932 | Corn Rhizosphere | MWFQLRSPELADEFERLMSDDRDIVRGSLDTVSDWRLTRPADVP |
Ga0207690_110459422 | 3300025932 | Corn Rhizosphere | VWFLLRSPELAEEFERVMTEDRDVVSGSLDTIANWRLTRPADVPGQSMG |
Ga0207706_113834252 | 3300025933 | Corn Rhizosphere | MWFQLRSPELAEEFERLMAGDRDVVRGSLDTVSDWRLMQ |
Ga0207704_104044063 | 3300025938 | Miscanthus Rhizosphere | MWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPADV |
Ga0207665_113165741 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFQLRSPELAEDFERLMTDDRDIVRGSLDTVSDWRLTR |
Ga0207689_103261323 | 3300025942 | Miscanthus Rhizosphere | MWFQLRSPDLAEDFERLMAQDRDIVGGSLDTVSDWRLTRPADVPGQSIGQADY |
Ga0207668_109936452 | 3300025972 | Switchgrass Rhizosphere | MWFSLRSPELAEDFERLMASDRDIVFGSLDTMRDYRLTRPMDVPGQA |
Ga0207640_110377771 | 3300025981 | Corn Rhizosphere | MWFQLRSPELADEFERLMSDDRDIVRGSLDTVSDWRLTRPADVPGQSIGS |
Ga0207639_111769581 | 3300026041 | Corn Rhizosphere | MWFQLRSPELAEEFERLMTDDRDIVRGALDTISDGRLTR |
Ga0209106_10677521 | 3300027616 | Forest Soil | MWFSLRSPELAEEFERLMADDRDIVRGSLDTVSDWRLTRPLDVPGQ |
Ga0209106_10934501 | 3300027616 | Forest Soil | MWFSLRSPELAEDFERLMADDRDIVRGSLDTVSDWR |
Ga0208981_11089582 | 3300027669 | Forest Soil | MWFQLRSPELAEDFERLMAEDRDIVRGSLDTVSDWRLTRPADVP |
Ga0268265_118513911 | 3300028380 | Switchgrass Rhizosphere | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSEWRLTRPADVPGQA |
Ga0247822_108172391 | 3300028592 | Soil | MWFQLRSPDLAEEFERLMAEDRDIVGGSLDTVSDWRLTRPA |
Ga0247822_117568341 | 3300028592 | Soil | MWFQLRSPDLAKDFERLMTQDRDIVSGSLDTISDWR |
Ga0307276_101068892 | 3300028705 | Soil | MWFSLRSPELAEDFERLMASDRDVVRSSLDTMSDYRLTRPM |
Ga0307276_101779672 | 3300028705 | Soil | MWFLLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVPGQSIGQADYV |
Ga0307301_100462382 | 3300028719 | Soil | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPADVPGQAIG |
Ga0307316_103379531 | 3300028755 | Soil | MWFLLRSPELAEDFERLMTEDRDIVRGSLDTVSDYRL |
Ga0307320_104582602 | 3300028771 | Soil | MWFQLRSPELAEDFERLMTEDRDIVGGSLDTVSDWRLTRPADV |
Ga0307282_104230361 | 3300028784 | Soil | MAAAATLVMWFHLRSPELAEEFERLMASDRDIVHGSLDTMPDWQLTRPMDVPGQA |
Ga0307290_100691581 | 3300028791 | Soil | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPTD |
Ga0247824_104113422 | 3300028809 | Soil | MWFQLRSPELAEEFERLMAEDRDIVGGSLDTVSDWR |
Ga0307296_107866402 | 3300028819 | Soil | MSPPATLLMWFQLRSPELAEDFERLMREDRDIVRGSMDTVSDWRLTRPADV |
Ga0307310_104550821 | 3300028824 | Soil | MWFSLRSPELAEDFERLMADDRDIVRGSLDTVSDWRLTRPLDVPGQSSEAAD |
Ga0307286_101019661 | 3300028876 | Soil | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSEWRLT |
Ga0307277_103151301 | 3300028881 | Soil | MAAATLVMWFSLRSPELAEEFERLMASDKDIVRGSLDTMSDWRLTRPTDVPGQA |
Ga0307304_103404331 | 3300028885 | Soil | MAAAATLIMWFSLRSPELAEDFERLMASDRDIVRSSLDTMSDWRLTRPM |
Ga0247826_100051324 | 3300030336 | Soil | MWFQLRSPELAEEFERLMAEDRDIVGGSLDTVSDWRLTRPADVPGQSIGQAD |
Ga0318546_109098951 | 3300031771 | Soil | VHYAPWINPPATLLMWSRLRSPELAEDFERVMAGDRDIVRGSLDPVSDRRLTR |
Ga0310904_107933404 | 3300031854 | Soil | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTISEWRLTRPSDVPGQSI |
Ga0307407_102367681 | 3300031903 | Rhizosphere | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTVSDWRLTRPAD |
Ga0306921_110024761 | 3300031912 | Soil | MWSRLRSPELAEDIERVMAGDRDIVRGSLDPVSDRRLTRSADVPGN |
Ga0307409_1024803112 | 3300031995 | Rhizosphere | MWFLLRSPELAEDFERLMTEDRDIVRGSLDTVSDYRLTRPADVPGQS |
Ga0308176_107955763 | 3300031996 | Soil | MSPPATLLVWFKLRSPELAQDFERLMAGDRDVVRSSLDTVSDWRLTRPADVPG |
Ga0308176_116121001 | 3300031996 | Soil | MWFLLRSPELAEDFERLMAEDRDIVRGSLDTVSEYRLTRPADVPGQSIGQ |
Ga0308173_102595801 | 3300032074 | Soil | MMSSPATLLVWFKLRSPALAEDFERLMADDRDVVRSSLDTVSDWRLTRPADVPG |
Ga0318518_105472971 | 3300032090 | Soil | MWFQLRSPELAEDFERLMTEDRDIVRGSLDTMSDWRLTRPA |
Ga0247829_111654813 | 3300033550 | Soil | MWFQLRSPDLAEDFERLMTEDRDLVRGSLDTVSDWRLTRPADVPG |
⦗Top⦘ |